F448345

General Info

Members Datasets Scaffolds Average Seq Length
459 286 918 320

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10181899|Ga0105240_101818992
Length 372
Sequence VTSADSPVTPELAEPGPVPAGSTGEVATGRGRHADLARFLGRRIGIGGILVIGTTLIAFLLTQLVPGDPAAANLGQRAISDPAAVQAFRQQNGLDKPLPVQYAIYLGHLLRGNLGTSQQSHRPVSTDLSEYVPATVELALFAIVISLLLGVTFGVLAAVTRDRWPDQLLRVVSLAGVSMPTFWIALVAFYVVFFKLGWVPGGGRLEPGQVPPEHITGLYTVDAALHGEWGLLGTVLQHLLLPGLVLAIYTIGMLLRFTRASVLEVLGNDYVRAARAKGLPEWLVIRRHVLRPALVGIITVAGVAFGSLLSGTVLVENIYSWPGIGQYAFRSATNLDLPAIMGVSLVVAIVYIGLNIVVDVLYGVIDPRLRLS

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
118 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
125 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
214 2547132181 Kosakonia sacchari SP1 Isolate Stem
215 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
216 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
217 2561511199 Enterobacter sp. R4-368 Isolate Nodule
218 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
219 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
220 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
221 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
222 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
223 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
224 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
225 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
226 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
227 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
228 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
229 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
230 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
231 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
232 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
233 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
234 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
235 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
236 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
237 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
238 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
239 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
240 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
241 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
242 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
243 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
244 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
245 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
246 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
247 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
248 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
249 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
250 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
251 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
252 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
253 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
254 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
255 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
256 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
257 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
258 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
259 2636415599 Klebsiella variicola DX120E Isolate Unclassified
260 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
261 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
262 2738543017 Bacillus sp. OV186 Isolate Unclassified
263 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
264 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
265 2775507074 Klebsiella sp. D5A Isolate Unclassified
266 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
267 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
268 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
269 2857586860 Bacillus sp. R-71935 Isolate Unclassified
270 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
271 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
272 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
273 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
274 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
275 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
276 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
277 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
278 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
279 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
280 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
281 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
282 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
283 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
284 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
285 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
286 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.66
Metatranscriptomes 0.22
Isolates 16.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 3.49
Nodule 1.74
Rhizoplane 10.46
Rhizosphere 69.06
Stem 0.22
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10181899 3300009093 Bacteria 2480
2 JGI25152J39213_1001634 3300002773 Bacteria 9348
3 JGI25165J46597_1000080 3300003214 Bacteria 176649
4 JGI25153J46596_10019890 3300003215 Bacteria 2555
5 rootH1_10093385 3300003323 Bacteria 2119
6 Ga0055538_1000573 3300003751 Bacteria 12489
7 Ga0058692_1000752 3300003856 Bacteria 13049
8 Ga0065704_10012775 3300005289 Bacteria 1820
9 Ga0065704_10079220 3300005289 Bacteria 4221
10 Ga0070658_10008133 3300005327 Bacteria 8435
11 Ga0070658_10066515 3300005327 Bacteria 2944
12 Ga0070658_10257745 3300005327 Bacteria 1481
13 Ga0070676_10002943 3300005328 Bacteria 8791
14 Ga0068869_100022493 3300005334 Bacteria 4345
15 Ga0070666_10026426 3300005335 Bacteria 3793
16 Ga0068868_100051267 3300005338 Bacteria 3245
17 Ga0070660_100088064 3300005339 Bacteria 2445
18 Ga0070689_100283987 3300005340 Bacteria 1374
19 Ga0070673_100018804 3300005364 Bacteria 4948
20 Ga0070659_100407766 3300005366 Bacteria 1148
21 Ga0070714_100007875 3300005435 Bacteria 8299
22 Ga0070713_100003894 3300005436 Bacteria 9892
23 Ga0070678_100007857 3300005456 Bacteria 6347
24 Ga0070678_100019800 3300005456 Bacteria 4398
25 Ga0070662_100067905 3300005457 Bacteria 2619
26 Ga0068867_100028104 3300005459 Bacteria 4048
27 Ga0070707_100082767 3300005468 Bacteria 3100
28 Ga0070698_100024120 3300005471 Bacteria 6348
29 Ga0070679_100043074 3300005530 Bacteria 4496
30 Ga0070679_100095981 3300005530 Bacteria 2952
31 Ga0068853_100431767 3300005539 Bacteria 1237
32 Ga0070665_100003057 3300005548 Bacteria 18016
33 Ga0070665_100014436 3300005548 Bacteria 7926
34 Ga0070665_100016070 3300005548 Bacteria 7511
35 Ga0070665_100061669 3300005548 Bacteria 3759
36 Ga0070665_100229918 3300005548 Bacteria 1854
37 Ga0068855_100151625 3300005563 Bacteria 2635
38 Ga0068855_100155074 3300005563 Bacteria 2602
39 Ga0070664_100317222 3300005564 Bacteria 1411
40 Ga0068857_100034992 3300005577 Bacteria 4446
41 Ga0068857_100080262 3300005577 Bacteria 2913
42 Ga0068856_100162067 3300005614 Bacteria 2247
43 Ga0068856_100300267 3300005614 Bacteria 1623
44 Ga0068859_100272717 3300005617 Bacteria 1784
45 Ga0068866_10009263 3300005718 Bacteria 4175
46 Ga0068870_10164369 3300005840 Bacteria 1319
47 Ga0068863_100057277 3300005841 Bacteria 3688
48 Ga0068858_100021719 3300005842 Bacteria 5997
49 Ga0068860_100165203 3300005843 Bacteria 2137
50 Ga0070717_10136501 3300006028 Bacteria 2113
51 Ga0075364_10000919 3300006051 Bacteria 15563
52 Ga0075362_10062177 3300006177 Bacteria 1691
53 Ga0075366_10105615 3300006195 Bacteria 1693
54 Ga0097621_100013533 3300006237 Bacteria 6083
55 Ga0097621_100037806 3300006237 Bacteria 3871
56 Ga0097621_100084094 3300006237 Bacteria 2652
57 Ga0068871_100002680 3300006358 Bacteria 12150
58 Ga0068871_100004106 3300006358 Bacteria 10069
59 Ga0075434_100319469 3300006871 Bacteria 1573
60 Ga0068865_100014510 3300006881 Bacteria 5007
61 Ga0097620_100272731 3300006931 Bacteria 1784
62 Ga0079104_1000149 3300006946 Bacteria 98131
63 Ga0079104_1000263 3300006946 Bacteria 69767
64 Ga0079104_1000716 3300006946 Bacteria 29970
65 Ga0099794_10013393 3300007265 Bacteria 3569
66 Ga0105251_10000577 3300009011 Bacteria 34051
67 Ga0105251_10004679 3300009011 Bacteria 9204
68 Ga0105251_10025306 3300009011 Bacteria 3037
69 Ga0105251_10043844 3300009011 Bacteria 2164
70 Ga0105244_10000015 3300009036 Bacteria 256814
71 Ga0105244_10000389 3300009036 Bacteria 40743
72 Ga0105244_10002335 3300009036 Bacteria 14431
73 Ga0105250_10000012 3300009092 Bacteria 274899
74 Ga0105250_10006453 3300009092 Bacteria 5125
75 Ga0105250_10110019 3300009092 Bacteria 1128
76 Ga0105240_10023516 3300009093 Bacteria 8145
77 Ga0105240_10154958 3300009093 Bacteria 2726
78 Ga0105240_10585510 3300009093 Bacteria 1230
79 Ga0111539_10000910 3300009094 Bacteria 38655
80 Ga0111539_10266084 3300009094 Bacteria 1996
81 Ga0105245_10017217 3300009098 Bacteria 6305
82 Ga0105245_10028675 3300009098 Bacteria 4913
83 Ga0105245_10053076 3300009098 Bacteria 3638
84 Ga0105247_10170603 3300009101 Bacteria 1446
85 Ga0114129_10350762 3300009147 Bacteria 1955
86 Ga0105243_10000455 3300009148 Bacteria 42520
87 Ga0105243_10000851 3300009148 Bacteria 28975
88 Ga0105243_10030205 3300009148 Bacteria 4171
89 Ga0105243_10451710 3300009148 Bacteria 1206
90 Ga0105241_10034028 3300009174 Bacteria 3827
91 Ga0105241_10071287 3300009174 Bacteria 2697
92 Ga0105241_10101981 3300009174 Bacteria 2283
93 Ga0105242_10018871 3300009176 Bacteria 5401
94 Ga0105242_10040788 3300009176 Bacteria 3741
95 Ga0105248_10016581 3300009177 Bacteria 8112
96 Ga0105248_10560358 3300009177 Bacteria 1289
97 Ga0105238_10035861 3300009551 Bacteria 5042
98 Ga0105238_10202435 3300009551 Bacteria 1961
99 Ga0105238_10391248 3300009551 Bacteria 1382
100 Ga0105249_10016981 3300009553 Bacteria 6457
101 Ga0105239_10059071 3300010375 Bacteria 4209
102 Ga0105239_10882317 3300010375 Bacteria 1026
103 Ga0105246_10008152 3300011119 Bacteria 6433
104 Ga0105246_10016289 3300011119 Bacteria 4705
105 Ga0105246_10234348 3300011119 Bacteria 1447
106 Ga0157371_10101579 3300013102 Bacteria 2040
107 Ga0157371_10126949 3300013102 Bacteria 1814
108 Ga0157370_10027158 3300013104 Bacteria 5645
109 Ga0157370_10186082 3300013104 Bacteria 1928
110 Ga0157369_10003489 3300013105 Bacteria 18668
111 Ga0157369_10317433 3300013105 Bacteria 1620
112 Ga0157374_10016866 3300013296 Bacteria 6426
113 Ga0157378_10051578 3300013297 Bacteria 3661
114 Ga0157378_10203522 3300013297 Bacteria 1873
115 Ga0157378_10492767 3300013297 Bacteria 1223
116 Ga0163162_10049085 3300013306 Bacteria 4229
117 Ga0163162_10305909 3300013306 Bacteria 1722
118 Ga0157372_10001020 3300013307 Bacteria 30623
119 Ga0157372_10502078 3300013307 Bacteria 1414
120 Ga0157375_10033050 3300013308 Bacteria 4912
121 Ga0163163_10000021 3300014325 Bacteria 191799
122 Ga0163163_10589345 3300014325 Bacteria 1175
123 Ga0157377_10036857 3300014745 Bacteria 2692
124 Ga0157379_10006174 3300014968 Bacteria 10318
125 Ga0157379_10025083 3300014968 Bacteria 5294
126 Ga0157379_10108298 3300014968 Bacteria 2495
127 Ga0157379_10123626 3300014968 Bacteria 2328
128 Ga0157376_10003177 3300014969 Bacteria 11287
129 Ga0163161_10004257 3300017792 Bacteria 9987
130 Ga0213876_10000039 3300021384 Bacteria 173104
131 Ga0213876_10002594 3300021384 Bacteria 10559
132 Ga0213875_10001489 3300021388 Bacteria 15051
133 Ga0209784_100240 3300025224 Bacteria 35738
134 Ga0209129_1000021 3300025258 Bacteria 445018
135 Ga0209233_1000006 3300025261 Bacteria 1473685
136 Ga0209233_1004125 3300025261 Bacteria 5004
137 Ga0209758_1000008 3300025297 Bacteria 1215263
138 Ga0207696_1000040 3300025711 Bacteria 318695
139 Ga0207696_1005688 3300025711 Bacteria 5139
140 Ga0207655_1000001 3300025728 Bacteria 1866413
141 Ga0207655_1000061 3300025728 Bacteria 258893
142 Ga0207655_1003510 3300025728 Bacteria 11630
143 Ga0207713_1000017 3300025735 Bacteria 394495
144 Ga0207713_1000053 3300025735 Bacteria 222068
145 Ga0207713_1018894 3300025735 Bacteria 3395
146 Ga0207713_1033860 3300025735 Bacteria 2225
147 Ga0207713_1036075 3300025735 Bacteria 2125
148 Ga0207642_10007033 3300025899 Bacteria 3775
149 Ga0207642_10094955 3300025899 Bacteria 1483
150 Ga0207645_10004193 3300025907 Bacteria 10703
151 Ga0207643_10076517 3300025908 Bacteria 1933
152 Ga0207705_10002674 3300025909 Bacteria 13653
153 Ga0207654_10038841 3300025911 Bacteria 2673
154 Ga0207654_10153449 3300025911 Bacteria 1481
155 Ga0207707_10048450 3300025912 Bacteria 3701
156 Ga0207707_10106924 3300025912 Bacteria 2446
157 Ga0207695_10065011 3300025913 Bacteria 3752
158 Ga0207695_10126864 3300025913 Bacteria 2513
159 Ga0207695_10153685 3300025913 Bacteria 2238
160 Ga0207660_10164340 3300025917 Bacteria 1715
161 Ga0207657_10108760 3300025919 Bacteria 2292
162 Ga0207652_10069980 3300025921 Bacteria 3047
163 Ga0207652_10205835 3300025921 Bacteria 1771
164 Ga0207646_10045095 3300025922 Bacteria 3958
165 Ga0207694_10029229 3300025924 Bacteria 4205
166 Ga0207694_10030424 3300025924 Bacteria 4123
167 Ga0207694_10135147 3300025924 Bacteria 1980
168 Ga0207694_10166359 3300025924 Bacteria 1784
169 Ga0207687_10058298 3300025927 Bacteria 2716
170 Ga0207687_10060976 3300025927 Bacteria 2662
171 Ga0207700_10028010 3300025928 Bacteria 3953
172 Ga0207700_10076940 3300025928 Bacteria 2591
173 Ga0207664_10002399 3300025929 Bacteria 12391
174 Ga0207690_10013089 3300025932 Bacteria 4978
175 Ga0207706_10164589 3300025933 Bacteria 1949
176 Ga0207686_10071477 3300025934 Bacteria 2233
177 Ga0207709_10000612 3300025935 Bacteria 29395
178 Ga0207709_10009133 3300025935 Bacteria 5464
179 Ga0207709_10103640 3300025935 Bacteria 1886
180 Ga0207704_10064950 3300025938 Bacteria 2283
181 Ga0207704_10079494 3300025938 Bacteria 2113
182 Ga0207711_10032869 3300025941 Bacteria 4388
183 Ga0207711_10162455 3300025941 Bacteria 2023
184 Ga0207689_10008366 3300025942 Bacteria 9009
185 Ga0207689_10020237 3300025942 Bacteria 5604
186 Ga0207667_10068799 3300025949 Bacteria 3686
187 Ga0207667_10091178 3300025949 Bacteria 3148
188 Ga0207651_10012287 3300025960 Bacteria 4839
189 Ga0207712_10287589 3300025961 Unclassified 1344
190 Ga0207703_10006683 3300026035 Bacteria 9202
191 Ga0207703_10053651 3300026035 Bacteria 3277
192 Ga0207639_10522777 3300026041 Bacteria 1087
193 Ga0207648_10009821 3300026089 Bacteria 9138
194 Ga0207648_10132476 3300026089 Bacteria 2194
195 Ga0207676_10221831 3300026095 Bacteria 1684
196 Ga0207674_10025756 3300026116 Bacteria 6264
197 Ga0207674_10112643 3300026116 Bacteria 2694
198 Ga0207683_10044552 3300026121 Bacteria 3879
199 Ga0209281_1000006 3300027111 Bacteria 1170244
200 Ga0209281_1000197 3300027111 Bacteria 137637
201 Ga0209281_1000287 3300027111 Bacteria 93918
202 Ga0209281_1004922 3300027111 Bacteria 3846
203 Ga0209371_1000027 3300027312 Bacteria 448853
204 Ga0209371_1000029 3300027312 Bacteria 424797
205 Ga0209371_1000481 3300027312 Bacteria 38916
206 Ga0209371_1004790 3300027312 Bacteria 5693
207 Ga0207428_10010497 3300027907 Bacteria 8267
208 Ga0268266_10000386 3300028379 Bacteria 67149
209 Ga0268266_10035023 3300028379 Bacteria 4270
210 Ga0268266_10037580 3300028379 Bacteria 4124
211 Ga0268266_10040978 3300028379 Bacteria 3949
212 Ga0265337_1000453 3300028556 Bacteria 21776
213 Ga0265326_10000476 3300028558 Bacteria 15464
214 Ga0265334_10004845 3300028573 Bacteria 5918
215 Ga0265338_10000784 3300028800 Bacteria 53838
216 Ga0265338_10038399 3300028800 Bacteria 4537
217 Ga0268256_1000032 3300030500 Bacteria 424603
218 Ga0268256_1000045 3300030500 Bacteria 330053
219 Ga0268256_1000407 3300030500 Bacteria 39064
220 Ga0268256_1004599 3300030500 Bacteria 5664
221 Ga0268256_1006010 3300030500 Bacteria 4623
222 Ga0268256_1008770 3300030500 Bacteria 3436
223 Ga0265332_10008977 3300031238 Bacteria 4470
224 Ga0265332_10010170 3300031238 Bacteria 4188
225 Ga0265325_10016455 3300031241 Bacteria 4135
226 Ga0265331_10003709 3300031250 Bacteria 9717
227 Ga0265331_10014483 3300031250 Bacteria 4199
228 Ga0265331_10075680 3300031250 Bacteria 1569
229 Ga0265316_10021813 3300031344 Bacteria 5414
230 Ga0265316_10152871 3300031344 Bacteria 1728
231 Ga0265313_10002056 3300031595 Bacteria 18048
232 Ga0265313_10003419 3300031595 Bacteria 12859
233 Ga0265314_10025675 3300031711 Bacteria 4439
234 Ga0265314_10077167 3300031711 Bacteria 2211
235 Ga0265314_10135218 3300031711 Bacteria 1532
236 Ga0265342_10025846 3300031712 Bacteria 3686
237 Ga0307416_100131095 3300032002 Bacteria 2257
238 Ga0373960_0042270 3300035121 Bacteria 1323
239 Ga0373937_0041245 3300036401 Bacteria 4210
240 Ga0373937_0540722 3300036401 Bacteria 1107
241 Ga0372808_002789 3300036459 Bacteria 2063
242 Ga0395900_0116557 3300037418 Bacteria 2741
243 Ga0395898_0106064 3300037466 Bacteria 2695
244 Ga0436364_1456431 3300037853 Bacteria 47323
245 Ga0436365_0171687 3300039437 Bacteria 172237
246 Ga0436365_0972682 3300039437 Bacteria 11263
247 Ga0436363_1398859 3300039450 Bacteria 1956
248 Ga0436362_0541191 3300039453 Bacteria 2107
249 Ga0451841_1034638 3300041498 Bacteria 1242
250 Ga0439452_000012 3300042010 Bacteria 412478
251 Ga0453684_0000859 3300044712 Bacteria 102253
252 Ga0453684_0027763 3300044712 Bacteria 8102
253 Ga0466957_0209317 3300044842 Bacteria 1283
254 Ga0466960_0000011 3300044901 Bacteria 60167
255 Ga0495591_000100 3300046458 Bacteria 99473
256 Ga0495651_0026153 3300046462 Bacteria 4545
257 Ga0495650_0004375 3300046471 Bacteria 9715
258 Ga0495606_0152112 3300046507 Bacteria 1357
259 Ga0495608_0039237 3300046511 Bacteria 3175
260 Ga0495618_0033968 3300046514 Bacteria 3198
261 Ga0495618_0181619 3300046514 Bacteria 1337
262 Ga0495654_0039794 3300046530 Bacteria 2346
263 Ga0495609_0031342 3300046538 Bacteria 2417
264 Ga0495621_0030531 3300046539 Bacteria 1843
265 Ga0495622_0001782 3300046557 Bacteria 10612
266 Ga0495667_0022846 3300046559 Bacteria 4214
267 Ga0495656_0015758 3300046615 Bacteria 2859
268 Ga0495635_0007442 3300046663 Bacteria 7643
269 Ga0495589_0058194 3300046794 Bacteria 1901
270 Ga0495680_0014088 3300047322 Bacteria 6947
271 Ga0495684_0023043 3300047471 Bacteria 4789
272 Ga0496104_0031551 3300048907 Bacteria 4928
273 Ga0496111_0203526 3300048914 Bacteria 1471
274 Ga0496114_0147972 3300048917 Bacteria 2037
275 Ga0496115_0001614 3300048918 Bacteria 16216
276 Ga0496115_0002372 3300048918 Bacteria 13512
277 Ga0496116_0000804 3300048919 Bacteria 39809
278 Ga0496116_0009094 3300048919 Bacteria 8515
279 Ga0496116_0012323 3300048919 Bacteria 6991
280 Ga0496116_0043469 3300048919 Bacteria 3061
281 Ga0496116_0151464 3300048919 Bacteria 1287
282 Ga0496117_0001256 3300048920 Bacteria 37763
283 Ga0496117_0001370 3300048920 Bacteria 35509
284 Ga0496117_0008739 3300048920 Bacteria 9567
285 Ga0496117_0008999 3300048920 Bacteria 9395
286 Ga0496117_0064356 3300048920 Bacteria 2501
287 Ga0496118_0002942 3300048921 Bacteria 22129
288 Ga0496118_0008338 3300048921 Bacteria 10730
289 Ga0496118_0011525 3300048921 Bacteria 8619
290 Ga0496119_0000023 3300048922 Bacteria 259882
291 Ga0496119_0000398 3300048922 Bacteria 59768
292 Ga0496119_0005735 3300048922 Bacteria 11770
293 Ga0496119_0054638 3300048922 Bacteria 2430
294 Ga0496120_0000499 3300048923 Bacteria 61341
295 Ga0496120_0000864 3300048923 Bacteria 42858
296 Ga0496120_0004217 3300048923 Bacteria 12267
297 Ga0496120_0009147 3300048923 Bacteria 7065
298 Ga0496120_0012774 3300048923 Bacteria 5691
299 Ga0496120_0017683 3300048923 Bacteria 4610
300 Ga0496121_0000154 3300048924 Bacteria 150013
301 Ga0496121_0005026 3300048924 Bacteria 17293
302 Ga0496121_0045912 3300048924 Bacteria 3746
303 Ga0496121_0045948 3300048924 Bacteria 3743
304 Ga0496122_0000005 3300048925 Bacteria 630659
305 Ga0496122_0001681 3300048925 Bacteria 34293
306 Ga0496122_0009877 3300048925 Bacteria 9945
307 Ga0496122_0016296 3300048925 Bacteria 7049
308 Ga0496122_0047024 3300048925 Bacteria 3335
309 Ga0496123_0000008 3300048926 Bacteria 630628
310 Ga0496123_0000504 3300048926 Bacteria 67871
311 Ga0496123_0003429 3300048926 Bacteria 17804
312 Ga0496123_0012592 3300048926 Bacteria 7193
313 Ga0496124_0000109 3300048927 Bacteria 166429
314 Ga0496125_0015422 3300048928 Bacteria 7394
315 Ga0496125_0026046 3300048928 Bacteria 5341
316 Ga0496125_0087153 3300048928 Bacteria 2359
317 Ga0496126_0014650 3300048929 Bacteria 7915
318 Ga0496126_0017046 3300048929 Bacteria 7247
319 Ga0496126_0038736 3300048929 Bacteria 4431
320 Ga0496126_0099457 3300048929 Bacteria 2547
321 Ga0501031_0009806 3300049568 Bacteria 6234
322 Ga0501032_0078547 3300049569 Bacteria 2197
323 Ga0501032_0104193 3300049569 Bacteria 1879
324 Ga0501033_0055831 3300049570 Bacteria 2919
325 Ga0501033_0064090 3300049570 Bacteria 2704
326 Ga0501033_0086756 3300049570 Bacteria 2291
327 Ga0501034_0010933 3300049571 Bacteria 9430
328 Ga0501034_0084142 3300049571 Bacteria 3183
329 Ga0501034_0093216 3300049571 Bacteria 3008
330 Ga0501036_0343629 3300049572 Bacteria 1246
331 Ga0501037_0035517 3300049573 Bacteria 3675
332 Ga0501038_0004442 3300049574 Bacteria 13034
333 Ga0501038_0093319 3300049574 Bacteria 2518
334 Ga0501038_0379649 3300049574 Bacteria 1096
335 Ga0501042_0031522 3300049578 Bacteria 3750
336 Ga0501042_0071304 3300049578 Bacteria 2485
337 Ga0501043_0034582 3300049579 Bacteria 3974
338 Ga0501043_0082004 3300049579 Bacteria 2534
339 Ga0501046_0015800 3300049580 Bacteria 6334
340 Ga0501046_0076865 3300049580 Bacteria 2585
341 Ga0501047_0007376 3300049581 Bacteria 10342
342 Ga0501047_0043642 3300049581 Bacteria 4331
343 Ga0501047_0049235 3300049581 Bacteria 4069
344 Ga0501047_0074268 3300049581 Bacteria 3273
345 Ga0501047_0225355 3300049581 Bacteria 1729
346 Ga0501047_0247649 3300049581 Bacteria 1631
347 Ga0501048_0002093 3300049582 Bacteria 15209
348 Ga0501048_0013211 3300049582 Bacteria 6127
349 Ga0501067_0000647 3300049583 Bacteria 18721
350 Ga0501068_0118263 3300049584 Bacteria 1651
351 Ga0501069_0002122 3300049585 Bacteria 9988
352 Ga0501069_0015454 3300049585 Bacteria 4091
353 Ga0501070_0174450 3300049586 Bacteria 1770
354 Ga0501071_0071264 3300049587 Bacteria 2533
355 Ga0501072_0066088 3300049588 Bacteria 2853
356 Ga0501073_0001751 3300049589 Bacteria 16114
357 Ga0501073_0020535 3300049589 Bacteria 4763
358 Ga0501073_0075581 3300049589 Bacteria 2345
359 Ga0501074_0014445 3300049590 Bacteria 5746
360 Ga0501074_0014451 3300049590 Bacteria 5743
361 Ga0501079_0003518 3300049741 Bacteria 11509
362 Ga0501080_0134856 3300049742 Bacteria 2285
363 Ga0501080_0163836 3300049742 Bacteria 2052
364 Ga0501083_0004671 3300049744 Bacteria 9679
365 Ga0501083_0020396 3300049744 Bacteria 4611
366 Ga0501035_0048888 3300049822 Bacteria 3791
367 Ga0501035_0051119 3300049822 Bacteria 3702
368 Ga0501035_0091055 3300049822 Bacteria 2684
369 Ga0501044_0005781 3300049823 Bacteria 13691
370 Ga0501044_0050321 3300049823 Bacteria 4300
371 Ga0501044_0135265 3300049823 Bacteria 2456
372 Ga0501044_0171279 3300049823 Bacteria 2142
373 Ga0501044_0294537 3300049823 Bacteria 1553
374 Ga0501045_0010232 3300049824 Bacteria 6568
375 nmdc:mga08y16_163_c1 3300050511 Bacteria 57931
376 nmdc:mga0n895_150365_c1 3300050512 Bacteria 2358
377 nmdc:mga0a205_103892_c1 3300050515 Bacteria 2740
378 Ga0500643_000017 3300053087 Bacteria 305781
379 Ga0500595_002549 3300053119 Bacteria 8924
380 Ga0500573_0000047 3300053140 Bacteria 96942
381 Ga0500573_0012169 3300053140 Bacteria 4829
382 Ga0501084_0026284 3300054114 Bacteria 4855
383 Ga0501084_0076952 3300054114 Bacteria 2797
384 Ga0501082_0039800 3300060353 Bacteria 4055
385 Ga0501082_0195748 3300060353 Bacteria 1758
386 2526063519 2524614857 Bacteria 4146328
387 2547698368 2547132181 Bacteria 4945084
388 2555260858 2554235234 Bacteria 5762085
389 2558908768 2558860112 Bacteria 9931328
390 2562464885 2561511199 Bacteria 5155034
391 2599411743 2599185169 Bacteria 5441380
392 2601524584 2600255254 Bacteria 5281859
393 2601529738 2600255255 Bacteria 5282785
394 2601534612 2600255256 Bacteria 5597742
395 2601539197 2600255257 Bacteria 5597196
396 2601616572 2600255280 Bacteria 5292309
397 2601621294 2600255281 Bacteria 5288753
398 2601645145 2600255287 Bacteria 5210468
399 2601649691 2600255288 Bacteria 5282738
400 2601654618 2600255289 Bacteria 5281907
401 2601660108 2600255290 Bacteria 5282218
402 2601664386 2600255291 Bacteria 5217298
403 2601698081 2600255298 Bacteria 5215185
404 2601702449 2600255299 Bacteria 5218662
405 2601707362 2600255300 Bacteria 5287774
406 2601712383 2600255301 Bacteria 5280532
407 2601717879 2600255302 Bacteria 5288235
408 2601722952 2600255303 Bacteria 5219315
409 2601727807 2600255304 Bacteria 5283973
410 2601732824 2600255305 Bacteria 5282329
411 2601737407 2600255306 Bacteria 5281613
412 2601741826 2600255307 Bacteria 5439064
413 2601752724 2600255309 Bacteria 5431045
414 2601757546 2600255310 Bacteria 5600903
415 2601763905 2600255311 Bacteria 5598766
416 2602019704 2600255392 Bacteria 5437392
417 2603640252 2602042046 Bacteria 5483348
418 2603662550 2602042052 Bacteria 5215873
419 2603667446 2602042053 Bacteria 5214361
420 2603840233 2602042103 Bacteria 5284714
421 2603845310 2602042104 Bacteria 5281639
422 2603850383 2602042105 Bacteria 5282303
423 2603855451 2602042106 Bacteria 5282744
424 2603868287 2602042109 Bacteria 5152801
425 2603873101 2602042110 Bacteria 5283285
426 2603878257 2602042111 Bacteria 5212080
427 2606050212 2603880178 Bacteria 5283018
428 2606071874 2603880184 Bacteria 5217896
429 2606147895 2603880202 Bacteria 5284684
430 2606178170 2603880211 Bacteria 5284226
431 2609911188 2609459761 Bacteria 5513740
432 2637222887 2636415599 Bacteria 5718434
433 2676408849 2675903046 Bacteria 5451247
434 2712470502 2711768156 Bacteria 4471618
435 2739267887 2738543017 Bacteria 4271950
436 2740064748 2739367875 Bacteria 4157290
437 2757566559 2757320391 Bacteria 4746095
438 2777021225 2775507074 Bacteria 5532402
439 2792311138 2791355010 Bacteria 4864581
440 2813726498 2811995292 Bacteria 5303342
441 2814693871 2814123068 Bacteria 5687681
442 2857587223 2857586860 Bacteria 4354574
443 2904516632 2904513164 Bacteria 5476410
444 2919112242 2919108558 Bacteria 5897419
445 2928510543 2928510474 Bacteria 4815308
446 2935628873 2935625433 Bacteria 5042964
447 2936343360 2936340661 Bacteria 5139038
448 2936362134 2936361878 Bacteria 5632809
449 2939569003 2939568625 Bacteria 4542555
450 2939620765 2939617950 Bacteria 4820956
451 2939643948 2939642701 Bacteria 4475280
452 2945875564 2945874760 Bacteria 5527237
453 2969079911 2969079654 Bacteria 5439582
454 2971821270 2971820967 Bacteria 5823634
455 2974435953 2974435778 Bacteria 4876478
456 2984562365 2984559226 Bacteria 5683096
457 2984600422 2984595703 Bacteria 5682994
458 8019507279 8019504834 Bacteria 4819156
459 8055534106 8055531788 Bacteria 5249694
460 Ga0105240_10181899
461 JGI25152J39213_1001634
462 JGI25165J46597_1000080
463 JGI25153J46596_10019890
464 rootH1_10093385
465 Ga0055538_1000573
466 Ga0058692_1000752
467 Ga0065704_10012775
468 Ga0065704_10079220
469 Ga0070658_10008133
470 Ga0070658_10066515
471 Ga0070658_10257745
472 Ga0070676_10002943
473 Ga0068869_100022493
474 Ga0070666_10026426
475 Ga0068868_100051267
476 Ga0070660_100088064
477 Ga0070689_100283987
478 Ga0070673_100018804
479 Ga0070659_100407766
480 Ga0070714_100007875
481 Ga0070713_100003894
482 Ga0070678_100007857
483 Ga0070678_100019800
484 Ga0070662_100067905
485 Ga0068867_100028104
486 Ga0070707_100082767
487 Ga0070698_100024120
488 Ga0070679_100043074
489 Ga0070679_100095981
490 Ga0068853_100431767
491 Ga0070665_100003057
492 Ga0070665_100014436
493 Ga0070665_100016070
494 Ga0070665_100061669
495 Ga0070665_100229918
496 Ga0068855_100151625
497 Ga0068855_100155074
498 Ga0070664_100317222
499 Ga0068857_100034992
500 Ga0068857_100080262
501 Ga0068856_100162067
502 Ga0068856_100300267
503 Ga0068859_100272717
504 Ga0068866_10009263
505 Ga0068870_10164369
506 Ga0068863_100057277
507 Ga0068858_100021719
508 Ga0068860_100165203
509 Ga0070717_10136501
510 Ga0075364_10000919
511 Ga0075362_10062177
512 Ga0075366_10105615
513 Ga0097621_100013533
514 Ga0097621_100037806
515 Ga0097621_100084094
516 Ga0068871_100002680
517 Ga0068871_100004106
518 Ga0075434_100319469
519 Ga0068865_100014510
520 Ga0097620_100272731
521 Ga0079104_1000149
522 Ga0079104_1000263
523 Ga0079104_1000716
524 Ga0099794_10013393
525 Ga0105251_10000577
526 Ga0105251_10004679
527 Ga0105251_10025306
528 Ga0105251_10043844
529 Ga0105244_10000015
530 Ga0105244_10000389
531 Ga0105244_10002335
532 Ga0105250_10000012
533 Ga0105250_10006453
534 Ga0105250_10110019
535 Ga0105240_10023516
536 Ga0105240_10154958
537 Ga0105240_10585510
538 Ga0111539_10000910
539 Ga0111539_10266084
540 Ga0105245_10017217
541 Ga0105245_10028675
542 Ga0105245_10053076
543 Ga0105247_10170603
544 Ga0114129_10350762
545 Ga0105243_10000455
546 Ga0105243_10000851
547 Ga0105243_10030205
548 Ga0105243_10451710
549 Ga0105241_10034028
550 Ga0105241_10071287
551 Ga0105241_10101981
552 Ga0105242_10018871
553 Ga0105242_10040788
554 Ga0105248_10016581
555 Ga0105248_10560358
556 Ga0105238_10035861
557 Ga0105238_10202435
558 Ga0105238_10391248
559 Ga0105249_10016981
560 Ga0105239_10059071
561 Ga0105239_10882317
562 Ga0105246_10008152
563 Ga0105246_10016289
564 Ga0105246_10234348
565 Ga0157371_10101579
566 Ga0157371_10126949
567 Ga0157370_10027158
568 Ga0157370_10186082
569 Ga0157369_10003489
570 Ga0157369_10317433
571 Ga0157374_10016866
572 Ga0157378_10051578
573 Ga0157378_10203522
574 Ga0157378_10492767
575 Ga0163162_10049085
576 Ga0163162_10305909
577 Ga0157372_10001020
578 Ga0157372_10502078
579 Ga0157375_10033050
580 Ga0163163_10000021
581 Ga0163163_10589345
582 Ga0157377_10036857
583 Ga0157379_10006174
584 Ga0157379_10025083
585 Ga0157379_10108298
586 Ga0157379_10123626
587 Ga0157376_10003177
588 Ga0163161_10004257
589 Ga0213876_10000039
590 Ga0213876_10002594
591 Ga0213875_10001489
592 Ga0209784_100240
593 Ga0209129_1000021
594 Ga0209233_1000006
595 Ga0209233_1004125
596 Ga0209758_1000008
597 Ga0207696_1000040
598 Ga0207696_1005688
599 Ga0207655_1000001
600 Ga0207655_1000061
601 Ga0207655_1003510
602 Ga0207713_1000017
603 Ga0207713_1000053
604 Ga0207713_1018894
605 Ga0207713_1033860
606 Ga0207713_1036075
607 Ga0207642_10007033
608 Ga0207642_10094955
609 Ga0207645_10004193
610 Ga0207643_10076517
611 Ga0207705_10002674
612 Ga0207654_10038841
613 Ga0207654_10153449
614 Ga0207707_10048450
615 Ga0207707_10106924
616 Ga0207695_10065011
617 Ga0207695_10126864
618 Ga0207695_10153685
619 Ga0207660_10164340
620 Ga0207657_10108760
621 Ga0207652_10069980
622 Ga0207652_10205835
623 Ga0207646_10045095
624 Ga0207694_10029229
625 Ga0207694_10030424
626 Ga0207694_10135147
627 Ga0207694_10166359
628 Ga0207687_10058298
629 Ga0207687_10060976
630 Ga0207700_10028010
631 Ga0207700_10076940
632 Ga0207664_10002399
633 Ga0207690_10013089
634 Ga0207706_10164589
635 Ga0207686_10071477
636 Ga0207709_10000612
637 Ga0207709_10009133
638 Ga0207709_10103640
639 Ga0207704_10064950
640 Ga0207704_10079494
641 Ga0207711_10032869
642 Ga0207711_10162455
643 Ga0207689_10008366
644 Ga0207689_10020237
645 Ga0207667_10068799
646 Ga0207667_10091178
647 Ga0207651_10012287
648 Ga0207712_10287589
649 Ga0207703_10006683
650 Ga0207703_10053651
651 Ga0207639_10522777
652 Ga0207648_10009821
653 Ga0207648_10132476
654 Ga0207676_10221831
655 Ga0207674_10025756
656 Ga0207674_10112643
657 Ga0207683_10044552
658 Ga0209281_1000006
659 Ga0209281_1000197
660 Ga0209281_1000287
661 Ga0209281_1004922
662 Ga0209371_1000027
663 Ga0209371_1000029
664 Ga0209371_1000481
665 Ga0209371_1004790
666 Ga0207428_10010497
667 Ga0268266_10000386
668 Ga0268266_10035023
669 Ga0268266_10037580
670 Ga0268266_10040978
671 Ga0265337_1000453
672 Ga0265326_10000476
673 Ga0265334_10004845
674 Ga0265338_10000784
675 Ga0265338_10038399
676 Ga0268256_1000032
677 Ga0268256_1000045
678 Ga0268256_1000407
679 Ga0268256_1004599
680 Ga0268256_1006010
681 Ga0268256_1008770
682 Ga0265332_10008977
683 Ga0265332_10010170
684 Ga0265325_10016455
685 Ga0265331_10003709
686 Ga0265331_10014483
687 Ga0265331_10075680
688 Ga0265316_10021813
689 Ga0265316_10152871
690 Ga0265313_10002056
691 Ga0265313_10003419
692 Ga0265314_10025675
693 Ga0265314_10077167
694 Ga0265314_10135218
695 Ga0265342_10025846
696 Ga0307416_100131095
697 Ga0373960_0042270
698 Ga0373937_0041245
699 Ga0373937_0540722
700 Ga0372808_002789
701 Ga0395900_0116557
702 Ga0395898_0106064
703 Ga0436364_1456431
704 Ga0436365_0171687
705 Ga0436365_0972682
706 Ga0436363_1398859
707 Ga0436362_0541191
708 Ga0451841_1034638
709 Ga0439452_000012
710 Ga0453684_0000859
711 Ga0453684_0027763
712 Ga0466957_0209317
713 Ga0466960_0000011
714 Ga0495591_000100
715 Ga0495651_0026153
716 Ga0495650_0004375
717 Ga0495606_0152112
718 Ga0495608_0039237
719 Ga0495618_0033968
720 Ga0495618_0181619
721 Ga0495654_0039794
722 Ga0495609_0031342
723 Ga0495621_0030531
724 Ga0495622_0001782
725 Ga0495667_0022846
726 Ga0495656_0015758
727 Ga0495635_0007442
728 Ga0495589_0058194
729 Ga0495680_0014088
730 Ga0495684_0023043
731 Ga0496104_0031551
732 Ga0496111_0203526
733 Ga0496114_0147972
734 Ga0496115_0001614
735 Ga0496115_0002372
736 Ga0496116_0000804
737 Ga0496116_0009094
738 Ga0496116_0012323
739 Ga0496116_0043469
740 Ga0496116_0151464
741 Ga0496117_0001256
742 Ga0496117_0001370
743 Ga0496117_0008739
744 Ga0496117_0008999
745 Ga0496117_0064356
746 Ga0496118_0002942
747 Ga0496118_0008338
748 Ga0496118_0011525
749 Ga0496119_0000023
750 Ga0496119_0000398
751 Ga0496119_0005735
752 Ga0496119_0054638
753 Ga0496120_0000499
754 Ga0496120_0000864
755 Ga0496120_0004217
756 Ga0496120_0009147
757 Ga0496120_0012774
758 Ga0496120_0017683
759 Ga0496121_0000154
760 Ga0496121_0005026
761 Ga0496121_0045912
762 Ga0496121_0045948
763 Ga0496122_0000005
764 Ga0496122_0001681
765 Ga0496122_0009877
766 Ga0496122_0016296
767 Ga0496122_0047024
768 Ga0496123_0000008
769 Ga0496123_0000504
770 Ga0496123_0003429
771 Ga0496123_0012592
772 Ga0496124_0000109
773 Ga0496125_0015422
774 Ga0496125_0026046
775 Ga0496125_0087153
776 Ga0496126_0014650
777 Ga0496126_0017046
778 Ga0496126_0038736
779 Ga0496126_0099457
780 Ga0501031_0009806
781 Ga0501032_0078547
782 Ga0501032_0104193
783 Ga0501033_0055831
784 Ga0501033_0064090
785 Ga0501033_0086756
786 Ga0501034_0010933
787 Ga0501034_0084142
788 Ga0501034_0093216
789 Ga0501036_0343629
790 Ga0501037_0035517
791 Ga0501038_0004442
792 Ga0501038_0093319
793 Ga0501038_0379649
794 Ga0501042_0031522
795 Ga0501042_0071304
796 Ga0501043_0034582
797 Ga0501043_0082004
798 Ga0501046_0015800
799 Ga0501046_0076865
800 Ga0501047_0007376
801 Ga0501047_0043642
802 Ga0501047_0049235
803 Ga0501047_0074268
804 Ga0501047_0225355
805 Ga0501047_0247649
806 Ga0501048_0002093
807 Ga0501048_0013211
808 Ga0501067_0000647
809 Ga0501068_0118263
810 Ga0501069_0002122
811 Ga0501069_0015454
812 Ga0501070_0174450
813 Ga0501071_0071264
814 Ga0501072_0066088
815 Ga0501073_0001751
816 Ga0501073_0020535
817 Ga0501073_0075581
818 Ga0501074_0014445
819 Ga0501074_0014451
820 Ga0501079_0003518
821 Ga0501080_0134856
822 Ga0501080_0163836
823 Ga0501083_0004671
824 Ga0501083_0020396
825 Ga0501035_0048888
826 Ga0501035_0051119
827 Ga0501035_0091055
828 Ga0501044_0005781
829 Ga0501044_0050321
830 Ga0501044_0135265
831 Ga0501044_0171279
832 Ga0501044_0294537
833 Ga0501045_0010232
834 nmdc:mga08y16_163_c1
835 nmdc:mga0n895_150365_c1
836 nmdc:mga0a205_103892_c1
837 Ga0500643_000017
838 Ga0500595_002549
839 Ga0500573_0000047
840 Ga0500573_0012169
841 Ga0501084_0026284
842 Ga0501084_0076952
843 Ga0501082_0039800
844 Ga0501082_0195748
845 2526063519
846 2547698368
847 2555260858
848 2558908768
849 2562464885
850 2599411743
851 2601524584
852 2601529738
853 2601534612
854 2601539197
855 2601616572
856 2601621294
857 2601645145
858 2601649691
859 2601654618
860 2601660108
861 2601664386
862 2601698081
863 2601702449
864 2601707362
865 2601712383
866 2601717879
867 2601722952
868 2601727807
869 2601732824
870 2601737407
871 2601741826
872 2601752724
873 2601757546
874 2601763905
875 2602019704
876 2603640252
877 2603662550
878 2603667446
879 2603840233
880 2603845310
881 2603850383
882 2603855451
883 2603868287
884 2603873101
885 2603878257
886 2606050212
887 2606071874
888 2606147895
889 2606178170
890 2609911188
891 2637222887
892 2676408849
893 2712470502
894 2739267887
895 2740064748
896 2757566559
897 2777021225
898 2792311138
899 2813726498
900 2814693871
901 2857587223
902 2904516632
903 2919112242
904 2928510543
905 2935628873
906 2936343360
907 2936362134
908 2939569003
909 2939620765
910 2939643948
911 2945875564
912 2969079911
913 2971821270
914 2974435953
915 2984562365
916 2984600422
917 8019507279
918 8055534106

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

150

371

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

36

139

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8357 76 286
7ahd-assembly1.cif.gz_B opua (e190q) occluded 0.8276 83 282
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8038 76 286
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7957 77 286
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7863 76 277
ID Description Score Start End Superfamily
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9812 74 286 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9722 74 286 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9483 66 288 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9467 72 286 1.10.3720.10
af_P0AFH2_84_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.946 71 284 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6S6NWT9-F1-model_v4 deleted 0.9779 20 295
AF-A0A090R1R7-F1-model_v4 deleted 0.9741 29 289
AF-W1XAJ9-F1-model_v4 Nickel transport system permease protein nikB 0.9734 14 230 GO:0005886
GO:0071916
AF-W1XAJ9-F1-model_v4 Nickel transport system permease protein nikB 0.969 14 230 GO:0005886
GO:0071916
AF-A0A2S5LB94-F1-model_v4 Glutathione ABC transporter permease GsiC 0.9671 66 289 GO:0005886
GO:0055085

Map