F448243
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 458 | 274 | 457 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0000740|Ga0466972_0000740_11281_11910 |
| Length | 209 |
| Sequence | MGYSLAVLNVCDVMACTRRHGLYRSRFTLRAQQMSQPASVSESPLQEQCAIDRRMVDGAHFKDAYRVSLSKDAPAVQVFQAVFAHHPWWMKLALIVRNVLASALGLATPSMAEVLRPTFASDYAVCQRIGVWPIFAVSTTELIVGRDNKHLDFRLSVLIHRVGAVPSATISTVCLAHNAFGRLYLLAVAPFHKFGLRRLLRSAVVDGRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 61 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 66 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 147 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 148 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 149 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 150 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 151 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 152 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 153 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 162 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 163 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 236 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 237 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 238 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 239 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 240 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 245 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 246 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 247 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 248 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 249 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 255 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 257 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 260 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 261 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 262 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 263 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 264 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 268 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 269 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 270 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 271 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 272 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 273 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 274 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0 |
| Isolates | 0.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.83 |
| Nodule | 0.22 |
| Rhizoplane | 5.68 |
| Rhizosphere | 79.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10007230 | 3300003203 | Bacteria | 5080 |
| 2 | rootH2_10250460 | 3300003320 | Bacteria | 1484 |
| 3 | rootL2_10120592 | 3300003322 | Bacteria | 2539 |
| 4 | JGI25404J52841_10002183 | 3300003659 | Bacteria | 3659 |
| 5 | JGI25404J52841_10003051 | 3300003659 | Bacteria | 3264 |
| 6 | JGI25404J52841_10020429 | 3300003659 | Bacteria | 1434 |
| 7 | JGI25404J52841_10031721 | 3300003659 | Bacteria | 1128 |
| 8 | JGI25404J52841_10053020 | 3300003659 | Bacteria | 851 |
| 9 | JGI25404J52841_10059641 | 3300003659 | Bacteria | 800 |
| 10 | Ga0070676_10221451 | 3300005328 | Bacteria | 1250 |
| 11 | Ga0070670_100012085 | 3300005331 | Bacteria | 7384 |
| 12 | Ga0068869_100096137 | 3300005334 | Bacteria | 2235 |
| 13 | Ga0070666_10358207 | 3300005335 | Bacteria | 1045 |
| 14 | Ga0068868_100042893 | 3300005338 | Bacteria | 3533 |
| 15 | Ga0070689_101119713 | 3300005340 | Bacteria | 704 |
| 16 | Ga0070691_10596228 | 3300005341 | Bacteria | 651 |
| 17 | Ga0070687_100517977 | 3300005343 | Bacteria | 806 |
| 18 | Ga0070661_100417800 | 3300005344 | Bacteria | 1063 |
| 19 | Ga0070668_100157891 | 3300005347 | Bacteria | 1838 |
| 20 | Ga0070669_100086432 | 3300005353 | Bacteria | 2343 |
| 21 | Ga0070675_100178875 | 3300005354 | Bacteria | 1833 |
| 22 | Ga0070675_100689870 | 3300005354 | Bacteria | 930 |
| 23 | Ga0070671_100002121 | 3300005355 | Bacteria | 15298 |
| 24 | Ga0070671_100425375 | 3300005355 | Bacteria | 1138 |
| 25 | Ga0070674_100180883 | 3300005356 | Bacteria | 1615 |
| 26 | Ga0070674_100349479 | 3300005356 | Bacteria | 1194 |
| 27 | Ga0070674_100632634 | 3300005356 | Bacteria | 908 |
| 28 | Ga0070673_100090885 | 3300005364 | Unclassified | 2495 |
| 29 | Ga0070673_100280037 | 3300005364 | Bacteria | 1462 |
| 30 | Ga0070673_100435481 | 3300005364 | Bacteria | 1177 |
| 31 | Ga0070688_100322675 | 3300005365 | Bacteria | 1123 |
| 32 | Ga0070688_100788336 | 3300005365 | Unclassified | 742 |
| 33 | Ga0070659_100858242 | 3300005366 | Bacteria | 792 |
| 34 | Ga0070667_100311629 | 3300005367 | Bacteria | 1419 |
| 35 | Ga0070709_10425601 | 3300005434 | Bacteria | 996 |
| 36 | Ga0070714_100524085 | 3300005435 | Bacteria | 1132 |
| 37 | Ga0070711_100272519 | 3300005439 | Bacteria | 1336 |
| 38 | Ga0070711_100337041 | 3300005439 | Bacteria | 1209 |
| 39 | Ga0070708_100051719 | 3300005445 | Bacteria | 3640 |
| 40 | Ga0070663_100051325 | 3300005455 | Bacteria | 2937 |
| 41 | Ga0070663_100827377 | 3300005455 | Bacteria | 795 |
| 42 | Ga0070678_100057818 | 3300005456 | Bacteria | 2843 |
| 43 | Ga0070678_100078551 | 3300005456 | Bacteria | 2493 |
| 44 | Ga0070678_100200831 | 3300005456 | Bacteria | 1645 |
| 45 | Ga0070662_100675536 | 3300005457 | Bacteria | 873 |
| 46 | Ga0068867_100109506 | 3300005459 | Bacteria | 2120 |
| 47 | Ga0070685_10368303 | 3300005466 | Bacteria | 987 |
| 48 | Ga0070706_100069687 | 3300005467 | Bacteria | 3253 |
| 49 | Ga0070698_100298518 | 3300005471 | Bacteria | 1542 |
| 50 | Ga0070698_101090973 | 3300005471 | Bacteria | 747 |
| 51 | Ga0070697_100169745 | 3300005536 | Bacteria | 1846 |
| 52 | Ga0068853_100228733 | 3300005539 | Bacteria | 1700 |
| 53 | Ga0070672_100126926 | 3300005543 | Bacteria | 2093 |
| 54 | Ga0070665_100066611 | 3300005548 | Bacteria | 3612 |
| 55 | Ga0070665_100090506 | 3300005548 | Bacteria | 3065 |
| 56 | Ga0070665_100336739 | 3300005548 | Bacteria | 1513 |
| 57 | Ga0070665_100738303 | 3300005548 | Bacteria | 998 |
| 58 | Ga0068855_100473784 | 3300005563 | Bacteria | 1363 |
| 59 | Ga0070664_100083929 | 3300005564 | Plasmid | 2749 |
| 60 | Ga0068857_100666717 | 3300005577 | Bacteria | 987 |
| 61 | Ga0068854_100256882 | 3300005578 | Bacteria | 1397 |
| 62 | Ga0068856_100273146 | 3300005614 | Bacteria | 1706 |
| 63 | Ga0068852_100248430 | 3300005616 | Bacteria | 1703 |
| 64 | Ga0068859_100367682 | 3300005617 | Bacteria | 1533 |
| 65 | Ga0068859_100877472 | 3300005617 | Bacteria | 982 |
| 66 | Ga0068864_100141637 | 3300005618 | Bacteria | 2169 |
| 67 | Ga0068870_10361172 | 3300005840 | Bacteria | 935 |
| 68 | Ga0068863_100367327 | 3300005841 | Bacteria | 1404 |
| 69 | Ga0068863_100675244 | 3300005841 | Bacteria | 1026 |
| 70 | Ga0068858_100494347 | 3300005842 | Bacteria | 1181 |
| 71 | Ga0068862_100148897 | 3300005844 | Bacteria | 2082 |
| 72 | Ga0081455_10009859 | 3300005937 | Bacteria | 9783 |
| 73 | Ga0081455_10010351 | 3300005937 | Bacteria | 9476 |
| 74 | Ga0081455_10271713 | 3300005937 | Bacteria | 1229 |
| 75 | Ga0081455_10352407 | 3300005937 | Bacteria | 1038 |
| 76 | Ga0081540_1002409 | 3300005983 | Bacteria | 15242 |
| 77 | Ga0081540_1004015 | 3300005983 | Bacteria | 11394 |
| 78 | Ga0081540_1005098 | 3300005983 | Bacteria | 9852 |
| 79 | Ga0081540_1005864 | 3300005983 | Bacteria | 9086 |
| 80 | Ga0081540_1006387 | 3300005983 | Bacteria | 8594 |
| 81 | Ga0081540_1015259 | 3300005983 | Bacteria | 4871 |
| 82 | Ga0081540_1058525 | 3300005983 | Bacteria | 1856 |
| 83 | Ga0081540_1067209 | 3300005983 | Bacteria | 1676 |
| 84 | Ga0081540_1095723 | 3300005983 | Bacteria | 1293 |
| 85 | Ga0081540_1131936 | 3300005983 | Bacteria | 1018 |
| 86 | Ga0081539_10016758 | 3300005985 | Bacteria | 5203 |
| 87 | Ga0081539_10170022 | 3300005985 | Bacteria | 1031 |
| 88 | Ga0075365_10166813 | 3300006038 | Bacteria | 1536 |
| 89 | Ga0075365_10307119 | 3300006038 | Bacteria | 1117 |
| 90 | Ga0075368_10220649 | 3300006042 | Bacteria | 805 |
| 91 | Ga0075363_100068592 | 3300006048 | Bacteria | 1923 |
| 92 | Ga0075363_100232179 | 3300006048 | Bacteria | 1059 |
| 93 | Ga0075364_10100606 | 3300006051 | Bacteria | 1924 |
| 94 | Ga0070716_100200191 | 3300006173 | Unclassified | 1327 |
| 95 | Ga0070712_100992842 | 3300006175 | Unclassified | 726 |
| 96 | Ga0075362_10074756 | 3300006177 | Bacteria | 1553 |
| 97 | Ga0075367_10110032 | 3300006178 | Bacteria | 1690 |
| 98 | Ga0075367_10195079 | 3300006178 | Bacteria | 1264 |
| 99 | Ga0075367_10221277 | 3300006178 | Bacteria | 1185 |
| 100 | Ga0075367_10258959 | 3300006178 | Bacteria | 1092 |
| 101 | Ga0075366_10342841 | 3300006195 | Bacteria | 916 |
| 102 | Ga0075370_10138859 | 3300006353 | Bacteria | 1420 |
| 103 | Ga0068871_100586661 | 3300006358 | Bacteria | 1012 |
| 104 | Ga0075433_10194301 | 3300006852 | Bacteria | 1805 |
| 105 | Ga0075433_11039782 | 3300006852 | Bacteria | 713 |
| 106 | Ga0075434_100243387 | 3300006871 | Bacteria | 1819 |
| 107 | Ga0075434_100500998 | 3300006871 | Bacteria | 1235 |
| 108 | Ga0068865_100047409 | 3300006881 | Bacteria | 2952 |
| 109 | Ga0068865_100739871 | 3300006881 | Bacteria | 844 |
| 110 | Ga0068865_101097232 | 3300006881 | Bacteria | 701 |
| 111 | Ga0097620_100367663 | 3300006931 | Bacteria | 1533 |
| 112 | Ga0097620_100877446 | 3300006931 | Bacteria | 982 |
| 113 | Ga0099794_10091806 | 3300007265 | Bacteria | 1507 |
| 114 | Ga0099794_10107997 | 3300007265 | Bacteria | 1392 |
| 115 | Ga0099794_10181834 | 3300007265 | Bacteria | 1073 |
| 116 | Ga0099795_10066715 | 3300007788 | Bacteria | 1348 |
| 117 | Ga0099795_10069526 | 3300007788 | Bacteria | 1325 |
| 118 | Ga0099795_10205062 | 3300007788 | Bacteria | 833 |
| 119 | Ga0105245_10278389 | 3300009098 | Unclassified | 1634 |
| 120 | Ga0105245_10702634 | 3300009098 | Bacteria | 1044 |
| 121 | Ga0105247_10073237 | 3300009101 | Bacteria | 2146 |
| 122 | Ga0105247_10379792 | 3300009101 | Bacteria | 1001 |
| 123 | Ga0114129_11192802 | 3300009147 | Bacteria | 948 |
| 124 | Ga0105243_11199680 | 3300009148 | Bacteria | 772 |
| 125 | Ga0105241_10059652 | 3300009174 | Bacteria | 2934 |
| 126 | Ga0105241_10163740 | 3300009174 | Unclassified | 1831 |
| 127 | Ga0105241_10658625 | 3300009174 | Bacteria | 952 |
| 128 | Ga0105248_10761857 | 3300009177 | Bacteria | 1092 |
| 129 | Ga0105237_10432007 | 3300009545 | Bacteria | 1323 |
| 130 | Ga0105237_10495747 | 3300009545 | Bacteria | 1228 |
| 131 | Ga0105237_11358637 | 3300009545 | Unclassified | 717 |
| 132 | Ga0105238_10417185 | 3300009551 | Bacteria | 1336 |
| 133 | Ga0105238_10452204 | 3300009551 | Bacteria | 1281 |
| 134 | Ga0105238_11059663 | 3300009551 | Bacteria | 833 |
| 135 | Ga0105249_10682143 | 3300009553 | Bacteria | 1086 |
| 136 | Ga0099796_10006692 | 3300010159 | Bacteria | 2968 |
| 137 | Ga0099796_10033287 | 3300010159 | Bacteria | 1695 |
| 138 | Ga0105239_10172092 | 3300010375 | Unclassified | 2422 |
| 139 | Ga0105239_10276810 | 3300010375 | Bacteria | 1888 |
| 140 | Ga0105246_10071550 | 3300011119 | Bacteria | 2442 |
| 141 | Ga0105246_10276904 | 3300011119 | Bacteria | 1344 |
| 142 | Ga0105246_10400633 | 3300011119 | Unclassified | 1139 |
| 143 | Ga0105246_11267330 | 3300011119 | Bacteria | 682 |
| 144 | Ga0157374_10085037 | 3300013296 | Bacteria | 3007 |
| 145 | Ga0157374_10428633 | 3300013296 | Unclassified | 1322 |
| 146 | Ga0157378_10395161 | 3300013297 | Unclassified | 1361 |
| 147 | Ga0157378_10519856 | 3300013297 | Bacteria | 1192 |
| 148 | Ga0157378_11790895 | 3300013297 | Unclassified | 662 |
| 149 | Ga0163162_10773005 | 3300013306 | Bacteria | 1079 |
| 150 | Ga0163162_10837879 | 3300013306 | Bacteria | 1035 |
| 151 | Ga0163162_11402380 | 3300013306 | Bacteria | 795 |
| 152 | Ga0157375_10170023 | 3300013308 | Bacteria | 2327 |
| 153 | Ga0157375_10889715 | 3300013308 | Bacteria | 1035 |
| 154 | Ga0163163_10064119 | 3300014325 | Plasmid | 3645 |
| 155 | Ga0163163_10329094 | 3300014325 | Bacteria | 1582 |
| 156 | Ga0163163_10377532 | 3300014325 | Bacteria | 1475 |
| 157 | Ga0157380_11022320 | 3300014326 | Bacteria | 861 |
| 158 | Ga0157377_10169897 | 3300014745 | Bacteria | 1363 |
| 159 | Ga0157377_10546024 | 3300014745 | Unclassified | 818 |
| 160 | Ga0157379_10030271 | 3300014968 | Bacteria | 4817 |
| 161 | Ga0157379_10272952 | 3300014968 | Bacteria | 1538 |
| 162 | Ga0157376_10096943 | 3300014969 | Bacteria | 2568 |
| 163 | Ga0157376_10224723 | 3300014969 | Bacteria | 1741 |
| 164 | Ga0157376_10749573 | 3300014969 | Bacteria | 985 |
| 165 | Ga0163161_10463795 | 3300017792 | Bacteria | 1026 |
| 166 | Ga0228598_1003692 | 3300024227 | Bacteria | 3274 |
| 167 | Ga0207697_10159667 | 3300025315 | Bacteria | 983 |
| 168 | Ga0207642_10354005 | 3300025899 | Bacteria | 867 |
| 169 | Ga0207710_10029727 | 3300025900 | Bacteria | 2380 |
| 170 | Ga0207688_10190060 | 3300025901 | Bacteria | 1228 |
| 171 | Ga0207680_10358180 | 3300025903 | Bacteria | 1026 |
| 172 | Ga0207647_10251005 | 3300025904 | Bacteria | 1015 |
| 173 | Ga0207645_10452494 | 3300025907 | Bacteria | 867 |
| 174 | Ga0207643_10173790 | 3300025908 | Bacteria | 1301 |
| 175 | Ga0207684_10028285 | 3300025910 | Bacteria | 4776 |
| 176 | Ga0207684_10110393 | 3300025910 | Bacteria | 2354 |
| 177 | Ga0207654_10007087 | 3300025911 | Bacteria | 5649 |
| 178 | Ga0207654_10442706 | 3300025911 | Unclassified | 910 |
| 179 | Ga0207671_10019579 | 3300025914 | Bacteria | 5174 |
| 180 | Ga0207671_10568077 | 3300025914 | Unclassified | 904 |
| 181 | Ga0207663_10107013 | 3300025916 | Bacteria | 1891 |
| 182 | Ga0207663_10135907 | 3300025916 | Bacteria | 1706 |
| 183 | Ga0207663_10721507 | 3300025916 | Unclassified | 790 |
| 184 | Ga0207662_10470018 | 3300025918 | Bacteria | 862 |
| 185 | Ga0207649_10382641 | 3300025920 | Bacteria | 1049 |
| 186 | Ga0207681_10238943 | 3300025923 | Bacteria | 1413 |
| 187 | Ga0207694_10880876 | 3300025924 | Bacteria | 757 |
| 188 | Ga0207694_11507320 | 3300025924 | Bacteria | 567 |
| 189 | Ga0207650_10075775 | 3300025925 | Plasmid | 2540 |
| 190 | Ga0207650_10399981 | 3300025925 | Bacteria | 1137 |
| 191 | Ga0207659_10306014 | 3300025926 | Unclassified | 1307 |
| 192 | Ga0207687_10027364 | 3300025927 | Bacteria | 3826 |
| 193 | Ga0207687_10149317 | 3300025927 | Unclassified | 1781 |
| 194 | Ga0207664_10606363 | 3300025929 | Bacteria | 983 |
| 195 | Ga0207644_10003060 | 3300025931 | Bacteria | 10765 |
| 196 | Ga0207644_10055921 | 3300025931 | Bacteria | 2846 |
| 197 | Ga0207644_10868996 | 3300025931 | Bacteria | 755 |
| 198 | Ga0207706_10177441 | 3300025933 | Bacteria | 1871 |
| 199 | Ga0207706_10220027 | 3300025933 | Bacteria | 1663 |
| 200 | Ga0207706_10406683 | 3300025933 | Bacteria | 1180 |
| 201 | Ga0207709_10170513 | 3300025935 | Bacteria | 1527 |
| 202 | Ga0207669_10063199 | 3300025937 | Bacteria | 2284 |
| 203 | Ga0207669_10103714 | 3300025937 | Bacteria | 1887 |
| 204 | Ga0207704_10042640 | 3300025938 | Bacteria | 2672 |
| 205 | Ga0207704_10294936 | 3300025938 | Bacteria | 1239 |
| 206 | Ga0207665_10739323 | 3300025939 | Bacteria | 775 |
| 207 | Ga0207691_10222319 | 3300025940 | Bacteria | 1637 |
| 208 | Ga0207689_10447251 | 3300025942 | Bacteria | 1080 |
| 209 | Ga0207679_11072104 | 3300025945 | Unclassified | 739 |
| 210 | Ga0207651_10151933 | 3300025960 | Bacteria | 1804 |
| 211 | Ga0207640_10215404 | 3300025981 | Bacteria | 1466 |
| 212 | Ga0207658_10211650 | 3300025986 | Bacteria | 1625 |
| 213 | Ga0207658_10456297 | 3300025986 | Bacteria | 1132 |
| 214 | Ga0207677_10062886 | 3300026023 | Bacteria | 2577 |
| 215 | Ga0207703_10066265 | 3300026035 | Bacteria | 2970 |
| 216 | Ga0207639_10080934 | 3300026041 | Bacteria | 2571 |
| 217 | Ga0207678_10517524 | 3300026067 | Bacteria | 1041 |
| 218 | Ga0207641_10568441 | 3300026088 | Bacteria | 1107 |
| 219 | Ga0207641_10960389 | 3300026088 | Bacteria | 850 |
| 220 | Ga0207648_10242681 | 3300026089 | Bacteria | 1604 |
| 221 | Ga0207676_10006429 | 3300026095 | Bacteria | 8303 |
| 222 | Ga0207674_10139383 | 3300026116 | Bacteria | 2386 |
| 223 | Ga0207675_100423129 | 3300026118 | Bacteria | 1316 |
| 224 | Ga0207683_10041585 | 3300026121 | Bacteria | 4014 |
| 225 | Ga0207683_10086116 | 3300026121 | Bacteria | 2793 |
| 226 | Ga0207683_10238958 | 3300026121 | Bacteria | 1657 |
| 227 | Ga0207683_10276731 | 3300026121 | Bacteria | 1534 |
| 228 | Ga0207698_10721935 | 3300026142 | Bacteria | 993 |
| 229 | Ga0209179_1044222 | 3300027512 | Bacteria | 943 |
| 230 | Ga0209588_1023475 | 3300027671 | Bacteria | 1944 |
| 231 | Ga0209588_1038254 | 3300027671 | Bacteria | 1545 |
| 232 | Ga0209588_1053151 | 3300027671 | Bacteria | 1310 |
| 233 | Ga0268266_10001439 | 3300028379 | Bacteria | 28336 |
| 234 | Ga0268266_10033226 | 3300028379 | Bacteria | 4386 |
| 235 | Ga0268266_10360225 | 3300028379 | Unclassified | 1368 |
| 236 | Ga0268264_10596011 | 3300028381 | Bacteria | 1088 |
| 237 | Ga0307517_10000098 | 3300028786 | Bacteria | 126044 |
| 238 | Ga0307517_10366646 | 3300028786 | Bacteria | 776 |
| 239 | Ga0307515_10016400 | 3300028794 | Bacteria | 13559 |
| 240 | Ga0307515_10258556 | 3300028794 | Unclassified | 1481 |
| 241 | Ga0307515_10562728 | 3300028794 | Bacteria | 750 |
| 242 | Ga0265332_10187929 | 3300031238 | Unclassified | 860 |
| 243 | Ga0307513_10043066 | 3300031456 | Bacteria | 4963 |
| 244 | Ga0307513_10253885 | 3300031456 | Bacteria | 1553 |
| 245 | Ga0307509_10071932 | 3300031507 | Bacteria | 3605 |
| 246 | Ga0307509_10302743 | 3300031507 | Bacteria | 1346 |
| 247 | Ga0307508_10207351 | 3300031616 | Bacteria | 1560 |
| 248 | Ga0307508_10231057 | 3300031616 | Bacteria | 1448 |
| 249 | Ga0307508_10344327 | 3300031616 | Bacteria | 1082 |
| 250 | Ga0307508_10612551 | 3300031616 | Unclassified | 691 |
| 251 | Ga0307516_10003537 | 3300031730 | Bacteria | 19981 |
| 252 | Ga0307516_10083064 | 3300031730 | Bacteria | 3045 |
| 253 | Ga0307516_10576725 | 3300031730 | Bacteria | 779 |
| 254 | Ga0373944_0036587 | 3300035089 | Bacteria | 1500 |
| 255 | Ga0373944_0105194 | 3300035089 | Unclassified | 958 |
| 256 | Ga0373923_0127280 | 3300035111 | Bacteria | 1142 |
| 257 | Ga0373936_0021072 | 3300035113 | Unclassified | 2535 |
| 258 | Ga0373939_0161553 | 3300035114 | Unclassified | 823 |
| 259 | Ga0373945_0116584 | 3300035116 | Bacteria | 1058 |
| 260 | Ga0373945_0290541 | 3300035116 | Unclassified | 698 |
| 261 | Ga0373954_0013494 | 3300035118 | Bacteria | 3642 |
| 262 | Ga0373943_0000806 | 3300035170 | Bacteria | 13730 |
| 263 | Ga0373943_0461627 | 3300035170 | Unclassified | 739 |
| 264 | Ga0373946_0040364 | 3300035171 | Bacteria | 1909 |
| 265 | Ga0373935_0003421 | 3300035692 | Bacteria | 9218 |
| 266 | Ga0373935_0501514 | 3300035692 | Unclassified | 881 |
| 267 | Ga0373927_0000046 | 3300035695 | Bacteria | 88401 |
| 268 | Ga0373927_0043815 | 3300035695 | Bacteria | 2896 |
| 269 | Ga0373927_0613437 | 3300035695 | Unclassified | 719 |
| 270 | Ga0373927_0858133 | 3300035695 | Unclassified | 599 |
| 271 | Ga0373947_0002296 | 3300035725 | Bacteria | 11558 |
| 272 | Ga0373925_0003178 | 3300037068 | Bacteria | 12843 |
| 273 | Ga0373925_0227374 | 3300037068 | Bacteria | 1491 |
| 274 | Ga0395905_0160938 | 3300037471 | Unclassified | 2109 |
| 275 | Ga0451791_0477269 | 3300041451 | Bacteria | 896 |
| 276 | Ga0466972_0000740 | 3300044658 | Bacteria | 15601 |
| 277 | Ga0495592_0080841 | 3300046454 | Bacteria | 2350 |
| 278 | Ga0495592_0167965 | 3300046454 | Bacteria | 1504 |
| 279 | Ga0495603_0000051 | 3300046455 | Bacteria | 50402 |
| 280 | Ga0495603_0119464 | 3300046455 | Bacteria | 1536 |
| 281 | Ga0495603_0133660 | 3300046455 | Bacteria | 1444 |
| 282 | Ga0495603_0167436 | 3300046455 | Bacteria | 1273 |
| 283 | Ga0495603_0475457 | 3300046455 | Unclassified | 716 |
| 284 | Ga0495629_0020958 | 3300046459 | Bacteria | 4665 |
| 285 | Ga0495629_0151596 | 3300046459 | Bacteria | 1611 |
| 286 | Ga0495629_0352029 | 3300046459 | Bacteria | 1004 |
| 287 | Ga0495629_0357386 | 3300046459 | Bacteria | 996 |
| 288 | Ga0495638_0071723 | 3300046460 | Bacteria | 2118 |
| 289 | Ga0495638_0458846 | 3300046460 | Bacteria | 649 |
| 290 | Ga0495641_0014250 | 3300046461 | Bacteria | 4310 |
| 291 | Ga0495651_0561460 | 3300046462 | Unclassified | 724 |
| 292 | Ga0495580_0054957 | 3300046472 | Bacteria | 2807 |
| 293 | Ga0495582_0000025 | 3300046473 | Bacteria | 82063 |
| 294 | Ga0495582_0157321 | 3300046473 | Bacteria | 1292 |
| 295 | Ga0495582_0270459 | 3300046473 | Bacteria | 975 |
| 296 | Ga0495605_0039602 | 3300046474 | Bacteria | 2360 |
| 297 | Ga0495639_0004907 | 3300046475 | Bacteria | 5735 |
| 298 | Ga0495662_0000583 | 3300046476 | Bacteria | 16810 |
| 299 | Ga0495662_0367889 | 3300046476 | Unclassified | 706 |
| 300 | Ga0495664_0065727 | 3300046477 | Bacteria | 2162 |
| 301 | Ga0495664_0133862 | 3300046477 | Bacteria | 1502 |
| 302 | Ga0495664_0209090 | 3300046477 | Unclassified | 1182 |
| 303 | Ga0495585_0030348 | 3300046492 | Bacteria | 3075 |
| 304 | Ga0495585_0297926 | 3300046492 | Bacteria | 793 |
| 305 | Ga0495594_0003321 | 3300046499 | Bacteria | 8321 |
| 306 | Ga0495583_0116703 | 3300046506 | Bacteria | 1127 |
| 307 | Ga0495606_0283860 | 3300046507 | Bacteria | 904 |
| 308 | Ga0495606_0645009 | 3300046507 | Bacteria | 513 |
| 309 | Ga0495616_0178145 | 3300046513 | Bacteria | 946 |
| 310 | Ga0495618_0405387 | 3300046514 | Unclassified | 833 |
| 311 | Ga0495628_0097570 | 3300046516 | Bacteria | 2270 |
| 312 | Ga0495628_0115651 | 3300046516 | Bacteria | 2060 |
| 313 | Ga0495628_0181444 | 3300046516 | Unclassified | 1592 |
| 314 | Ga0495628_0300908 | 3300046516 | Bacteria | 1187 |
| 315 | Ga0495628_0354929 | 3300046516 | Bacteria | 1077 |
| 316 | Ga0495630_0009655 | 3300046517 | Bacteria | 6940 |
| 317 | Ga0495630_0117156 | 3300046517 | Bacteria | 2019 |
| 318 | Ga0495630_0547437 | 3300046517 | Unclassified | 887 |
| 319 | Ga0495630_1434806 | 3300046517 | Unclassified | 519 |
| 320 | Ga0495643_0111012 | 3300046522 | Bacteria | 1394 |
| 321 | Ga0495643_0266659 | 3300046522 | Bacteria | 793 |
| 322 | Ga0495663_0031042 | 3300046525 | Bacteria | 1586 |
| 323 | Ga0495666_0372064 | 3300046526 | Bacteria | 643 |
| 324 | Ga0495642_0075538 | 3300046528 | Bacteria | 1414 |
| 325 | Ga0495652_0173293 | 3300046529 | Bacteria | 1663 |
| 326 | Ga0495652_0287374 | 3300046529 | Bacteria | 1201 |
| 327 | Ga0495654_0146248 | 3300046530 | Bacteria | 1049 |
| 328 | Ga0495640_0009977 | 3300046533 | Bacteria | 7361 |
| 329 | Ga0495640_0023128 | 3300046533 | Bacteria | 4536 |
| 330 | Ga0495640_0571605 | 3300046533 | Unclassified | 684 |
| 331 | Ga0495586_0246384 | 3300046535 | Bacteria | 1019 |
| 332 | Ga0495597_0242728 | 3300046542 | Bacteria | 710 |
| 333 | Ga0495622_0021185 | 3300046557 | Bacteria | 3028 |
| 334 | Ga0495667_0033121 | 3300046559 | Bacteria | 3458 |
| 335 | Ga0495667_0220514 | 3300046559 | Unclassified | 1210 |
| 336 | Ga0495656_0002496 | 3300046615 | Bacteria | 6121 |
| 337 | Ga0495656_0029456 | 3300046615 | Bacteria | 2210 |
| 338 | Ga0495634_0008013 | 3300046642 | Bacteria | 7882 |
| 339 | Ga0495634_0225745 | 3300046642 | Bacteria | 1154 |
| 340 | Ga0495611_0044027 | 3300046648 | Bacteria | 1996 |
| 341 | Ga0495611_0249474 | 3300046648 | Bacteria | 823 |
| 342 | Ga0495625_0151423 | 3300046660 | Bacteria | 1559 |
| 343 | Ga0495625_0491730 | 3300046660 | Bacteria | 751 |
| 344 | Ga0495635_0004315 | 3300046663 | Bacteria | 9844 |
| 345 | Ga0495635_0363086 | 3300046663 | Bacteria | 965 |
| 346 | Ga0495659_0002773 | 3300046664 | Bacteria | 5638 |
| 347 | Ga0495659_0167607 | 3300046664 | Bacteria | 889 |
| 348 | Ga0495661_0425816 | 3300046665 | Bacteria | 642 |
| 349 | Ga0495588_0021822 | 3300046674 | Bacteria | 3159 |
| 350 | Ga0495588_0042330 | 3300046674 | Bacteria | 2328 |
| 351 | Ga0495599_0307306 | 3300046678 | Unclassified | 956 |
| 352 | Ga0495646_0205646 | 3300046680 | Bacteria | 1070 |
| 353 | Ga0495647_0000616 | 3300046681 | Bacteria | 10500 |
| 354 | Ga0495658_0000155 | 3300046683 | Bacteria | 38298 |
| 355 | Ga0495658_0135401 | 3300046683 | Unclassified | 1503 |
| 356 | Ga0495669_0116564 | 3300046684 | Bacteria | 1250 |
| 357 | Ga0495669_0131069 | 3300046684 | Bacteria | 1180 |
| 358 | Ga0495669_0183106 | 3300046684 | Bacteria | 999 |
| 359 | Ga0495669_0346981 | 3300046684 | Bacteria | 717 |
| 360 | Ga0495613_0012528 | 3300046689 | Bacteria | 6302 |
| 361 | Ga0495613_0225688 | 3300046689 | Bacteria | 1314 |
| 362 | Ga0495624_0014936 | 3300046690 | Bacteria | 5259 |
| 363 | Ga0495624_0232865 | 3300046690 | Unclassified | 1115 |
| 364 | Ga0495624_0308912 | 3300046690 | Bacteria | 953 |
| 365 | Ga0495670_0120694 | 3300046691 | Bacteria | 1361 |
| 366 | Ga0495649_0218993 | 3300046694 | Bacteria | 985 |
| 367 | Ga0495600_0133057 | 3300046809 | Bacteria | 1616 |
| 368 | Ga0495600_0370416 | 3300046809 | Bacteria | 895 |
| 369 | Ga0495660_0261107 | 3300046810 | Bacteria | 800 |
| 370 | Ga0495581_0000187 | 3300047315 | Bacteria | 28682 |
| 371 | Ga0495636_0277983 | 3300047318 | Bacteria | 779 |
| 372 | Ga0495674_0003575 | 3300047319 | Bacteria | 15109 |
| 373 | Ga0495674_0377338 | 3300047319 | Bacteria | 1148 |
| 374 | Ga0495672_0045098 | 3300047320 | Bacteria | 2641 |
| 375 | Ga0495676_0041979 | 3300047321 | Bacteria | 3760 |
| 376 | Ga0495676_0195981 | 3300047321 | Bacteria | 1406 |
| 377 | Ga0495683_0167869 | 3300047323 | Bacteria | 1011 |
| 378 | Ga0495675_0424550 | 3300047444 | Unclassified | 772 |
| 379 | Ga0495679_121405 | 3300047446 | Bacteria | 714 |
| 380 | Ga0495684_0276826 | 3300047471 | Bacteria | 1212 |
| 381 | Ga0495686_0110380 | 3300047472 | Bacteria | 1650 |
| 382 | Ga0495686_0173961 | 3300047472 | Bacteria | 1251 |
| 383 | Ga0495593_0000469 | 3300047673 | Bacteria | 22695 |
| 384 | Ga0495614_0014072 | 3300048089 | Bacteria | 3508 |
| 385 | Ga0495626_0095411 | 3300048091 | Bacteria | 1303 |
| 386 | Ga0496100_0438150 | 3300048903 | Bacteria | 1000 |
| 387 | Ga0496100_0824993 | 3300048903 | Bacteria | 727 |
| 388 | Ga0496100_1265024 | 3300048903 | Unclassified | 582 |
| 389 | Ga0496101_0310484 | 3300048904 | Bacteria | 1236 |
| 390 | Ga0496101_0436471 | 3300048904 | Bacteria | 1033 |
| 391 | Ga0496101_1197382 | 3300048904 | Unclassified | 595 |
| 392 | Ga0496102_0176059 | 3300048905 | Bacteria | 2014 |
| 393 | Ga0496102_0988290 | 3300048905 | Unclassified | 762 |
| 394 | Ga0496104_0289596 | 3300048907 | Bacteria | 1550 |
| 395 | Ga0496105_0237739 | 3300048908 | Bacteria | 1479 |
| 396 | Ga0496106_0672600 | 3300048909 | Bacteria | 826 |
| 397 | Ga0496107_0436114 | 3300048910 | Bacteria | 974 |
| 398 | Ga0496108_0251538 | 3300048911 | Bacteria | 1537 |
| 399 | Ga0496108_0934092 | 3300048911 | Unclassified | 743 |
| 400 | Ga0496109_0365747 | 3300048912 | Bacteria | 1362 |
| 401 | Ga0496109_0615766 | 3300048912 | Unclassified | 1022 |
| 402 | Ga0496110_0377346 | 3300048913 | Bacteria | 1292 |
| 403 | Ga0496110_0509370 | 3300048913 | Bacteria | 1095 |
| 404 | Ga0496111_0472047 | 3300048914 | Bacteria | 925 |
| 405 | Ga0496112_0000040 | 3300048915 | Bacteria | 89057 |
| 406 | Ga0496112_0024838 | 3300048915 | Bacteria | 5748 |
| 407 | Ga0496112_0101473 | 3300048915 | Bacteria | 2847 |
| 408 | Ga0496113_0625708 | 3300048916 | Bacteria | 861 |
| 409 | Ga0496114_0365865 | 3300048917 | Bacteria | 1276 |
| 410 | Ga0496115_0071097 | 3300048918 | Bacteria | 2822 |
| 411 | Ga0496119_0340756 | 3300048922 | Bacteria | 729 |
| 412 | Ga0496125_0321461 | 3300048928 | Bacteria | 938 |
| 413 | Ga0496126_0118157 | 3300048929 | Bacteria | 2302 |
| 414 | Ga0496126_0291155 | 3300048929 | Bacteria | 1350 |
| 415 | nmdc:mga03683_173094_c1 | 3300050489 | Bacteria | 982 |
| 416 | nmdc:mga03n38_8316_c1 | 3300050490 | Bacteria | 3718 |
| 417 | nmdc:mga00v17_42604_c1 | 3300050491 | Bacteria | 2731 |
| 418 | nmdc:mga0yw44_120720_c1 | 3300050492 | Bacteria | 1688 |
| 419 | nmdc:mga0yw44_21272_c1 | 3300050492 | Bacteria | 3615 |
| 420 | nmdc:mga0yw44_296842_c1 | 3300050492 | Bacteria | 1082 |
| 421 | nmdc:mga0yw44_443007_c1 | 3300050492 | Bacteria | 880 |
| 422 | nmdc:mga0k408_112619_c1 | 3300050493 | Bacteria | 1609 |
| 423 | nmdc:mga0k408_218553_c1 | 3300050493 | Bacteria | 1138 |
| 424 | nmdc:mga07m45_238716_c1 | 3300050496 | Bacteria | 1058 |
| 425 | nmdc:mga07m45_397714_c1 | 3300050496 | Bacteria | 800 |
| 426 | nmdc:mga05p37_822163_c1 | 3300050507 | Bacteria | 1013 |
| 427 | nmdc:mga08y16_1238540_c1 | 3300050511 | Bacteria | 715 |
| 428 | nmdc:mga0n895_1257591_c1 | 3300050512 | Unclassified | 712 |
| 429 | nmdc:mga0n895_164318_c1 | 3300050512 | Bacteria | 2251 |
| 430 | nmdc:mga0n895_309762_c1 | 3300050512 | Bacteria | 1600 |
| 431 | nmdc:mga0a205_547148_c1 | 3300050515 | Bacteria | 1013 |
| 432 | nmdc:mga0sz30_72943_c2 | 3300050516 | Bacteria | 651 |
| 433 | Ga0495601_0084857 | 3300053077 | Bacteria | 2034 |
| 434 | Ga0495601_0173906 | 3300053077 | Bacteria | 1408 |
| 435 | Ga0495601_0242538 | 3300053077 | Bacteria | 1176 |
| 436 | Ga0500610_0159710 | 3300053079 | Bacteria | 1122 |
| 437 | Ga0500635_0005076 | 3300053080 | Bacteria | 3432 |
| 438 | Ga0495619_0508044 | 3300053085 | Bacteria | 829 |
| 439 | Ga0495619_0605656 | 3300053085 | Unclassified | 749 |
| 440 | Ga0500578_0219336 | 3300053086 | Bacteria | 1157 |
| 441 | Ga0500583_0027332 | 3300053092 | Bacteria | 2462 |
| 442 | Ga0500651_0501854 | 3300053093 | Bacteria | 669 |
| 443 | Ga0500650_0229800 | 3300053098 | Bacteria | 837 |
| 444 | Ga0500554_022341 | 3300053102 | Bacteria | 1766 |
| 445 | Ga0500555_093957 | 3300053103 | Bacteria | 768 |
| 446 | Ga0500592_031423 | 3300053116 | Bacteria | 857 |
| 447 | Ga0500595_012930 | 3300053119 | Bacteria | 3211 |
| 448 | Ga0500617_189294 | 3300053124 | Bacteria | 768 |
| 449 | Ga0500577_0047147 | 3300053142 | Bacteria | 1600 |
| 450 | Ga0500588_0060025 | 3300053146 | Bacteria | 1215 |
| 451 | Ga0500603_000340 | 3300053150 | Bacteria | 12205 |
| 452 | Ga0500633_0157225 | 3300053160 | Bacteria | 853 |
| 453 | Ga0500634_0078007 | 3300053161 | Bacteria | 1715 |
| 454 | Ga0500637_0052453 | 3300053178 | Bacteria | 2326 |
| 455 | Ga0500637_0053768 | 3300053178 | Bacteria | 2299 |
| 456 | Ga0500645_046095 | 3300053730 | Bacteria | 1279 |
| 457 | Ga0500645_105821 | 3300053730 | Bacteria | 791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046517 | Ga0495630_1434806 | Ga0495630_1434806_11_445 | 104 |
| 2 | 3300046529 | Ga0495652_0173293 | Ga0495652_0173293_1211_1645 | 104 |
| 3 | 3300046507 | Ga0495606_0645009 | Ga0495606_0645009_26_496 | 116 |
| 4 | 3300046642 | Ga0495634_0225745 | Ga0495634_0225745_41_511 | 116 |
| 5 | 3300046678 | Ga0495599_0307306 | Ga0495599_0307306_469_939 | 116 |
| 6 | 3300050496 | nmdc:mga07m45_397714_c1 | nmdc:mga07m45_397714_c1_205_675 | 116 |
| 7 | 3300046477 | Ga0495664_0209090 | Ga0495664_0209090_657_1142 | 121 |
| 8 | 3300046514 | Ga0495618_0405387 | Ga0495618_0405387_154_639 | 121 |
| 9 | 3300046516 | Ga0495628_0181444 | Ga0495628_0181444_460_945 | 121 |
| 10 | 3300046533 | Ga0495640_0571605 | Ga0495640_0571605_124_609 | 121 |
| 11 | 3300046689 | Ga0495613_0225688 | Ga0495613_0225688_364_849 | 121 |
| 12 | 3300046809 | Ga0495600_0370416 | Ga0495600_0370416_28_513 | 121 |
| 13 | 3300047444 | Ga0495675_0424550 | Ga0495675_0424550_22_507 | 121 |
| 14 | 3300053077 | Ga0495601_0084857 | Ga0495601_0084857_501_986 | 121 |
| 15 | 3300053085 | Ga0495619_0605656 | Ga0495619_0605656_202_687 | 121 |
| 16 | 3300046459 | Ga0495629_0357386 | Ga0495629_0357386_402_950 | 124 |
| 17 | iso_pu_bacteria | 2513237104 | 2513723954 | 129 |
| 18 | 3300047323 | Ga0495683_0167869 | Ga0495683_0167869_467_979 | 130 |
| 19 | 3300007788 | Ga0099795_10069526 | Ga0099795_100695262 | 131 |
| 20 | 3300010159 | Ga0099796_10006692 | Ga0099796_100066923 | 131 |
| 21 | 3300006038 | Ga0075365_10166813 | Ga0075365_101668133 | 132 |
| 22 | 3300006177 | Ga0075362_10074756 | Ga0075362_100747562 | 132 |
| 23 | 3300006178 | Ga0075367_10195079 | Ga0075367_101950792 | 132 |
| 24 | 3300031238 | Ga0265332_10187929 | Ga0265332_101879291 | 132 |
| 25 | 3300044658 | Ga0466972_0000740 | Ga0466972_0000740_11281_11910 | 132 |
| 26 | 3300050489 | nmdc:mga03683_173094_c1 | nmdc:mga03683_173094_c1_167_685 | 132 |
| 27 | 3300053085 | Ga0495619_0508044 | Ga0495619_0508044_156_674 | 132 |
| 28 | 3300003320 | rootH2_10250460 | rootH2_102504603 | 133 |
| 29 | 3300003322 | rootL2_10120592 | rootL2_101205923 | 133 |
| 30 | 3300003659 | JGI25404J52841_10002183 | JGI25404J52841_100021832 | 133 |
| 31 | 3300003659 | JGI25404J52841_10003051 | JGI25404J52841_100030512 | 133 |
| 32 | 3300003659 | JGI25404J52841_10020429 | JGI25404J52841_100204292 | 133 |
| 33 | 3300003659 | JGI25404J52841_10031721 | JGI25404J52841_100317212 | 133 |
| 34 | 3300003659 | JGI25404J52841_10053020 | JGI25404J52841_100530201 | 133 |
| 35 | 3300003659 | JGI25404J52841_10059641 | JGI25404J52841_100596412 | 133 |
| 36 | 3300005328 | Ga0070676_10221451 | Ga0070676_102214511 | 133 |
| 37 | 3300005331 | Ga0070670_100012085 | Ga0070670_1000120854 | 133 |
| 38 | 3300005334 | Ga0068869_100096137 | Ga0068869_1000961372 | 133 |
| 39 | 3300005335 | Ga0070666_10358207 | Ga0070666_103582071 | 133 |
| 40 | 3300005338 | Ga0068868_100042893 | Ga0068868_1000428932 | 133 |
| 41 | 3300005340 | Ga0070689_101119713 | Ga0070689_1011197131 | 133 |
| 42 | 3300005341 | Ga0070691_10596228 | Ga0070691_105962281 | 133 |
| 43 | 3300005343 | Ga0070687_100517977 | Ga0070687_1005179771 | 133 |
| 44 | 3300005344 | Ga0070661_100417800 | Ga0070661_1004178002 | 133 |
| 45 | 3300005347 | Ga0070668_100157891 | Ga0070668_1001578912 | 133 |
| 46 | 3300005353 | Ga0070669_100086432 | Ga0070669_1000864322 | 133 |
| 47 | 3300005354 | Ga0070675_100178875 | Ga0070675_1001788751 | 133 |
| 48 | 3300005354 | Ga0070675_100689870 | Ga0070675_1006898702 | 133 |
| 49 | 3300005355 | Ga0070671_100002121 | Ga0070671_1000021216 | 133 |
| 50 | 3300005355 | Ga0070671_100425375 | Ga0070671_1004253752 | 133 |
| 51 | 3300005356 | Ga0070674_100180883 | Ga0070674_1001808832 | 133 |
| 52 | 3300005356 | Ga0070674_100349479 | Ga0070674_1003494791 | 133 |
| 53 | 3300005356 | Ga0070674_100632634 | Ga0070674_1006326342 | 133 |
| 54 | 3300005364 | Ga0070673_100090885 | Ga0070673_1000908852 | 133 |
| 55 | 3300005364 | Ga0070673_100280037 | Ga0070673_1002800372 | 133 |
| 56 | 3300005364 | Ga0070673_100435481 | Ga0070673_1004354812 | 133 |
| 57 | 3300005365 | Ga0070688_100322675 | Ga0070688_1003226752 | 133 |
| 58 | 3300005365 | Ga0070688_100788336 | Ga0070688_1007883361 | 133 |
| 59 | 3300005366 | Ga0070659_100858242 | Ga0070659_1008582421 | 133 |
| 60 | 3300005367 | Ga0070667_100311629 | Ga0070667_1003116292 | 133 |
| 61 | 3300005434 | Ga0070709_10425601 | Ga0070709_104256011 | 133 |
| 62 | 3300005435 | Ga0070714_100524085 | Ga0070714_1005240852 | 133 |
| 63 | 3300005439 | Ga0070711_100272519 | Ga0070711_1002725191 | 133 |
| 64 | 3300005439 | Ga0070711_100337041 | Ga0070711_1003370411 | 133 |
| 65 | 3300005445 | Ga0070708_100051719 | Ga0070708_1000517195 | 133 |
| 66 | 3300005455 | Ga0070663_100051325 | Ga0070663_1000513252 | 133 |
| 67 | 3300005455 | Ga0070663_100827377 | Ga0070663_1008273771 | 133 |
| 68 | 3300005456 | Ga0070678_100057818 | Ga0070678_1000578182 | 133 |
| 69 | 3300005456 | Ga0070678_100078551 | Ga0070678_1000785512 | 133 |
| 70 | 3300005456 | Ga0070678_100200831 | Ga0070678_1002008312 | 133 |
| 71 | 3300005457 | Ga0070662_100675536 | Ga0070662_1006755362 | 133 |
| 72 | 3300005459 | Ga0068867_100109506 | Ga0068867_1001095062 | 133 |
| 73 | 3300005466 | Ga0070685_10368303 | Ga0070685_103683031 | 133 |
| 74 | 3300005467 | Ga0070706_100069687 | Ga0070706_1000696872 | 133 |
| 75 | 3300005471 | Ga0070698_100298518 | Ga0070698_1002985182 | 133 |
| 76 | 3300005471 | Ga0070698_101090973 | Ga0070698_1010909731 | 133 |
| 77 | 3300005536 | Ga0070697_100169745 | Ga0070697_1001697453 | 133 |
| 78 | 3300005539 | Ga0068853_100228733 | Ga0068853_1002287332 | 133 |
| 79 | 3300005543 | Ga0070672_100126926 | Ga0070672_1001269262 | 133 |
| 80 | 3300005548 | Ga0070665_100066611 | Ga0070665_1000666111 | 133 |
| 81 | 3300005548 | Ga0070665_100090506 | Ga0070665_1000905062 | 133 |
| 82 | 3300005548 | Ga0070665_100336739 | Ga0070665_1003367392 | 133 |
| 83 | 3300005548 | Ga0070665_100738303 | Ga0070665_1007383032 | 133 |
| 84 | 3300005563 | Ga0068855_100473784 | Ga0068855_1004737842 | 133 |
| 85 | 3300005564 | Ga0070664_100083929 | Ga0070664_1000839292 | 133 |
| 86 | 3300005577 | Ga0068857_100666717 | Ga0068857_1006667171 | 133 |
| 87 | 3300005578 | Ga0068854_100256882 | Ga0068854_1002568822 | 133 |
| 88 | 3300005614 | Ga0068856_100273146 | Ga0068856_1002731462 | 133 |
| 89 | 3300005616 | Ga0068852_100248430 | Ga0068852_1002484302 | 133 |
| 90 | 3300005617 | Ga0068859_100367682 | Ga0068859_1003676822 | 133 |
| 91 | 3300005617 | Ga0068859_100877472 | Ga0068859_1008774722 | 133 |
| 92 | 3300005618 | Ga0068864_100141637 | Ga0068864_1001416372 | 133 |
| 93 | 3300005840 | Ga0068870_10361172 | Ga0068870_103611722 | 133 |
| 94 | 3300005841 | Ga0068863_100367327 | Ga0068863_1003673272 | 133 |
| 95 | 3300005841 | Ga0068863_100675244 | Ga0068863_1006752442 | 133 |
| 96 | 3300005842 | Ga0068858_100494347 | Ga0068858_1004943472 | 133 |
| 97 | 3300005844 | Ga0068862_100148897 | Ga0068862_1001488972 | 133 |
| 98 | 3300005937 | Ga0081455_10009859 | Ga0081455_100098597 | 133 |
| 99 | 3300005937 | Ga0081455_10010351 | Ga0081455_100103512 | 133 |
| 100 | 3300005937 | Ga0081455_10271713 | Ga0081455_102717132 | 133 |
| 101 | 3300005937 | Ga0081455_10352407 | Ga0081455_103524072 | 133 |
| 102 | 3300005983 | Ga0081540_1002409 | Ga0081540_100240912 | 133 |
| 103 | 3300005983 | Ga0081540_1004015 | Ga0081540_10040159 | 133 |
| 104 | 3300005983 | Ga0081540_1005098 | Ga0081540_10050983 | 133 |
| 105 | 3300005983 | Ga0081540_1005864 | Ga0081540_100586413 | 133 |
| 106 | 3300005983 | Ga0081540_1006387 | Ga0081540_10063878 | 133 |
| 107 | 3300005983 | Ga0081540_1015259 | Ga0081540_10152597 | 133 |
| 108 | 3300005983 | Ga0081540_1058525 | Ga0081540_10585252 | 133 |
| 109 | 3300005983 | Ga0081540_1067209 | Ga0081540_10672093 | 133 |
| 110 | 3300005983 | Ga0081540_1095723 | Ga0081540_10957231 | 133 |
| 111 | 3300005983 | Ga0081540_1131936 | Ga0081540_11319361 | 133 |
| 112 | 3300005985 | Ga0081539_10016758 | Ga0081539_100167583 | 133 |
| 113 | 3300005985 | Ga0081539_10170022 | Ga0081539_101700222 | 133 |
| 114 | 3300006038 | Ga0075365_10307119 | Ga0075365_103071192 | 133 |
| 115 | 3300006042 | Ga0075368_10220649 | Ga0075368_102206492 | 133 |
| 116 | 3300006048 | Ga0075363_100068592 | Ga0075363_1000685922 | 133 |
| 117 | 3300006048 | Ga0075363_100232179 | Ga0075363_1002321792 | 133 |
| 118 | 3300006051 | Ga0075364_10100606 | Ga0075364_101006062 | 133 |
| 119 | 3300006173 | Ga0070716_100200191 | Ga0070716_1002001912 | 133 |
| 120 | 3300006175 | Ga0070712_100992842 | Ga0070712_1009928422 | 133 |
| 121 | 3300006178 | Ga0075367_10110032 | Ga0075367_101100322 | 133 |
| 122 | 3300006178 | Ga0075367_10221277 | Ga0075367_102212771 | 133 |
| 123 | 3300006178 | Ga0075367_10258959 | Ga0075367_102589592 | 133 |
| 124 | 3300006195 | Ga0075366_10342841 | Ga0075366_103428412 | 133 |
| 125 | 3300006353 | Ga0075370_10138859 | Ga0075370_101388592 | 133 |
| 126 | 3300006358 | Ga0068871_100586661 | Ga0068871_1005866612 | 133 |
| 127 | 3300006852 | Ga0075433_10194301 | Ga0075433_101943012 | 133 |
| 128 | 3300006852 | Ga0075433_11039782 | Ga0075433_110397821 | 133 |
| 129 | 3300006871 | Ga0075434_100243387 | Ga0075434_1002433872 | 133 |
| 130 | 3300006871 | Ga0075434_100500998 | Ga0075434_1005009981 | 133 |
| 131 | 3300006881 | Ga0068865_100047409 | Ga0068865_1000474092 | 133 |
| 132 | 3300006881 | Ga0068865_100739871 | Ga0068865_1007398711 | 133 |
| 133 | 3300006881 | Ga0068865_101097232 | Ga0068865_1010972321 | 133 |
| 134 | 3300006931 | Ga0097620_100367663 | Ga0097620_1003676632 | 133 |
| 135 | 3300006931 | Ga0097620_100877446 | Ga0097620_1008774462 | 133 |
| 136 | 3300007265 | Ga0099794_10091806 | Ga0099794_100918062 | 133 |
| 137 | 3300007265 | Ga0099794_10107997 | Ga0099794_101079972 | 133 |
| 138 | 3300007265 | Ga0099794_10181834 | Ga0099794_101818341 | 133 |
| 139 | 3300007788 | Ga0099795_10066715 | Ga0099795_100667152 | 133 |
| 140 | 3300007788 | Ga0099795_10205062 | Ga0099795_102050622 | 133 |
| 141 | 3300009098 | Ga0105245_10278389 | Ga0105245_102783892 | 133 |
| 142 | 3300009098 | Ga0105245_10702634 | Ga0105245_107026341 | 133 |
| 143 | 3300009101 | Ga0105247_10073237 | Ga0105247_100732372 | 133 |
| 144 | 3300009101 | Ga0105247_10379792 | Ga0105247_103797922 | 133 |
| 145 | 3300009147 | Ga0114129_11192802 | Ga0114129_111928022 | 133 |
| 146 | 3300009148 | Ga0105243_11199680 | Ga0105243_111996801 | 133 |
| 147 | 3300009174 | Ga0105241_10059652 | Ga0105241_100596522 | 133 |
| 148 | 3300009174 | Ga0105241_10163740 | Ga0105241_101637402 | 133 |
| 149 | 3300009174 | Ga0105241_10658625 | Ga0105241_106586252 | 133 |
| 150 | 3300009177 | Ga0105248_10761857 | Ga0105248_107618572 | 133 |
| 151 | 3300009545 | Ga0105237_10432007 | Ga0105237_104320072 | 133 |
| 152 | 3300009545 | Ga0105237_10495747 | Ga0105237_104957471 | 133 |
| 153 | 3300009545 | Ga0105237_11358637 | Ga0105237_113586371 | 133 |
| 154 | 3300009551 | Ga0105238_10417185 | Ga0105238_104171851 | 133 |
| 155 | 3300009551 | Ga0105238_10452204 | Ga0105238_104522042 | 133 |
| 156 | 3300009551 | Ga0105238_11059663 | Ga0105238_110596631 | 133 |
| 157 | 3300009553 | Ga0105249_10682143 | Ga0105249_106821432 | 133 |
| 158 | 3300010159 | Ga0099796_10033287 | Ga0099796_100332871 | 133 |
| 159 | 3300010375 | Ga0105239_10172092 | Ga0105239_101720921 | 133 |
| 160 | 3300010375 | Ga0105239_10276810 | Ga0105239_102768102 | 133 |
| 161 | 3300011119 | Ga0105246_10071550 | Ga0105246_100715502 | 133 |
| 162 | 3300011119 | Ga0105246_10276904 | Ga0105246_102769042 | 133 |
| 163 | 3300011119 | Ga0105246_10400633 | Ga0105246_104006331 | 133 |
| 164 | 3300011119 | Ga0105246_11267330 | Ga0105246_112673301 | 133 |
| 165 | 3300013296 | Ga0157374_10085037 | Ga0157374_100850373 | 133 |
| 166 | 3300013296 | Ga0157374_10428633 | Ga0157374_104286332 | 133 |
| 167 | 3300013297 | Ga0157378_10395161 | Ga0157378_103951612 | 133 |
| 168 | 3300013297 | Ga0157378_10519856 | Ga0157378_105198562 | 133 |
| 169 | 3300013297 | Ga0157378_11790895 | Ga0157378_117908951 | 133 |
| 170 | 3300013306 | Ga0163162_10773005 | Ga0163162_107730052 | 133 |
| 171 | 3300013306 | Ga0163162_10837879 | Ga0163162_108378792 | 133 |
| 172 | 3300013306 | Ga0163162_11402380 | Ga0163162_114023801 | 133 |
| 173 | 3300013308 | Ga0157375_10170023 | Ga0157375_101700233 | 133 |
| 174 | 3300013308 | Ga0157375_10889715 | Ga0157375_108897151 | 133 |
| 175 | 3300014325 | Ga0163163_10064119 | Ga0163163_100641192 | 133 |
| 176 | 3300014325 | Ga0163163_10329094 | Ga0163163_103290942 | 133 |
| 177 | 3300014325 | Ga0163163_10377532 | Ga0163163_103775322 | 133 |
| 178 | 3300014326 | Ga0157380_11022320 | Ga0157380_110223202 | 133 |
| 179 | 3300014745 | Ga0157377_10169897 | Ga0157377_101698972 | 133 |
| 180 | 3300014745 | Ga0157377_10546024 | Ga0157377_105460242 | 133 |
| 181 | 3300014968 | Ga0157379_10030271 | Ga0157379_100302712 | 133 |
| 182 | 3300014968 | Ga0157379_10272952 | Ga0157379_102729522 | 133 |
| 183 | 3300014969 | Ga0157376_10096943 | Ga0157376_100969432 | 133 |
| 184 | 3300014969 | Ga0157376_10224723 | Ga0157376_102247232 | 133 |
| 185 | 3300014969 | Ga0157376_10749573 | Ga0157376_107495731 | 133 |
| 186 | 3300017792 | Ga0163161_10463795 | Ga0163161_104637952 | 133 |
| 187 | 3300024227 | Ga0228598_1003692 | Ga0228598_10036921 | 133 |
| 188 | 3300025315 | Ga0207697_10159667 | Ga0207697_101596672 | 133 |
| 189 | 3300025899 | Ga0207642_10354005 | Ga0207642_103540051 | 133 |
| 190 | 3300025900 | Ga0207710_10029727 | Ga0207710_100297272 | 133 |
| 191 | 3300025901 | Ga0207688_10190060 | Ga0207688_101900602 | 133 |
| 192 | 3300025903 | Ga0207680_10358180 | Ga0207680_103581802 | 133 |
| 193 | 3300025904 | Ga0207647_10251005 | Ga0207647_102510052 | 133 |
| 194 | 3300025907 | Ga0207645_10452494 | Ga0207645_104524941 | 133 |
| 195 | 3300025908 | Ga0207643_10173790 | Ga0207643_101737902 | 133 |
| 196 | 3300025910 | Ga0207684_10028285 | Ga0207684_100282854 | 133 |
| 197 | 3300025910 | Ga0207684_10110393 | Ga0207684_101103932 | 133 |
| 198 | 3300025911 | Ga0207654_10007087 | Ga0207654_100070872 | 133 |
| 199 | 3300025911 | Ga0207654_10442706 | Ga0207654_104427062 | 133 |
| 200 | 3300025914 | Ga0207671_10019579 | Ga0207671_100195794 | 133 |
| 201 | 3300025914 | Ga0207671_10568077 | Ga0207671_105680772 | 133 |
| 202 | 3300025916 | Ga0207663_10107013 | Ga0207663_101070133 | 133 |
| 203 | 3300025916 | Ga0207663_10135907 | Ga0207663_101359072 | 133 |
| 204 | 3300025916 | Ga0207663_10721507 | Ga0207663_107215071 | 133 |
| 205 | 3300025918 | Ga0207662_10470018 | Ga0207662_104700182 | 133 |
| 206 | 3300025920 | Ga0207649_10382641 | Ga0207649_103826412 | 133 |
| 207 | 3300025923 | Ga0207681_10238943 | Ga0207681_102389432 | 133 |
| 208 | 3300025924 | Ga0207694_10880876 | Ga0207694_108808761 | 133 |
| 209 | 3300025924 | Ga0207694_11507320 | Ga0207694_115073201 | 133 |
| 210 | 3300025925 | Ga0207650_10075775 | Ga0207650_100757752 | 133 |
| 211 | 3300025925 | Ga0207650_10399981 | Ga0207650_103999811 | 133 |
| 212 | 3300025926 | Ga0207659_10306014 | Ga0207659_103060142 | 133 |
| 213 | 3300025927 | Ga0207687_10027364 | Ga0207687_100273642 | 133 |
| 214 | 3300025927 | Ga0207687_10149317 | Ga0207687_101493172 | 133 |
| 215 | 3300025929 | Ga0207664_10606363 | Ga0207664_106063632 | 133 |
| 216 | 3300025931 | Ga0207644_10003060 | Ga0207644_100030604 | 133 |
| 217 | 3300025931 | Ga0207644_10055921 | Ga0207644_100559213 | 133 |
| 218 | 3300025931 | Ga0207644_10868996 | Ga0207644_108689961 | 133 |
| 219 | 3300025933 | Ga0207706_10177441 | Ga0207706_101774412 | 133 |
| 220 | 3300025933 | Ga0207706_10220027 | Ga0207706_102200271 | 133 |
| 221 | 3300025933 | Ga0207706_10406683 | Ga0207706_104066831 | 133 |
| 222 | 3300025935 | Ga0207709_10170513 | Ga0207709_101705132 | 133 |
| 223 | 3300025937 | Ga0207669_10063199 | Ga0207669_100631992 | 133 |
| 224 | 3300025937 | Ga0207669_10103714 | Ga0207669_101037142 | 133 |
| 225 | 3300025938 | Ga0207704_10042640 | Ga0207704_100426402 | 133 |
| 226 | 3300025938 | Ga0207704_10294936 | Ga0207704_102949362 | 133 |
| 227 | 3300025939 | Ga0207665_10739323 | Ga0207665_107393231 | 133 |
| 228 | 3300025940 | Ga0207691_10222319 | Ga0207691_102223192 | 133 |
| 229 | 3300025942 | Ga0207689_10447251 | Ga0207689_104472512 | 133 |
| 230 | 3300025945 | Ga0207679_11072104 | Ga0207679_110721041 | 133 |
| 231 | 3300025960 | Ga0207651_10151933 | Ga0207651_101519332 | 133 |
| 232 | 3300025981 | Ga0207640_10215404 | Ga0207640_102154042 | 133 |
| 233 | 3300025986 | Ga0207658_10211650 | Ga0207658_102116502 | 133 |
| 234 | 3300025986 | Ga0207658_10456297 | Ga0207658_104562972 | 133 |
| 235 | 3300026023 | Ga0207677_10062886 | Ga0207677_100628861 | 133 |
| 236 | 3300026035 | Ga0207703_10066265 | Ga0207703_100662652 | 133 |
| 237 | 3300026041 | Ga0207639_10080934 | Ga0207639_100809342 | 133 |
| 238 | 3300026067 | Ga0207678_10517524 | Ga0207678_105175242 | 133 |
| 239 | 3300026088 | Ga0207641_10568441 | Ga0207641_105684412 | 133 |
| 240 | 3300026088 | Ga0207641_10960389 | Ga0207641_109603891 | 133 |
| 241 | 3300026089 | Ga0207648_10242681 | Ga0207648_102426812 | 133 |
| 242 | 3300026095 | Ga0207676_10006429 | Ga0207676_100064298 | 133 |
| 243 | 3300026116 | Ga0207674_10139383 | Ga0207674_101393833 | 133 |
| 244 | 3300026118 | Ga0207675_100423129 | Ga0207675_1004231292 | 133 |
| 245 | 3300026121 | Ga0207683_10041585 | Ga0207683_100415852 | 133 |
| 246 | 3300026121 | Ga0207683_10086116 | Ga0207683_100861162 | 133 |
| 247 | 3300026121 | Ga0207683_10276731 | Ga0207683_102767311 | 133 |
| 248 | 3300026142 | Ga0207698_10721935 | Ga0207698_107219351 | 133 |
| 249 | 3300027512 | Ga0209179_1044222 | Ga0209179_10442222 | 133 |
| 250 | 3300027671 | Ga0209588_1023475 | Ga0209588_10234752 | 133 |
| 251 | 3300027671 | Ga0209588_1038254 | Ga0209588_10382542 | 133 |
| 252 | 3300027671 | Ga0209588_1053151 | Ga0209588_10531512 | 133 |
| 253 | 3300028379 | Ga0268266_10001439 | Ga0268266_100014392 | 133 |
| 254 | 3300028379 | Ga0268266_10033226 | Ga0268266_100332264 | 133 |
| 255 | 3300028379 | Ga0268266_10360225 | Ga0268266_103602251 | 133 |
| 256 | 3300028381 | Ga0268264_10596011 | Ga0268264_105960112 | 133 |
| 257 | 3300028786 | Ga0307517_10000098 | Ga0307517_1000009889 | 133 |
| 258 | 3300028786 | Ga0307517_10366646 | Ga0307517_103666461 | 133 |
| 259 | 3300028794 | Ga0307515_10016400 | Ga0307515_100164003 | 133 |
| 260 | 3300028794 | Ga0307515_10258556 | Ga0307515_102585562 | 133 |
| 261 | 3300028794 | Ga0307515_10562728 | Ga0307515_105627282 | 133 |
| 262 | 3300031456 | Ga0307513_10043066 | Ga0307513_100430664 | 133 |
| 263 | 3300031456 | Ga0307513_10253885 | Ga0307513_102538852 | 133 |
| 264 | 3300031507 | Ga0307509_10071932 | Ga0307509_100719322 | 133 |
| 265 | 3300031507 | Ga0307509_10302743 | Ga0307509_103027432 | 133 |
| 266 | 3300031616 | Ga0307508_10207351 | Ga0307508_102073512 | 133 |
| 267 | 3300031616 | Ga0307508_10231057 | Ga0307508_102310573 | 133 |
| 268 | 3300031616 | Ga0307508_10344327 | Ga0307508_103443272 | 133 |
| 269 | 3300031616 | Ga0307508_10612551 | Ga0307508_106125511 | 133 |
| 270 | 3300031730 | Ga0307516_10003537 | Ga0307516_1000353718 | 133 |
| 271 | 3300031730 | Ga0307516_10083064 | Ga0307516_100830642 | 133 |
| 272 | 3300031730 | Ga0307516_10576725 | Ga0307516_105767251 | 133 |
| 273 | 3300035089 | Ga0373944_0036587 | Ga0373944_0036587_715_1236 | 133 |
| 274 | 3300035089 | Ga0373944_0105194 | Ga0373944_0105194_41_562 | 133 |
| 275 | 3300035111 | Ga0373923_0127280 | Ga0373923_0127280_420_941 | 133 |
| 276 | 3300035113 | Ga0373936_0021072 | Ga0373936_0021072_158_679 | 133 |
| 277 | 3300035114 | Ga0373939_0161553 | Ga0373939_0161553_209_772 | 133 |
| 278 | 3300035116 | Ga0373945_0116584 | Ga0373945_0116584_260_781 | 133 |
| 279 | 3300035116 | Ga0373945_0290541 | Ga0373945_0290541_115_636 | 133 |
| 280 | 3300035118 | Ga0373954_0013494 | Ga0373954_0013494_2573_3094 | 133 |
| 281 | 3300035170 | Ga0373943_0000806 | Ga0373943_0000806_1252_1773 | 133 |
| 282 | 3300035170 | Ga0373943_0461627 | Ga0373943_0461627_120_641 | 133 |
| 283 | 3300035171 | Ga0373946_0040364 | Ga0373946_0040364_183_704 | 133 |
| 284 | 3300035692 | Ga0373935_0003421 | Ga0373935_0003421_1044_1565 | 133 |
| 285 | 3300035692 | Ga0373935_0501514 | Ga0373935_0501514_219_740 | 133 |
| 286 | 3300035695 | Ga0373927_0000046 | Ga0373927_0000046_68606_69127 | 133 |
| 287 | 3300035695 | Ga0373927_0043815 | Ga0373927_0043815_2044_2565 | 133 |
| 288 | 3300035695 | Ga0373927_0613437 | Ga0373927_0613437_24_545 | 133 |
| 289 | 3300035695 | Ga0373927_0858133 | Ga0373927_0858133_54_575 | 133 |
| 290 | 3300035725 | Ga0373947_0002296 | Ga0373947_0002296_2657_3178 | 133 |
| 291 | 3300037068 | Ga0373925_0003178 | Ga0373925_0003178_11099_11620 | 133 |
| 292 | 3300037068 | Ga0373925_0227374 | Ga0373925_0227374_224_745 | 133 |
| 293 | 3300037471 | Ga0395905_0160938 | Ga0395905_0160938_210_731 | 133 |
| 294 | 3300041451 | Ga0451791_0477269 | Ga0451791_0477269_300_821 | 133 |
| 295 | 3300046454 | Ga0495592_0080841 | Ga0495592_0080841_485_1006 | 133 |
| 296 | 3300046454 | Ga0495592_0167965 | Ga0495592_0167965_364_885 | 133 |
| 297 | 3300046455 | Ga0495603_0000051 | Ga0495603_0000051_31767_32288 | 133 |
| 298 | 3300046455 | Ga0495603_0119464 | Ga0495603_0119464_368_889 | 133 |
| 299 | 3300046455 | Ga0495603_0133660 | Ga0495603_0133660_213_734 | 133 |
| 300 | 3300046455 | Ga0495603_0167436 | Ga0495603_0167436_151_672 | 133 |
| 301 | 3300046455 | Ga0495603_0475457 | Ga0495603_0475457_86_607 | 133 |
| 302 | 3300046459 | Ga0495629_0020958 | Ga0495629_0020958_3122_3643 | 133 |
| 303 | 3300046459 | Ga0495629_0151596 | Ga0495629_0151596_474_995 | 133 |
| 304 | 3300046459 | Ga0495629_0352029 | Ga0495629_0352029_141_662 | 133 |
| 305 | 3300046460 | Ga0495638_0071723 | Ga0495638_0071723_781_1302 | 133 |
| 306 | 3300046460 | Ga0495638_0458846 | Ga0495638_0458846_42_563 | 133 |
| 307 | 3300046461 | Ga0495641_0014250 | Ga0495641_0014250_2479_3000 | 133 |
| 308 | 3300046462 | Ga0495651_0561460 | Ga0495651_0561460_47_568 | 133 |
| 309 | 3300046472 | Ga0495580_0054957 | Ga0495580_0054957_1952_2473 | 133 |
| 310 | 3300046473 | Ga0495582_0000025 | Ga0495582_0000025_9021_9542 | 133 |
| 311 | 3300046473 | Ga0495582_0157321 | Ga0495582_0157321_457_978 | 133 |
| 312 | 3300046473 | Ga0495582_0270459 | Ga0495582_0270459_57_578 | 133 |
| 313 | 3300046474 | Ga0495605_0039602 | Ga0495605_0039602_1163_1684 | 133 |
| 314 | 3300046475 | Ga0495639_0004907 | Ga0495639_0004907_895_1416 | 133 |
| 315 | 3300046476 | Ga0495662_0000583 | Ga0495662_0000583_16132_16653 | 133 |
| 316 | 3300046476 | Ga0495662_0367889 | Ga0495662_0367889_63_584 | 133 |
| 317 | 3300046477 | Ga0495664_0065727 | Ga0495664_0065727_1138_1659 | 133 |
| 318 | 3300046477 | Ga0495664_0133862 | Ga0495664_0133862_553_1074 | 133 |
| 319 | 3300046492 | Ga0495585_0030348 | Ga0495585_0030348_1752_2264 | 133 |
| 320 | 3300046492 | Ga0495585_0297926 | Ga0495585_0297926_235_783 | 133 |
| 321 | 3300046499 | Ga0495594_0003321 | Ga0495594_0003321_4149_4670 | 133 |
| 322 | 3300046506 | Ga0495583_0116703 | Ga0495583_0116703_407_928 | 133 |
| 323 | 3300046507 | Ga0495606_0283860 | Ga0495606_0283860_293_814 | 133 |
| 324 | 3300046513 | Ga0495616_0178145 | Ga0495616_0178145_196_717 | 133 |
| 325 | 3300046516 | Ga0495628_0097570 | Ga0495628_0097570_202_723 | 133 |
| 326 | 3300046516 | Ga0495628_0115651 | Ga0495628_0115651_963_1484 | 133 |
| 327 | 3300046516 | Ga0495628_0300908 | Ga0495628_0300908_34_555 | 133 |
| 328 | 3300046516 | Ga0495628_0354929 | Ga0495628_0354929_354_920 | 133 |
| 329 | 3300046517 | Ga0495630_0009655 | Ga0495630_0009655_3622_4143 | 133 |
| 330 | 3300046517 | Ga0495630_0117156 | Ga0495630_0117156_1286_1807 | 133 |
| 331 | 3300046517 | Ga0495630_0547437 | Ga0495630_0547437_94_615 | 133 |
| 332 | 3300046522 | Ga0495643_0111012 | Ga0495643_0111012_343_864 | 133 |
| 333 | 3300046522 | Ga0495643_0266659 | Ga0495643_0266659_240_761 | 133 |
| 334 | 3300046525 | Ga0495663_0031042 | Ga0495663_0031042_558_1079 | 133 |
| 335 | 3300046526 | Ga0495666_0372064 | Ga0495666_0372064_59_580 | 133 |
| 336 | 3300046528 | Ga0495642_0075538 | Ga0495642_0075538_483_1004 | 133 |
| 337 | 3300046529 | Ga0495652_0287374 | Ga0495652_0287374_178_699 | 133 |
| 338 | 3300046530 | Ga0495654_0146248 | Ga0495654_0146248_289_810 | 133 |
| 339 | 3300046533 | Ga0495640_0009977 | Ga0495640_0009977_4323_4844 | 133 |
| 340 | 3300046533 | Ga0495640_0023128 | Ga0495640_0023128_1123_1644 | 133 |
| 341 | 3300046535 | Ga0495586_0246384 | Ga0495586_0246384_95_616 | 133 |
| 342 | 3300046542 | Ga0495597_0242728 | Ga0495597_0242728_155_676 | 133 |
| 343 | 3300046557 | Ga0495622_0021185 | Ga0495622_0021185_2040_2561 | 133 |
| 344 | 3300046559 | Ga0495667_0033121 | Ga0495667_0033121_991_1512 | 133 |
| 345 | 3300046559 | Ga0495667_0220514 | Ga0495667_0220514_101_670 | 133 |
| 346 | 3300046615 | Ga0495656_0002496 | Ga0495656_0002496_329_850 | 133 |
| 347 | 3300046615 | Ga0495656_0029456 | Ga0495656_0029456_963_1484 | 133 |
| 348 | 3300046642 | Ga0495634_0008013 | Ga0495634_0008013_335_856 | 133 |
| 349 | 3300046648 | Ga0495611_0044027 | Ga0495611_0044027_589_1110 | 133 |
| 350 | 3300046648 | Ga0495611_0249474 | Ga0495611_0249474_165_686 | 133 |
| 351 | 3300046660 | Ga0495625_0151423 | Ga0495625_0151423_323_844 | 133 |
| 352 | 3300046660 | Ga0495625_0491730 | Ga0495625_0491730_25_546 | 133 |
| 353 | 3300046663 | Ga0495635_0004315 | Ga0495635_0004315_6838_7359 | 133 |
| 354 | 3300046663 | Ga0495635_0363086 | Ga0495635_0363086_73_594 | 133 |
| 355 | 3300046664 | Ga0495659_0002773 | Ga0495659_0002773_3891_4412 | 133 |
| 356 | 3300046664 | Ga0495659_0167607 | Ga0495659_0167607_242_763 | 133 |
| 357 | 3300046665 | Ga0495661_0425816 | Ga0495661_0425816_93_614 | 133 |
| 358 | 3300046674 | Ga0495588_0021822 | Ga0495588_0021822_1344_1865 | 133 |
| 359 | 3300046674 | Ga0495588_0042330 | Ga0495588_0042330_127_648 | 133 |
| 360 | 3300046680 | Ga0495646_0205646 | Ga0495646_0205646_412_933 | 133 |
| 361 | 3300046681 | Ga0495647_0000616 | Ga0495647_0000616_8724_9245 | 133 |
| 362 | 3300046683 | Ga0495658_0000155 | Ga0495658_0000155_77_598 | 133 |
| 363 | 3300046683 | Ga0495658_0135401 | Ga0495658_0135401_266_787 | 133 |
| 364 | 3300046684 | Ga0495669_0116564 | Ga0495669_0116564_521_1042 | 133 |
| 365 | 3300046684 | Ga0495669_0131069 | Ga0495669_0131069_75_596 | 133 |
| 366 | 3300046684 | Ga0495669_0183106 | Ga0495669_0183106_135_683 | 133 |
| 367 | 3300046684 | Ga0495669_0346981 | Ga0495669_0346981_182_703 | 133 |
| 368 | 3300046689 | Ga0495613_0012528 | Ga0495613_0012528_5622_6143 | 133 |
| 369 | 3300046690 | Ga0495624_0014936 | Ga0495624_0014936_3426_3947 | 133 |
| 370 | 3300046690 | Ga0495624_0232865 | Ga0495624_0232865_79_600 | 133 |
| 371 | 3300046690 | Ga0495624_0308912 | Ga0495624_0308912_209_730 | 133 |
| 372 | 3300046691 | Ga0495670_0120694 | Ga0495670_0120694_540_1061 | 133 |
| 373 | 3300046694 | Ga0495649_0218993 | Ga0495649_0218993_274_795 | 133 |
| 374 | 3300046809 | Ga0495600_0133057 | Ga0495600_0133057_157_678 | 133 |
| 375 | 3300046810 | Ga0495660_0261107 | Ga0495660_0261107_197_718 | 133 |
| 376 | 3300047315 | Ga0495581_0000187 | Ga0495581_0000187_19269_19790 | 133 |
| 377 | 3300047318 | Ga0495636_0277983 | Ga0495636_0277983_240_761 | 133 |
| 378 | 3300047319 | Ga0495674_0003575 | Ga0495674_0003575_11988_12509 | 133 |
| 379 | 3300047319 | Ga0495674_0377338 | Ga0495674_0377338_532_1053 | 133 |
| 380 | 3300047320 | Ga0495672_0045098 | Ga0495672_0045098_1053_1574 | 133 |
| 381 | 3300047321 | Ga0495676_0041979 | Ga0495676_0041979_350_871 | 133 |
| 382 | 3300047321 | Ga0495676_0195981 | Ga0495676_0195981_722_1243 | 133 |
| 383 | 3300047446 | Ga0495679_121405 | Ga0495679_121405_80_601 | 133 |
| 384 | 3300047471 | Ga0495684_0276826 | Ga0495684_0276826_343_912 | 133 |
| 385 | 3300047472 | Ga0495686_0110380 | Ga0495686_0110380_635_1156 | 133 |
| 386 | 3300047472 | Ga0495686_0173961 | Ga0495686_0173961_698_1219 | 133 |
| 387 | 3300047673 | Ga0495593_0000469 | Ga0495593_0000469_1023_1544 | 133 |
| 388 | 3300048089 | Ga0495614_0014072 | Ga0495614_0014072_944_1465 | 133 |
| 389 | 3300048091 | Ga0495626_0095411 | Ga0495626_0095411_235_756 | 133 |
| 390 | 3300048903 | Ga0496100_0438150 | Ga0496100_0438150_468_989 | 133 |
| 391 | 3300048903 | Ga0496100_0824993 | Ga0496100_0824993_80_601 | 133 |
| 392 | 3300048903 | Ga0496100_1265024 | Ga0496100_1265024_24_545 | 133 |
| 393 | 3300048904 | Ga0496101_0310484 | Ga0496101_0310484_468_989 | 133 |
| 394 | 3300048904 | Ga0496101_0436471 | Ga0496101_0436471_157_678 | 133 |
| 395 | 3300048904 | Ga0496101_1197382 | Ga0496101_1197382_44_565 | 133 |
| 396 | 3300048905 | Ga0496102_0176059 | Ga0496102_0176059_969_1490 | 133 |
| 397 | 3300048905 | Ga0496102_0988290 | Ga0496102_0988290_67_588 | 133 |
| 398 | 3300048907 | Ga0496104_0289596 | Ga0496104_0289596_116_637 | 133 |
| 399 | 3300048908 | Ga0496105_0237739 | Ga0496105_0237739_426_947 | 133 |
| 400 | 3300048909 | Ga0496106_0672600 | Ga0496106_0672600_244_765 | 133 |
| 401 | 3300048910 | Ga0496107_0436114 | Ga0496107_0436114_182_703 | 133 |
| 402 | 3300048911 | Ga0496108_0251538 | Ga0496108_0251538_451_972 | 133 |
| 403 | 3300048911 | Ga0496108_0934092 | Ga0496108_0934092_50_598 | 133 |
| 404 | 3300048912 | Ga0496109_0365747 | Ga0496109_0365747_562_1083 | 133 |
| 405 | 3300048912 | Ga0496109_0615766 | Ga0496109_0615766_409_930 | 133 |
| 406 | 3300048913 | Ga0496110_0377346 | Ga0496110_0377346_157_678 | 133 |
| 407 | 3300048913 | Ga0496110_0509370 | Ga0496110_0509370_255_776 | 133 |
| 408 | 3300048914 | Ga0496111_0472047 | Ga0496111_0472047_187_708 | 133 |
| 409 | 3300048915 | Ga0496112_0000040 | Ga0496112_0000040_60435_60956 | 133 |
| 410 | 3300048915 | Ga0496112_0024838 | Ga0496112_0024838_4997_5518 | 133 |
| 411 | 3300048915 | Ga0496112_0101473 | Ga0496112_0101473_1480_2001 | 133 |
| 412 | 3300048916 | Ga0496113_0625708 | Ga0496113_0625708_199_720 | 133 |
| 413 | 3300048917 | Ga0496114_0365865 | Ga0496114_0365865_398_919 | 133 |
| 414 | 3300048918 | Ga0496115_0071097 | Ga0496115_0071097_1497_2018 | 133 |
| 415 | 3300048922 | Ga0496119_0340756 | Ga0496119_0340756_187_708 | 133 |
| 416 | 3300048928 | Ga0496125_0321461 | Ga0496125_0321461_249_770 | 133 |
| 417 | 3300048929 | Ga0496126_0118157 | Ga0496126_0118157_1508_2029 | 133 |
| 418 | 3300048929 | Ga0496126_0291155 | Ga0496126_0291155_217_738 | 133 |
| 419 | 3300050490 | nmdc:mga03n38_8316_c1 | nmdc:mga03n38_8316_c1_825_1346 | 133 |
| 420 | 3300050491 | nmdc:mga00v17_42604_c1 | nmdc:mga00v17_42604_c1_152_673 | 133 |
| 421 | 3300050492 | nmdc:mga0yw44_120720_c1 | nmdc:mga0yw44_120720_c1_322_843 | 133 |
| 422 | 3300050492 | nmdc:mga0yw44_21272_c1 | nmdc:mga0yw44_21272_c1_2891_3412 | 133 |
| 423 | 3300050492 | nmdc:mga0yw44_296842_c1 | nmdc:mga0yw44_296842_c1_99_611 | 133 |
| 424 | 3300050492 | nmdc:mga0yw44_443007_c1 | nmdc:mga0yw44_443007_c1_161_682 | 133 |
| 425 | 3300050493 | nmdc:mga0k408_112619_c1 | nmdc:mga0k408_112619_c1_314_835 | 133 |
| 426 | 3300050493 | nmdc:mga0k408_218553_c1 | nmdc:mga0k408_218553_c1_335_856 | 133 |
| 427 | 3300050496 | nmdc:mga07m45_238716_c1 | nmdc:mga07m45_238716_c1_469_990 | 133 |
| 428 | 3300050507 | nmdc:mga05p37_822163_c1 | nmdc:mga05p37_822163_c1_74_595 | 133 |
| 429 | 3300050511 | nmdc:mga08y16_1238540_c1 | nmdc:mga08y16_1238540_c1_28_549 | 133 |
| 430 | 3300050512 | nmdc:mga0n895_164318_c1 | nmdc:mga0n895_164318_c1_205_768 | 133 |
| 431 | 3300050512 | nmdc:mga0n895_309762_c1 | nmdc:mga0n895_309762_c1_976_1497 | 133 |
| 432 | 3300050515 | nmdc:mga0a205_547148_c1 | nmdc:mga0a205_547148_c1_100_621 | 133 |
| 433 | 3300050516 | nmdc:mga0sz30_72943_c2 | nmdc:mga0sz30_72943_c2_101_622 | 133 |
| 434 | 3300053077 | Ga0495601_0173906 | Ga0495601_0173906_41_562 | 133 |
| 435 | 3300053077 | Ga0495601_0242538 | Ga0495601_0242538_342_863 | 133 |
| 436 | 3300053079 | Ga0500610_0159710 | Ga0500610_0159710_276_797 | 133 |
| 437 | 3300053080 | Ga0500635_0005076 | Ga0500635_0005076_2818_3339 | 133 |
| 438 | 3300053086 | Ga0500578_0219336 | Ga0500578_0219336_584_1105 | 133 |
| 439 | 3300053092 | Ga0500583_0027332 | Ga0500583_0027332_1134_1655 | 133 |
| 440 | 3300053093 | Ga0500651_0501854 | Ga0500651_0501854_57_578 | 133 |
| 441 | 3300053098 | Ga0500650_0229800 | Ga0500650_0229800_288_809 | 133 |
| 442 | 3300053102 | Ga0500554_022341 | Ga0500554_022341_223_744 | 133 |
| 443 | 3300053103 | Ga0500555_093957 | Ga0500555_093957_34_555 | 133 |
| 444 | 3300053116 | Ga0500592_031423 | Ga0500592_031423_324_845 | 133 |
| 445 | 3300053119 | Ga0500595_012930 | Ga0500595_012930_209_730 | 133 |
| 446 | 3300053124 | Ga0500617_189294 | Ga0500617_189294_82_603 | 133 |
| 447 | 3300053142 | Ga0500577_0047147 | Ga0500577_0047147_251_772 | 133 |
| 448 | 3300053146 | Ga0500588_0060025 | Ga0500588_0060025_468_989 | 133 |
| 449 | 3300053150 | Ga0500603_000340 | Ga0500603_000340_3015_3536 | 133 |
| 450 | 3300053160 | Ga0500633_0157225 | Ga0500633_0157225_65_586 | 133 |
| 451 | 3300053161 | Ga0500634_0078007 | Ga0500634_0078007_330_851 | 133 |
| 452 | 3300053178 | Ga0500637_0052453 | Ga0500637_0052453_19_540 | 133 |
| 453 | 3300053178 | Ga0500637_0053768 | Ga0500637_0053768_120_641 | 133 |
| 454 | 3300053730 | Ga0500645_046095 | Ga0500645_046095_468_1013 | 133 |
| 455 | 3300053730 | Ga0500645_105821 | Ga0500645_105821_99_620 | 133 |
| 456 | 3300026121 | Ga0207683_10238958 | Ga0207683_102389581 | 134 |
| 457 | 3300003203 | JGI25406J46586_10007230 | JGI25406J46586_100072304 | 141 |
| 458 | 3300050512 | nmdc:mga0n895_1257591_c1 | nmdc:mga0n895_1257591_c1_12_611 | 141 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar