F448346

General Info

Members Datasets Scaffolds Average Seq Length
459 249 918 134

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10183696|Ga0105245_101836963
Length 145
Sequence LIVLVWGERLARECMFTIDHLGIAVKSLTSAKGIYEKLGLSVSPEEVVEGERVKVVMIPVGESRLELLEPTTEDSTVAKFLAKRGEGLHHVSLRVPDLAAVVTKLKQDGVRLVSDEIKIGAGGHRYVFVHPSSAGGVLLELVEEH

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
112 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
184 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
185 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
186 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
187 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
188 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
189 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
220 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
224 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 1.31
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.75
Rhizosphere 91.5
Stem 0
Stem Tuber 0
Unclassified 25.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10183696 3300009098 Bacteria 1999
2 LJNas_1000215 3300000546 Bacteria 9831
3 JGI24752J21851_1007272 3300001976 Bacteria 1444
4 JGI24748J21848_1041365 3300002074 Unclassified 587
5 JGI24034J26672_10010016 3300002239 Bacteria 1405
6 JGI24751J29686_10011539 3300002459 Bacteria 1822
7 rootL2_10105497 3300003322 Bacteria 3935
8 Ga0065715_10125539 3300005293 Bacteria 2128
9 Ga0065715_10339530 3300005293 Unclassified 969
10 Ga0070658_10019630 3300005327 Bacteria 5412
11 Ga0070676_10011637 3300005328 Bacteria 4785
12 Ga0070683_100043815 3300005329 Bacteria 4124
13 Ga0070690_100039888 3300005330 Bacteria 2968
14 Ga0070670_100152513 3300005331 Bacteria 2000
15 Ga0070670_100162551 3300005331 Bacteria 1935
16 Ga0070677_10018288 3300005333 Bacteria 2522
17 Ga0068869_100004379 3300005334 Bacteria 8767
18 Ga0068869_100458608 3300005334 Bacteria 1058
19 Ga0070666_10017323 3300005335 Bacteria 4618
20 Ga0070682_100017628 3300005337 Bacteria 4165
21 Ga0070682_101326038 3300005337 Unclassified 612
22 Ga0068868_100049239 3300005338 Bacteria 3307
23 Ga0068868_100083499 3300005338 Bacteria 2564
24 Ga0070660_100022885 3300005339 Bacteria 4627
25 Ga0070689_100011061 3300005340 Bacteria 6453
26 Ga0070691_10264053 3300005341 Bacteria 928
27 Ga0070661_100010243 3300005344 Bacteria 6512
28 Ga0070668_100010215 3300005347 Bacteria 6963
29 Ga0070669_100290434 3300005353 Bacteria 1312
30 Ga0070675_100060535 3300005354 Bacteria 3126
31 Ga0070674_100044711 3300005356 Bacteria 3021
32 Ga0070673_100029008 3300005364 Bacteria 4122
33 Ga0070688_100021640 3300005365 Bacteria 3758
34 Ga0070659_100091584 3300005366 Bacteria 2437
35 Ga0070667_101027506 3300005367 Bacteria 769
36 Ga0070667_101517537 3300005367 Unclassified 629
37 Ga0070709_10086596 3300005434 Bacteria 2057
38 Ga0070709_10107331 3300005434 Bacteria 1871
39 Ga0070709_11687287 3300005434 Unclassified 517
40 Ga0070714_100000128 3300005435 Bacteria 59542
41 Ga0070714_100086054 3300005435 Bacteria 2746
42 Ga0070714_100200424 3300005435 Bacteria 1825
43 Ga0070714_100777505 3300005435 Unclassified 926
44 Ga0070714_101085777 3300005435 Unclassified 780
45 Ga0070713_100015878 3300005436 Bacteria 5645
46 Ga0070713_100058913 3300005436 Unclassified 3204
47 Ga0070713_100510571 3300005436 Bacteria 1135
48 Ga0070710_10098547 3300005437 Bacteria 1737
49 Ga0070711_100229815 3300005439 Bacteria 1446
50 Ga0070711_100521640 3300005439 Bacteria 982
51 Ga0070705_100118820 3300005440 Bacteria 1703
52 Ga0070700_100173880 3300005441 Unclassified 1493
53 Ga0070694_100361893 3300005444 Bacteria 1127
54 Ga0070708_100002433 3300005445 Bacteria 14437
55 Ga0070708_100070700 3300005445 Unclassified 3140
56 Ga0070708_100082867 3300005445 Bacteria 2906
57 Ga0070708_100181185 3300005445 Bacteria 1969
58 Ga0070708_100900201 3300005445 Unclassified 831
59 Ga0070663_100241713 3300005455 Unclassified 1425
60 Ga0070663_101491706 3300005455 Bacteria 601
61 Ga0070678_100033309 3300005456 Bacteria 3576
62 Ga0070662_100047295 3300005457 Bacteria 3094
63 Ga0070681_10136474 3300005458 Bacteria 2384
64 Ga0070681_10569036 3300005458 Unclassified 1047
65 Ga0068867_100039615 3300005459 Bacteria 3436
66 Ga0068867_100073152 3300005459 Bacteria 2567
67 Ga0070685_10061613 3300005466 Bacteria 2197
68 Ga0070685_10073263 3300005466 Bacteria 2035
69 Ga0070685_10451762 3300005466 Unclassified 900
70 Ga0070706_100001770 3300005467 Bacteria 22364
71 Ga0070706_100103642 3300005467 Bacteria 2645
72 Ga0070706_100413830 3300005467 Unclassified 1255
73 Ga0070707_100236867 3300005468 Bacteria 1776
74 Ga0070707_100418635 3300005468 Bacteria 1300
75 Ga0070698_100127462 3300005471 Bacteria 2502
76 Ga0070698_100402462 3300005471 Unclassified 1302
77 Ga0070699_100240964 3300005518 Bacteria 1614
78 Ga0070684_100039308 3300005535 Bacteria 4068
79 Ga0070697_100000902 3300005536 Bacteria 22350
80 Ga0070697_100282385 3300005536 Bacteria 1425
81 Ga0070697_100723055 3300005536 Unclassified 879
82 Ga0068853_100104737 3300005539 Bacteria 2505
83 Ga0068853_100126949 3300005539 Bacteria 2279
84 Ga0068853_100873668 3300005539 Unclassified 863
85 Ga0070672_100079926 3300005543 Bacteria 2618
86 Ga0070672_101166714 3300005543 Unclassified 686
87 Ga0070686_100017238 3300005544 Bacteria 4217
88 Ga0070686_100030478 3300005544 Bacteria 3291
89 Ga0070686_100130877 3300005544 Bacteria 1735
90 Ga0070695_100164303 3300005545 Bacteria 1561
91 Ga0070695_100613437 3300005545 Unclassified 855
92 Ga0070696_100040632 3300005546 Bacteria 3211
93 Ga0070696_100591818 3300005546 Bacteria 893
94 Ga0070693_100070313 3300005547 Bacteria 2059
95 Ga0070693_100384905 3300005547 Unclassified 968
96 Ga0068855_100126872 3300005563 Bacteria 2917
97 Ga0068855_100590186 3300005563 Unclassified 1199
98 Ga0070664_100503520 3300005564 Unclassified 1116
99 Ga0070664_100599571 3300005564 Bacteria 1021
100 Ga0068857_100010903 3300005577 Bacteria 7910
101 Ga0068857_100233355 3300005577 Unclassified 1683
102 Ga0068854_100550495 3300005578 Unclassified 978
103 Ga0068856_100006740 3300005614 Bacteria 11254
104 Ga0068856_100094894 3300005614 Bacteria 2970
105 Ga0068856_100700589 3300005614 Bacteria 1033
106 Ga0070702_100151605 3300005615 Bacteria 1489
107 Ga0068852_100004955 3300005616 Bacteria 9460
108 Ga0068852_102584067 3300005616 Unclassified 527
109 Ga0068859_100030882 3300005617 Bacteria 5376
110 Ga0068859_100349070 3300005617 Unclassified 1574
111 Ga0068864_100219057 3300005618 Bacteria 1755
112 Ga0068864_100395615 3300005618 Unclassified 1312
113 Ga0068866_10006361 3300005718 Bacteria 4916
114 Ga0068866_10901411 3300005718 Bacteria 622
115 Ga0068861_100040667 3300005719 Bacteria 3478
116 Ga0068851_10065903 3300005834 Unclassified 1865
117 Ga0068870_10044127 3300005840 Bacteria 2328
118 Ga0068863_100024129 3300005841 Bacteria 5802
119 Ga0068858_100001067 3300005842 Bacteria 28344
120 Ga0068858_100031579 3300005842 Bacteria 4920
121 Ga0068860_100022618 3300005843 Bacteria 6078
122 Ga0068860_100162295 3300005843 Bacteria 2155
123 Ga0068860_100299776 3300005843 Unclassified 1574
124 Ga0068862_100025624 3300005844 Bacteria 4952
125 Ga0070717_10001911 3300006028 Bacteria 14564
126 Ga0070717_10010130 3300006028 Bacteria 7098
127 Ga0070717_10010950 3300006028 Bacteria 6868
128 Ga0070717_10061605 3300006028 Bacteria 3110
129 Ga0070717_10071635 3300006028 Bacteria 2892
130 Ga0070717_10170115 3300006028 Unclassified 1895
131 Ga0070717_10893758 3300006028 Bacteria 809
132 Ga0070716_100001801 3300006173 Bacteria 9710
133 Ga0070716_100143161 3300006173 Bacteria 1528
134 Ga0070716_100224047 3300006173 Bacteria 1265
135 Ga0070716_100791010 3300006173 Unclassified 733
136 Ga0070716_101081892 3300006173 Unclassified 638
137 Ga0070716_101438938 3300006173 Bacteria 561
138 Ga0070712_100027094 3300006175 Bacteria 3824
139 Ga0070712_100270487 3300006175 Bacteria 1365
140 Ga0070712_101179108 3300006175 Unclassified 666
141 Ga0070712_101225584 3300006175 Unclassified 653
142 Ga0097621_100018894 3300006237 Bacteria 5278
143 Ga0097621_100666808 3300006237 Unclassified 955
144 Ga0097621_101173815 3300006237 Bacteria 722
145 Ga0068871_100042279 3300006358 Unclassified 3658
146 Ga0068871_100090909 3300006358 Bacteria 2543
147 Ga0068871_100456988 3300006358 Unclassified 1145
148 Ga0068871_100899674 3300006358 Unclassified 820
149 Ga0068865_100018218 3300006881 Bacteria 4529
150 Ga0068865_100035913 3300006881 Bacteria 3337
151 Ga0068865_100049379 3300006881 Bacteria 2900
152 Ga0075436_100009322 3300006914 Bacteria 6713
153 Ga0097620_100030881 3300006931 Bacteria 5376
154 Ga0097620_100349054 3300006931 Unclassified 1574
155 Ga0075435_100006567 3300007076 Bacteria 8230
156 Ga0075435_100298651 3300007076 Bacteria 1377
157 Ga0105250_10008646 3300009092 Bacteria 4315
158 Ga0105250_10210237 3300009092 Unclassified 822
159 Ga0105240_10037841 3300009093 Bacteria 6196
160 Ga0105240_10405587 3300009093 Bacteria 1534
161 Ga0111539_11452974 3300009094 Unclassified 795
162 Ga0105245_10327436 3300009098 Bacteria 1511
163 Ga0105245_10438019 3300009098 Unclassified 1313
164 Ga0105247_10027564 3300009101 Bacteria 3434
165 Ga0105247_10045966 3300009101 Bacteria 2680
166 Ga0105247_10441413 3300009101 Bacteria 936
167 Ga0105243_10066646 3300009148 Bacteria 2896
168 Ga0105243_10168164 3300009148 Bacteria 1897
169 Ga0105243_11346141 3300009148 Unclassified 733
170 Ga0105241_10001259 3300009174 Bacteria 19306
171 Ga0105241_10063812 3300009174 Bacteria 2843
172 Ga0105241_10245526 3300009174 Unclassified 1515
173 Ga0105241_10277932 3300009174 Bacteria 1429
174 Ga0105241_11072935 3300009174 Bacteria 757
175 Ga0105242_10009635 3300009176 Bacteria 7402
176 Ga0105242_10065599 3300009176 Bacteria 2995
177 Ga0105242_10201910 3300009176 Bacteria 1766
178 Ga0105248_11124747 3300009177 Unclassified 888
179 Ga0105237_10011352 3300009545 Bacteria 9426
180 Ga0105237_10018216 3300009545 Bacteria 7266
181 Ga0105237_10313679 3300009545 Unclassified 1571
182 Ga0105249_10095998 3300009553 Bacteria 2780
183 Ga0105239_10014054 3300010375 Bacteria 8887
184 Ga0105239_10083648 3300010375 Bacteria 3515
185 Ga0105239_10691300 3300010375 Bacteria 1166
186 Ga0105246_11799071 3300011119 Unclassified 585
187 Ga0157373_10001333 3300013100 Bacteria 18897
188 Ga0157373_10020961 3300013100 Bacteria 4745
189 Ga0157373_10043949 3300013100 Bacteria 3190
190 Ga0157373_10046508 3300013100 Bacteria 3097
191 Ga0157371_10007438 3300013102 Bacteria 8868
192 Ga0157371_10226640 3300013102 Unclassified 1342
193 Ga0157370_10136138 3300013104 Unclassified 2289
194 Ga0157370_10150403 3300013104 Unclassified 2166
195 Ga0157369_10046899 3300013105 Bacteria 4694
196 Ga0157369_10371306 3300013105 Unclassified 1485
197 Ga0157369_12448479 3300013105 Bacteria 529
198 Ga0157374_10012969 3300013296 Bacteria 7266
199 Ga0157374_10023534 3300013296 Bacteria 5511
200 Ga0157374_10032815 3300013296 Bacteria 4731
201 Ga0157374_11891188 3300013296 Unclassified 622
202 Ga0157378_10122520 3300013297 Bacteria 2398
203 Ga0157378_10336539 3300013297 Bacteria 1470
204 Ga0157378_10564268 3300013297 Unclassified 1145
205 Ga0157378_10959746 3300013297 Unclassified 888
206 Ga0163162_10035620 3300013306 Bacteria 4959
207 Ga0163162_10047312 3300013306 Bacteria 4311
208 Ga0163162_10297184 3300013306 Bacteria 1746
209 Ga0163162_10347826 3300013306 Bacteria 1615
210 Ga0157372_11137663 3300013307 Bacteria 903
211 Ga0157372_11836034 3300013307 Unclassified 697
212 Ga0157375_10257948 3300013308 Bacteria 1905
213 Ga0157375_10477170 3300013308 Bacteria 1412
214 Ga0157375_10497427 3300013308 Unclassified 1383
215 Ga0157375_11403268 3300013308 Bacteria 823
216 Ga0163163_10012687 3300014325 Bacteria 7686
217 Ga0163163_10124577 3300014325 Bacteria 2613
218 Ga0157380_11917583 3300014326 Unclassified 653
219 Ga0157377_10006876 3300014745 Bacteria 5454
220 Ga0157377_10044436 3300014745 Bacteria 2477
221 Ga0157379_10003230 3300014968 Bacteria 13811
222 Ga0157379_10077141 3300014968 Bacteria 2984
223 Ga0157376_10374566 3300014969 Bacteria 1369
224 Ga0157376_10473973 3300014969 Bacteria 1225
225 Ga0157376_10576979 3300014969 Unclassified 1116
226 Ga0163161_10003472 3300017792 Bacteria 11047
227 Ga0224569_100149 3300022732 Bacteria 5354
228 Ga0224571_105480 3300022734 Unclassified 835
229 Ga0224572_1057558 3300024225 Unclassified 721
230 Ga0228598_1000707 3300024227 Bacteria 7102
231 Ga0228598_1002428 3300024227 Bacteria 4069
232 Ga0207697_10005131 3300025315 Bacteria 6125
233 Ga0207656_10066450 3300025321 Unclassified 1594
234 Ga0207692_10062007 3300025898 Unclassified 1940
235 Ga0207642_10004583 3300025899 Bacteria 4465
236 Ga0207642_10423366 3300025899 Bacteria 801
237 Ga0207710_10101677 3300025900 Unclassified 1356
238 Ga0207680_10057746 3300025903 Bacteria 2349
239 Ga0207647_10011204 3300025904 Bacteria 6296
240 Ga0207647_10043848 3300025904 Bacteria 2797
241 Ga0207647_10248701 3300025904 Bacteria 1020
242 Ga0207699_10070028 3300025906 Bacteria 2140
243 Ga0207699_10112091 3300025906 Bacteria 1750
244 Ga0207645_10000021 3300025907 Bacteria 104186
245 Ga0207643_10007444 3300025908 Bacteria 5874
246 Ga0207705_10034163 3300025909 Bacteria 3636
247 Ga0207684_10002047 3300025910 Bacteria 20752
248 Ga0207684_10060046 3300025910 Bacteria 3229
249 Ga0207684_10370863 3300025910 Unclassified 1231
250 Ga0207654_10036484 3300025911 Bacteria 2747
251 Ga0207654_10079306 3300025911 Bacteria 1972
252 Ga0207654_10220359 3300025911 Unclassified 1258
253 Ga0207707_10016277 3300025912 Bacteria 6487
254 Ga0207707_10270819 3300025912 Bacteria 1472
255 Ga0207707_10309989 3300025912 Unclassified 1364
256 Ga0207671_10052039 3300025914 Bacteria 3034
257 Ga0207671_10076388 3300025914 Bacteria 2506
258 Ga0207671_10261906 3300025914 Unclassified 1361
259 Ga0207693_10014864 3300025915 Bacteria 6253
260 Ga0207693_10336463 3300025915 Bacteria 1181
261 Ga0207693_10398650 3300025915 Bacteria 1076
262 Ga0207663_10039641 3300025916 Bacteria 2856
263 Ga0207663_10268928 3300025916 Bacteria 1262
264 Ga0207663_11464786 3300025916 Bacteria 550
265 Ga0207660_10191627 3300025917 Bacteria 1592
266 Ga0207657_10001918 3300025919 Bacteria 22449
267 Ga0207649_10000836 3300025920 Bacteria 19838
268 Ga0207649_10129813 3300025920 Unclassified 1710
269 Ga0207652_10119685 3300025921 Bacteria 2342
270 Ga0207646_10112026 3300025922 Unclassified 2449
271 Ga0207681_10126049 3300025923 Bacteria 1885
272 Ga0207650_10000097 3300025925 Bacteria 115583
273 Ga0207650_10049622 3300025925 Bacteria 3100
274 Ga0207659_10042252 3300025926 Bacteria 3195
275 Ga0207659_11520527 3300025926 Unclassified 572
276 Ga0207687_10711425 3300025927 Unclassified 853
277 Ga0207687_10931243 3300025927 Unclassified 744
278 Ga0207700_10045398 3300025928 Unclassified 3242
279 Ga0207700_10049133 3300025928 Bacteria 3136
280 Ga0207700_10520411 3300025928 Bacteria 1054
281 Ga0207664_10000033 3300025929 Bacteria 176549
282 Ga0207644_10053885 3300025931 Bacteria 2895
283 Ga0207690_10011645 3300025932 Bacteria 5256
284 Ga0207706_10000048 3300025933 Bacteria 117454
285 Ga0207706_11506684 3300025933 Unclassified 548
286 Ga0207686_10479775 3300025934 Bacteria 961
287 Ga0207709_10623595 3300025935 Unclassified 856
288 Ga0207670_10148711 3300025936 Bacteria 1735
289 Ga0207669_10118364 3300025937 Bacteria 1792
290 Ga0207704_10009462 3300025938 Bacteria 4703
291 Ga0207704_10092971 3300025938 Bacteria 1987
292 Ga0207665_10003172 3300025939 Bacteria 11015
293 Ga0207665_10059946 3300025939 Bacteria 2576
294 Ga0207665_10172381 3300025939 Bacteria 1563
295 Ga0207665_11403592 3300025939 Unclassified 556
296 Ga0207691_10000721 3300025940 Bacteria 32643
297 Ga0207691_11027281 3300025940 Unclassified 687
298 Ga0207711_10068196 3300025941 Bacteria 3080
299 Ga0207689_10000078 3300025942 Bacteria 79810
300 Ga0207689_10011634 3300025942 Bacteria 7541
301 Ga0207661_10001148 3300025944 Bacteria 17682
302 Ga0207661_10063706 3300025944 Bacteria 2987
303 Ga0207679_10000151 3300025945 Bacteria 57080
304 Ga0207679_10223898 3300025945 Bacteria 1584
305 Ga0207679_10386917 3300025945 Bacteria 1227
306 Ga0207667_10287914 3300025949 Unclassified 1679
307 Ga0207667_11169322 3300025949 Unclassified 750
308 Ga0207651_10028487 3300025960 Bacteria 3524
309 Ga0207712_11273167 3300025961 Unclassified 657
310 Ga0207668_10123260 3300025972 Unclassified 1966
311 Ga0207668_10127730 3300025972 Bacteria 1936
312 Ga0207640_10067782 3300025981 Bacteria 2389
313 Ga0207658_10087853 3300025986 Bacteria 2401
314 Ga0207658_10954572 3300025986 Unclassified 782
315 Ga0207677_10066041 3300026023 Bacteria 2527
316 Ga0207677_10086569 3300026023 Bacteria 2265
317 Ga0207677_10129932 3300026023 Bacteria 1911
318 Ga0207703_10011881 3300026035 Bacteria 6779
319 Ga0207703_10083698 3300026035 Bacteria 2666
320 Ga0207703_10242953 3300026035 Bacteria 1619
321 Ga0207639_10272919 3300026041 Unclassified 1484
322 Ga0207639_10307900 3300026041 Bacteria 1402
323 Ga0207678_10002928 3300026067 Bacteria 15472
324 Ga0207678_10606365 3300026067 Bacteria 960
325 Ga0207708_10155798 3300026075 Unclassified 1801
326 Ga0207702_10003823 3300026078 Bacteria 13582
327 Ga0207702_10026929 3300026078 Bacteria 4774
328 Ga0207702_10115472 3300026078 Bacteria 2394
329 Ga0207702_10363293 3300026078 Bacteria 1388
330 Ga0207641_10000183 3300026088 Bacteria 87085
331 Ga0207641_11458011 3300026088 Unclassified 686
332 Ga0207648_10000063 3300026089 Bacteria 99270
333 Ga0207648_10038555 3300026089 Bacteria 4204
334 Ga0207676_10000536 3300026095 Bacteria 31866
335 Ga0207674_10001582 3300026116 Bacteria 29319
336 Ga0207674_10233164 3300026116 Bacteria 1788
337 Ga0207674_10459297 3300026116 Unclassified 1231
338 Ga0207674_11185159 3300026116 Unclassified 733
339 Ga0207675_100013698 3300026118 Bacteria 7569
340 Ga0207675_100155779 3300026118 Bacteria 2177
341 Ga0207675_100456452 3300026118 Bacteria 1267
342 Ga0207683_10003861 3300026121 Bacteria 13007
343 Ga0207698_10024954 3300026142 Bacteria 4202
344 Ga0268266_10008112 3300028379 Bacteria 9376
345 Ga0268265_10094990 3300028380 Bacteria 2392
346 Ga0268264_10315129 3300028381 Bacteria 1477
347 Ga0265338_10002093 3300028800 Bacteria 30821
348 Ga0265770_1008356 3300030878 Unclassified 1474
349 Ga0265770_1097320 3300030878 Bacteria 594
350 Ga0265760_10016007 3300031090 Unclassified 2151
351 Ga0265760_10029290 3300031090 Bacteria 1618
352 Ga0265760_10169537 3300031090 Unclassified 724
353 Ga0265760_10253196 3300031090 Unclassified 610
354 Ga0265339_10011390 3300031249 Bacteria 5477
355 Ga0265316_10103989 3300031344 Bacteria 2156
356 Ga0373958_0054392 3300034819 Bacteria 853
357 Ga0373926_0026965 3300035083 Unclassified 2011
358 Ga0373928_0100143 3300035084 Unclassified 755
359 Ga0373934_0017393 3300035086 Bacteria 2745
360 Ga0373949_0311517 3300035090 Unclassified 502
361 Ga0373951_0093054 3300035091 Bacteria 793
362 Ga0373923_0394698 3300035111 Bacteria 665
363 Ga0373945_0040697 3300035116 Bacteria 1679
364 Ga0373955_0044395 3300035172 Bacteria 2394
365 Ga0373931_0026532 3300035691 Bacteria 2949
366 Ga0373931_0054269 3300035691 Bacteria 2141
367 Ga0373931_0233429 3300035691 Bacteria 1112
368 Ga0373931_0504277 3300035691 Unclassified 781
369 Ga0373931_0706280 3300035691 Unclassified 666
370 Ga0373935_0005941 3300035692 Bacteria 7238
371 Ga0373935_0329661 3300035692 Bacteria 1085
372 Ga0373927_0065382 3300035695 Bacteria 2353
373 Ga0373927_0141601 3300035695 Bacteria 1573
374 Ga0373927_0400103 3300035695 Bacteria 906
375 Ga0373947_0005903 3300035725 Bacteria 7133
376 Ga0373947_1265556 3300035725 Unclassified 502
377 Ga0373937_0086094 3300036401 Bacteria 2908
378 Ga0373925_0005367 3300037068 Bacteria 9559
379 Ga0373925_0033460 3300037068 Bacteria 3788
380 Ga0436364_0681727 3300037853 Unclassified 1289
381 Ga0436365_1573953 3300039437 Bacteria 1101
382 Ga0436365_1770086 3300039437 Bacteria 1304
383 Ga0436360_0622421 3300039438 Bacteria 23274
384 Ga0436361_0734757 3300039447 Bacteria 910
385 Ga0436363_0394155 3300039450 Unclassified 1115
386 Ga0436363_0509565 3300039450 Bacteria 1408
387 Ga0436363_0764347 3300039450 Bacteria 2369
388 Ga0436363_1611776 3300039450 Bacteria 6333
389 Ga0451577_0000390 3300042876 Bacteria 81287
390 Ga0451577_0856354 3300042876 Bacteria 820
391 Ga0453683_0004400 3300044673 Bacteria 10012
392 Ga0466963_0041923 3300044694 Bacteria 3003
393 Ga0466964_0317821 3300044706 Unclassified 790
394 Ga0453684_0000686 3300044712 Bacteria 120659
395 Ga0466957_0540758 3300044842 Unclassified 811
396 Ga0466960_0218721 3300044901 Bacteria 1047
397 Ga0451576_0043080 3300045051 Bacteria 4763
398 Ga0466967_0180564 3300045976 Bacteria 1990
399 Ga0466967_2228860 3300045976 Bacteria 544
400 Ga0495603_0054883 3300046455 Bacteria 2361
401 Ga0495580_0000220 3300046472 Bacteria 44125
402 Ga0495580_0000988 3300046472 Bacteria 24951
403 Ga0495580_0001590 3300046472 Bacteria 19932
404 Ga0495580_0026330 3300046472 Unclassified 4241
405 Ga0495582_0006031 3300046473 Bacteria 6758
406 Ga0495584_0204220 3300046491 Bacteria 1004
407 Ga0495594_0062245 3300046499 Bacteria 2066
408 Ga0495618_0675506 3300046514 Unclassified 609
409 Ga0495666_0038605 3300046526 Bacteria 2322
410 Ga0495642_0245104 3300046528 Unclassified 783
411 Ga0495665_0005408 3300046531 Bacteria 6884
412 Ga0495633_0510476 3300046558 Unclassified 542
413 Ga0495659_0220658 3300046664 Bacteria 783
414 Ga0495588_0108740 3300046674 Bacteria 1460
415 Ga0495588_0665002 3300046674 Unclassified 545
416 Ga0495623_0350200 3300046679 Bacteria 805
417 Ga0495658_0093369 3300046683 Bacteria 1785
418 Ga0495674_1348316 3300047319 Unclassified 533
419 Ga0495684_0812937 3300047471 Unclassified 610
420 Ga0495602_0187298 3300048088 Bacteria 1590
421 Ga0495602_0358214 3300048088 Bacteria 1051
422 Ga0496100_0274737 3300048903 Unclassified 1254
423 Ga0496101_0206324 3300048904 Bacteria 1521
424 Ga0496101_0232792 3300048904 Bacteria 1432
425 Ga0496102_0001608 3300048905 Bacteria 19914
426 Ga0496102_0037848 3300048905 Bacteria 4352
427 Ga0496102_0365674 3300048905 Bacteria 1358
428 Ga0496102_0968928 3300048905 Bacteria 771
429 Ga0496102_0993056 3300048905 Bacteria 760
430 Ga0496102_1227920 3300048905 Unclassified 669
431 Ga0496102_1603867 3300048905 Unclassified 569
432 Ga0496103_0001131 3300048906 Bacteria 18549
433 Ga0496103_0093293 3300048906 Bacteria 1901
434 Ga0496103_0149875 3300048906 Bacteria 1494
435 Ga0496104_0020814 3300048907 Bacteria 6015
436 Ga0496105_0734827 3300048908 Unclassified 755
437 Ga0496106_0765609 3300048909 Bacteria 767
438 Ga0496106_1024871 3300048909 Unclassified 648
439 Ga0496107_0124429 3300048910 Bacteria 1901
440 Ga0496107_0165070 3300048910 Bacteria 1642
441 Ga0496107_0405281 3300048910 Bacteria 1014
442 Ga0496108_0002049 3300048911 Bacteria 16155
443 Ga0496109_0003478 3300048912 Bacteria 13150
444 Ga0496110_0000608 3300048913 Bacteria 24639
445 Ga0496110_1531079 3300048913 Bacteria 577
446 Ga0496111_0003481 3300048914 Bacteria 9740
447 Ga0496112_0001533 3300048915 Bacteria 17827
448 Ga0496112_0004982 3300048915 Bacteria 11386
449 Ga0496112_0006612 3300048915 Bacteria 10206
450 Ga0496112_0074796 3300048915 Bacteria 3350
451 Ga0496112_0330771 3300048915 Unclassified 1467
452 Ga0496113_0000151 3300048916 Bacteria 30342
453 Ga0501069_0280504 3300049585 Bacteria 975
454 Ga0501083_0247747 3300049744 Bacteria 1160
455 nmdc:mga08y16_1134538_c1 3300050511 Unclassified 755
456 nmdc:mga0rr50_7178_c1 3300050513 Bacteria 6845
457 nmdc:mga08x19_108323_c1 3300050514 Bacteria 1851
458 nmdc:mga08x19_1088185_c1 3300050514 Unclassified 567
459 Ga0501084_0897919 3300054114 Bacteria 745
460 Ga0105245_10183696
461 LJNas_1000215
462 JGI24752J21851_1007272
463 JGI24748J21848_1041365
464 JGI24034J26672_10010016
465 JGI24751J29686_10011539
466 rootL2_10105497
467 Ga0065715_10125539
468 Ga0065715_10339530
469 Ga0070658_10019630
470 Ga0070676_10011637
471 Ga0070683_100043815
472 Ga0070690_100039888
473 Ga0070670_100152513
474 Ga0070670_100162551
475 Ga0070677_10018288
476 Ga0068869_100004379
477 Ga0068869_100458608
478 Ga0070666_10017323
479 Ga0070682_100017628
480 Ga0070682_101326038
481 Ga0068868_100049239
482 Ga0068868_100083499
483 Ga0070660_100022885
484 Ga0070689_100011061
485 Ga0070691_10264053
486 Ga0070661_100010243
487 Ga0070668_100010215
488 Ga0070669_100290434
489 Ga0070675_100060535
490 Ga0070674_100044711
491 Ga0070673_100029008
492 Ga0070688_100021640
493 Ga0070659_100091584
494 Ga0070667_101027506
495 Ga0070667_101517537
496 Ga0070709_10086596
497 Ga0070709_10107331
498 Ga0070709_11687287
499 Ga0070714_100000128
500 Ga0070714_100086054
501 Ga0070714_100200424
502 Ga0070714_100777505
503 Ga0070714_101085777
504 Ga0070713_100015878
505 Ga0070713_100058913
506 Ga0070713_100510571
507 Ga0070710_10098547
508 Ga0070711_100229815
509 Ga0070711_100521640
510 Ga0070705_100118820
511 Ga0070700_100173880
512 Ga0070694_100361893
513 Ga0070708_100002433
514 Ga0070708_100070700
515 Ga0070708_100082867
516 Ga0070708_100181185
517 Ga0070708_100900201
518 Ga0070663_100241713
519 Ga0070663_101491706
520 Ga0070678_100033309
521 Ga0070662_100047295
522 Ga0070681_10136474
523 Ga0070681_10569036
524 Ga0068867_100039615
525 Ga0068867_100073152
526 Ga0070685_10061613
527 Ga0070685_10073263
528 Ga0070685_10451762
529 Ga0070706_100001770
530 Ga0070706_100103642
531 Ga0070706_100413830
532 Ga0070707_100236867
533 Ga0070707_100418635
534 Ga0070698_100127462
535 Ga0070698_100402462
536 Ga0070699_100240964
537 Ga0070684_100039308
538 Ga0070697_100000902
539 Ga0070697_100282385
540 Ga0070697_100723055
541 Ga0068853_100104737
542 Ga0068853_100126949
543 Ga0068853_100873668
544 Ga0070672_100079926
545 Ga0070672_101166714
546 Ga0070686_100017238
547 Ga0070686_100030478
548 Ga0070686_100130877
549 Ga0070695_100164303
550 Ga0070695_100613437
551 Ga0070696_100040632
552 Ga0070696_100591818
553 Ga0070693_100070313
554 Ga0070693_100384905
555 Ga0068855_100126872
556 Ga0068855_100590186
557 Ga0070664_100503520
558 Ga0070664_100599571
559 Ga0068857_100010903
560 Ga0068857_100233355
561 Ga0068854_100550495
562 Ga0068856_100006740
563 Ga0068856_100094894
564 Ga0068856_100700589
565 Ga0070702_100151605
566 Ga0068852_100004955
567 Ga0068852_102584067
568 Ga0068859_100030882
569 Ga0068859_100349070
570 Ga0068864_100219057
571 Ga0068864_100395615
572 Ga0068866_10006361
573 Ga0068866_10901411
574 Ga0068861_100040667
575 Ga0068851_10065903
576 Ga0068870_10044127
577 Ga0068863_100024129
578 Ga0068858_100001067
579 Ga0068858_100031579
580 Ga0068860_100022618
581 Ga0068860_100162295
582 Ga0068860_100299776
583 Ga0068862_100025624
584 Ga0070717_10001911
585 Ga0070717_10010130
586 Ga0070717_10010950
587 Ga0070717_10061605
588 Ga0070717_10071635
589 Ga0070717_10170115
590 Ga0070717_10893758
591 Ga0070716_100001801
592 Ga0070716_100143161
593 Ga0070716_100224047
594 Ga0070716_100791010
595 Ga0070716_101081892
596 Ga0070716_101438938
597 Ga0070712_100027094
598 Ga0070712_100270487
599 Ga0070712_101179108
600 Ga0070712_101225584
601 Ga0097621_100018894
602 Ga0097621_100666808
603 Ga0097621_101173815
604 Ga0068871_100042279
605 Ga0068871_100090909
606 Ga0068871_100456988
607 Ga0068871_100899674
608 Ga0068865_100018218
609 Ga0068865_100035913
610 Ga0068865_100049379
611 Ga0075436_100009322
612 Ga0097620_100030881
613 Ga0097620_100349054
614 Ga0075435_100006567
615 Ga0075435_100298651
616 Ga0105250_10008646
617 Ga0105250_10210237
618 Ga0105240_10037841
619 Ga0105240_10405587
620 Ga0111539_11452974
621 Ga0105245_10327436
622 Ga0105245_10438019
623 Ga0105247_10027564
624 Ga0105247_10045966
625 Ga0105247_10441413
626 Ga0105243_10066646
627 Ga0105243_10168164
628 Ga0105243_11346141
629 Ga0105241_10001259
630 Ga0105241_10063812
631 Ga0105241_10245526
632 Ga0105241_10277932
633 Ga0105241_11072935
634 Ga0105242_10009635
635 Ga0105242_10065599
636 Ga0105242_10201910
637 Ga0105248_11124747
638 Ga0105237_10011352
639 Ga0105237_10018216
640 Ga0105237_10313679
641 Ga0105249_10095998
642 Ga0105239_10014054
643 Ga0105239_10083648
644 Ga0105239_10691300
645 Ga0105246_11799071
646 Ga0157373_10001333
647 Ga0157373_10020961
648 Ga0157373_10043949
649 Ga0157373_10046508
650 Ga0157371_10007438
651 Ga0157371_10226640
652 Ga0157370_10136138
653 Ga0157370_10150403
654 Ga0157369_10046899
655 Ga0157369_10371306
656 Ga0157369_12448479
657 Ga0157374_10012969
658 Ga0157374_10023534
659 Ga0157374_10032815
660 Ga0157374_11891188
661 Ga0157378_10122520
662 Ga0157378_10336539
663 Ga0157378_10564268
664 Ga0157378_10959746
665 Ga0163162_10035620
666 Ga0163162_10047312
667 Ga0163162_10297184
668 Ga0163162_10347826
669 Ga0157372_11137663
670 Ga0157372_11836034
671 Ga0157375_10257948
672 Ga0157375_10477170
673 Ga0157375_10497427
674 Ga0157375_11403268
675 Ga0163163_10012687
676 Ga0163163_10124577
677 Ga0157380_11917583
678 Ga0157377_10006876
679 Ga0157377_10044436
680 Ga0157379_10003230
681 Ga0157379_10077141
682 Ga0157376_10374566
683 Ga0157376_10473973
684 Ga0157376_10576979
685 Ga0163161_10003472
686 Ga0224569_100149
687 Ga0224571_105480
688 Ga0224572_1057558
689 Ga0228598_1000707
690 Ga0228598_1002428
691 Ga0207697_10005131
692 Ga0207656_10066450
693 Ga0207692_10062007
694 Ga0207642_10004583
695 Ga0207642_10423366
696 Ga0207710_10101677
697 Ga0207680_10057746
698 Ga0207647_10011204
699 Ga0207647_10043848
700 Ga0207647_10248701
701 Ga0207699_10070028
702 Ga0207699_10112091
703 Ga0207645_10000021
704 Ga0207643_10007444
705 Ga0207705_10034163
706 Ga0207684_10002047
707 Ga0207684_10060046
708 Ga0207684_10370863
709 Ga0207654_10036484
710 Ga0207654_10079306
711 Ga0207654_10220359
712 Ga0207707_10016277
713 Ga0207707_10270819
714 Ga0207707_10309989
715 Ga0207671_10052039
716 Ga0207671_10076388
717 Ga0207671_10261906
718 Ga0207693_10014864
719 Ga0207693_10336463
720 Ga0207693_10398650
721 Ga0207663_10039641
722 Ga0207663_10268928
723 Ga0207663_11464786
724 Ga0207660_10191627
725 Ga0207657_10001918
726 Ga0207649_10000836
727 Ga0207649_10129813
728 Ga0207652_10119685
729 Ga0207646_10112026
730 Ga0207681_10126049
731 Ga0207650_10000097
732 Ga0207650_10049622
733 Ga0207659_10042252
734 Ga0207659_11520527
735 Ga0207687_10711425
736 Ga0207687_10931243
737 Ga0207700_10045398
738 Ga0207700_10049133
739 Ga0207700_10520411
740 Ga0207664_10000033
741 Ga0207644_10053885
742 Ga0207690_10011645
743 Ga0207706_10000048
744 Ga0207706_11506684
745 Ga0207686_10479775
746 Ga0207709_10623595
747 Ga0207670_10148711
748 Ga0207669_10118364
749 Ga0207704_10009462
750 Ga0207704_10092971
751 Ga0207665_10003172
752 Ga0207665_10059946
753 Ga0207665_10172381
754 Ga0207665_11403592
755 Ga0207691_10000721
756 Ga0207691_11027281
757 Ga0207711_10068196
758 Ga0207689_10000078
759 Ga0207689_10011634
760 Ga0207661_10001148
761 Ga0207661_10063706
762 Ga0207679_10000151
763 Ga0207679_10223898
764 Ga0207679_10386917
765 Ga0207667_10287914
766 Ga0207667_11169322
767 Ga0207651_10028487
768 Ga0207712_11273167
769 Ga0207668_10123260
770 Ga0207668_10127730
771 Ga0207640_10067782
772 Ga0207658_10087853
773 Ga0207658_10954572
774 Ga0207677_10066041
775 Ga0207677_10086569
776 Ga0207677_10129932
777 Ga0207703_10011881
778 Ga0207703_10083698
779 Ga0207703_10242953
780 Ga0207639_10272919
781 Ga0207639_10307900
782 Ga0207678_10002928
783 Ga0207678_10606365
784 Ga0207708_10155798
785 Ga0207702_10003823
786 Ga0207702_10026929
787 Ga0207702_10115472
788 Ga0207702_10363293
789 Ga0207641_10000183
790 Ga0207641_11458011
791 Ga0207648_10000063
792 Ga0207648_10038555
793 Ga0207676_10000536
794 Ga0207674_10001582
795 Ga0207674_10233164
796 Ga0207674_10459297
797 Ga0207674_11185159
798 Ga0207675_100013698
799 Ga0207675_100155779
800 Ga0207675_100456452
801 Ga0207683_10003861
802 Ga0207698_10024954
803 Ga0268266_10008112
804 Ga0268265_10094990
805 Ga0268264_10315129
806 Ga0265338_10002093
807 Ga0265770_1008356
808 Ga0265770_1097320
809 Ga0265760_10016007
810 Ga0265760_10029290
811 Ga0265760_10169537
812 Ga0265760_10253196
813 Ga0265339_10011390
814 Ga0265316_10103989
815 Ga0373958_0054392
816 Ga0373926_0026965
817 Ga0373928_0100143
818 Ga0373934_0017393
819 Ga0373949_0311517
820 Ga0373951_0093054
821 Ga0373923_0394698
822 Ga0373945_0040697
823 Ga0373955_0044395
824 Ga0373931_0026532
825 Ga0373931_0054269
826 Ga0373931_0233429
827 Ga0373931_0504277
828 Ga0373931_0706280
829 Ga0373935_0005941
830 Ga0373935_0329661
831 Ga0373927_0065382
832 Ga0373927_0141601
833 Ga0373927_0400103
834 Ga0373947_0005903
835 Ga0373947_1265556
836 Ga0373937_0086094
837 Ga0373925_0005367
838 Ga0373925_0033460
839 Ga0436364_0681727
840 Ga0436365_1573953
841 Ga0436365_1770086
842 Ga0436360_0622421
843 Ga0436361_0734757
844 Ga0436363_0394155
845 Ga0436363_0509565
846 Ga0436363_0764347
847 Ga0436363_1611776
848 Ga0451577_0000390
849 Ga0451577_0856354
850 Ga0453683_0004400
851 Ga0466963_0041923
852 Ga0466964_0317821
853 Ga0453684_0000686
854 Ga0466957_0540758
855 Ga0466960_0218721
856 Ga0451576_0043080
857 Ga0466967_0180564
858 Ga0466967_2228860
859 Ga0495603_0054883
860 Ga0495580_0000220
861 Ga0495580_0000988
862 Ga0495580_0001590
863 Ga0495580_0026330
864 Ga0495582_0006031
865 Ga0495584_0204220
866 Ga0495594_0062245
867 Ga0495618_0675506
868 Ga0495666_0038605
869 Ga0495642_0245104
870 Ga0495665_0005408
871 Ga0495633_0510476
872 Ga0495659_0220658
873 Ga0495588_0108740
874 Ga0495588_0665002
875 Ga0495623_0350200
876 Ga0495658_0093369
877 Ga0495674_1348316
878 Ga0495684_0812937
879 Ga0495602_0187298
880 Ga0495602_0358214
881 Ga0496100_0274737
882 Ga0496101_0206324
883 Ga0496101_0232792
884 Ga0496102_0001608
885 Ga0496102_0037848
886 Ga0496102_0365674
887 Ga0496102_0968928
888 Ga0496102_0993056
889 Ga0496102_1227920
890 Ga0496102_1603867
891 Ga0496103_0001131
892 Ga0496103_0093293
893 Ga0496103_0149875
894 Ga0496104_0020814
895 Ga0496105_0734827
896 Ga0496106_0765609
897 Ga0496106_1024871
898 Ga0496107_0124429
899 Ga0496107_0165070
900 Ga0496107_0405281
901 Ga0496108_0002049
902 Ga0496109_0003478
903 Ga0496110_0000608
904 Ga0496110_1531079
905 Ga0496111_0003481
906 Ga0496112_0001533
907 Ga0496112_0004982
908 Ga0496112_0006612
909 Ga0496112_0074796
910 Ga0496112_0330771
911 Ga0496113_0000151
912 Ga0501069_0280504
913 Ga0501083_0247747
914 nmdc:mga08y16_1134538_c1
915 nmdc:mga0rr50_7178_c1
916 nmdc:mga08x19_108323_c1
917 nmdc:mga08x19_1088185_c1
918 Ga0501084_0897919

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

128

0.95

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

141

0.89

PF13468

Glyoxalase_3

Glyoxalase-like domain

18

143

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qh4-assembly2.cif.gz_D-2 crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9444 3 130
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9438 2 135
6qh4-assembly1.cif.gz_A crystal structure of human methylmalonyl-coa epimerase (mcee) p.arg143cys variant 0.9317 3 130
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9304 2 135
3rmu-assembly2.cif.gz_D crystal structure of human methylmalonyl-coa epimerase, mcee 0.9282 3 130
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9619 2 130 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9457 4 131 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9317 3 130 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.927 2 130 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8977 3 130 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A2U3KWR7-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9982 2 130 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V9Y9H4-F1-model_v4 Methylmalonyl-CoA epimerase 0.993 21 130 GO:0004493
GO:0046491
GO:0046872
AF-A0A0S8J9M1-F1-model_v4 Methylmalonyl-CoA epimerase 0.9835 3 130 GO:0004493
GO:0046491
GO:0046872
AF-A0A645HG88-F1-model_v4 VOC domain-containing protein 0.9785 32 130 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V9Y9H4-F1-model_v4 Methylmalonyl-CoA epimerase 0.9753 21 130 GO:0004493
GO:0046491
GO:0046872

Map