F448243

General Info

Members Datasets Scaffolds Average Seq Length
458 274 457 173

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000740|Ga0466972_0000740_11281_11910
Length 209
Sequence MGYSLAVLNVCDVMACTRRHGLYRSRFTLRAQQMSQPASVSESPLQEQCAIDRRMVDGAHFKDAYRVSLSKDAPAVQVFQAVFAHHPWWMKLALIVRNVLASALGLATPSMAEVLRPTFASDYAVCQRIGVWPIFAVSTTELIVGRDNKHLDFRLSVLIHRVGAVPSATISTVCLAHNAFGRLYLLAVAPFHKFGLRRLLRSAVVDGRV

Samples

Sample ID Description Type Environment
1 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
225 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
245 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
248 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
252 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
257 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
261 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
268 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
269 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
270 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.83
Nodule 0.22
Rhizoplane 5.68
Rhizosphere 79.48
Stem 0
Stem Tuber 0
Unclassified 4.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007230 3300003203 Bacteria 5080
2 rootH2_10250460 3300003320 Bacteria 1484
3 rootL2_10120592 3300003322 Bacteria 2539
4 JGI25404J52841_10002183 3300003659 Bacteria 3659
5 JGI25404J52841_10003051 3300003659 Bacteria 3264
6 JGI25404J52841_10020429 3300003659 Bacteria 1434
7 JGI25404J52841_10031721 3300003659 Bacteria 1128
8 JGI25404J52841_10053020 3300003659 Bacteria 851
9 JGI25404J52841_10059641 3300003659 Bacteria 800
10 Ga0070676_10221451 3300005328 Bacteria 1250
11 Ga0070670_100012085 3300005331 Bacteria 7384
12 Ga0068869_100096137 3300005334 Bacteria 2235
13 Ga0070666_10358207 3300005335 Bacteria 1045
14 Ga0068868_100042893 3300005338 Bacteria 3533
15 Ga0070689_101119713 3300005340 Bacteria 704
16 Ga0070691_10596228 3300005341 Bacteria 651
17 Ga0070687_100517977 3300005343 Bacteria 806
18 Ga0070661_100417800 3300005344 Bacteria 1063
19 Ga0070668_100157891 3300005347 Bacteria 1838
20 Ga0070669_100086432 3300005353 Bacteria 2343
21 Ga0070675_100178875 3300005354 Bacteria 1833
22 Ga0070675_100689870 3300005354 Bacteria 930
23 Ga0070671_100002121 3300005355 Bacteria 15298
24 Ga0070671_100425375 3300005355 Bacteria 1138
25 Ga0070674_100180883 3300005356 Bacteria 1615
26 Ga0070674_100349479 3300005356 Bacteria 1194
27 Ga0070674_100632634 3300005356 Bacteria 908
28 Ga0070673_100090885 3300005364 Unclassified 2495
29 Ga0070673_100280037 3300005364 Bacteria 1462
30 Ga0070673_100435481 3300005364 Bacteria 1177
31 Ga0070688_100322675 3300005365 Bacteria 1123
32 Ga0070688_100788336 3300005365 Unclassified 742
33 Ga0070659_100858242 3300005366 Bacteria 792
34 Ga0070667_100311629 3300005367 Bacteria 1419
35 Ga0070709_10425601 3300005434 Bacteria 996
36 Ga0070714_100524085 3300005435 Bacteria 1132
37 Ga0070711_100272519 3300005439 Bacteria 1336
38 Ga0070711_100337041 3300005439 Bacteria 1209
39 Ga0070708_100051719 3300005445 Bacteria 3640
40 Ga0070663_100051325 3300005455 Bacteria 2937
41 Ga0070663_100827377 3300005455 Bacteria 795
42 Ga0070678_100057818 3300005456 Bacteria 2843
43 Ga0070678_100078551 3300005456 Bacteria 2493
44 Ga0070678_100200831 3300005456 Bacteria 1645
45 Ga0070662_100675536 3300005457 Bacteria 873
46 Ga0068867_100109506 3300005459 Bacteria 2120
47 Ga0070685_10368303 3300005466 Bacteria 987
48 Ga0070706_100069687 3300005467 Bacteria 3253
49 Ga0070698_100298518 3300005471 Bacteria 1542
50 Ga0070698_101090973 3300005471 Bacteria 747
51 Ga0070697_100169745 3300005536 Bacteria 1846
52 Ga0068853_100228733 3300005539 Bacteria 1700
53 Ga0070672_100126926 3300005543 Bacteria 2093
54 Ga0070665_100066611 3300005548 Bacteria 3612
55 Ga0070665_100090506 3300005548 Bacteria 3065
56 Ga0070665_100336739 3300005548 Bacteria 1513
57 Ga0070665_100738303 3300005548 Bacteria 998
58 Ga0068855_100473784 3300005563 Bacteria 1363
59 Ga0070664_100083929 3300005564 Plasmid 2749
60 Ga0068857_100666717 3300005577 Bacteria 987
61 Ga0068854_100256882 3300005578 Bacteria 1397
62 Ga0068856_100273146 3300005614 Bacteria 1706
63 Ga0068852_100248430 3300005616 Bacteria 1703
64 Ga0068859_100367682 3300005617 Bacteria 1533
65 Ga0068859_100877472 3300005617 Bacteria 982
66 Ga0068864_100141637 3300005618 Bacteria 2169
67 Ga0068870_10361172 3300005840 Bacteria 935
68 Ga0068863_100367327 3300005841 Bacteria 1404
69 Ga0068863_100675244 3300005841 Bacteria 1026
70 Ga0068858_100494347 3300005842 Bacteria 1181
71 Ga0068862_100148897 3300005844 Bacteria 2082
72 Ga0081455_10009859 3300005937 Bacteria 9783
73 Ga0081455_10010351 3300005937 Bacteria 9476
74 Ga0081455_10271713 3300005937 Bacteria 1229
75 Ga0081455_10352407 3300005937 Bacteria 1038
76 Ga0081540_1002409 3300005983 Bacteria 15242
77 Ga0081540_1004015 3300005983 Bacteria 11394
78 Ga0081540_1005098 3300005983 Bacteria 9852
79 Ga0081540_1005864 3300005983 Bacteria 9086
80 Ga0081540_1006387 3300005983 Bacteria 8594
81 Ga0081540_1015259 3300005983 Bacteria 4871
82 Ga0081540_1058525 3300005983 Bacteria 1856
83 Ga0081540_1067209 3300005983 Bacteria 1676
84 Ga0081540_1095723 3300005983 Bacteria 1293
85 Ga0081540_1131936 3300005983 Bacteria 1018
86 Ga0081539_10016758 3300005985 Bacteria 5203
87 Ga0081539_10170022 3300005985 Bacteria 1031
88 Ga0075365_10166813 3300006038 Bacteria 1536
89 Ga0075365_10307119 3300006038 Bacteria 1117
90 Ga0075368_10220649 3300006042 Bacteria 805
91 Ga0075363_100068592 3300006048 Bacteria 1923
92 Ga0075363_100232179 3300006048 Bacteria 1059
93 Ga0075364_10100606 3300006051 Bacteria 1924
94 Ga0070716_100200191 3300006173 Unclassified 1327
95 Ga0070712_100992842 3300006175 Unclassified 726
96 Ga0075362_10074756 3300006177 Bacteria 1553
97 Ga0075367_10110032 3300006178 Bacteria 1690
98 Ga0075367_10195079 3300006178 Bacteria 1264
99 Ga0075367_10221277 3300006178 Bacteria 1185
100 Ga0075367_10258959 3300006178 Bacteria 1092
101 Ga0075366_10342841 3300006195 Bacteria 916
102 Ga0075370_10138859 3300006353 Bacteria 1420
103 Ga0068871_100586661 3300006358 Bacteria 1012
104 Ga0075433_10194301 3300006852 Bacteria 1805
105 Ga0075433_11039782 3300006852 Bacteria 713
106 Ga0075434_100243387 3300006871 Bacteria 1819
107 Ga0075434_100500998 3300006871 Bacteria 1235
108 Ga0068865_100047409 3300006881 Bacteria 2952
109 Ga0068865_100739871 3300006881 Bacteria 844
110 Ga0068865_101097232 3300006881 Bacteria 701
111 Ga0097620_100367663 3300006931 Bacteria 1533
112 Ga0097620_100877446 3300006931 Bacteria 982
113 Ga0099794_10091806 3300007265 Bacteria 1507
114 Ga0099794_10107997 3300007265 Bacteria 1392
115 Ga0099794_10181834 3300007265 Bacteria 1073
116 Ga0099795_10066715 3300007788 Bacteria 1348
117 Ga0099795_10069526 3300007788 Bacteria 1325
118 Ga0099795_10205062 3300007788 Bacteria 833
119 Ga0105245_10278389 3300009098 Unclassified 1634
120 Ga0105245_10702634 3300009098 Bacteria 1044
121 Ga0105247_10073237 3300009101 Bacteria 2146
122 Ga0105247_10379792 3300009101 Bacteria 1001
123 Ga0114129_11192802 3300009147 Bacteria 948
124 Ga0105243_11199680 3300009148 Bacteria 772
125 Ga0105241_10059652 3300009174 Bacteria 2934
126 Ga0105241_10163740 3300009174 Unclassified 1831
127 Ga0105241_10658625 3300009174 Bacteria 952
128 Ga0105248_10761857 3300009177 Bacteria 1092
129 Ga0105237_10432007 3300009545 Bacteria 1323
130 Ga0105237_10495747 3300009545 Bacteria 1228
131 Ga0105237_11358637 3300009545 Unclassified 717
132 Ga0105238_10417185 3300009551 Bacteria 1336
133 Ga0105238_10452204 3300009551 Bacteria 1281
134 Ga0105238_11059663 3300009551 Bacteria 833
135 Ga0105249_10682143 3300009553 Bacteria 1086
136 Ga0099796_10006692 3300010159 Bacteria 2968
137 Ga0099796_10033287 3300010159 Bacteria 1695
138 Ga0105239_10172092 3300010375 Unclassified 2422
139 Ga0105239_10276810 3300010375 Bacteria 1888
140 Ga0105246_10071550 3300011119 Bacteria 2442
141 Ga0105246_10276904 3300011119 Bacteria 1344
142 Ga0105246_10400633 3300011119 Unclassified 1139
143 Ga0105246_11267330 3300011119 Bacteria 682
144 Ga0157374_10085037 3300013296 Bacteria 3007
145 Ga0157374_10428633 3300013296 Unclassified 1322
146 Ga0157378_10395161 3300013297 Unclassified 1361
147 Ga0157378_10519856 3300013297 Bacteria 1192
148 Ga0157378_11790895 3300013297 Unclassified 662
149 Ga0163162_10773005 3300013306 Bacteria 1079
150 Ga0163162_10837879 3300013306 Bacteria 1035
151 Ga0163162_11402380 3300013306 Bacteria 795
152 Ga0157375_10170023 3300013308 Bacteria 2327
153 Ga0157375_10889715 3300013308 Bacteria 1035
154 Ga0163163_10064119 3300014325 Plasmid 3645
155 Ga0163163_10329094 3300014325 Bacteria 1582
156 Ga0163163_10377532 3300014325 Bacteria 1475
157 Ga0157380_11022320 3300014326 Bacteria 861
158 Ga0157377_10169897 3300014745 Bacteria 1363
159 Ga0157377_10546024 3300014745 Unclassified 818
160 Ga0157379_10030271 3300014968 Bacteria 4817
161 Ga0157379_10272952 3300014968 Bacteria 1538
162 Ga0157376_10096943 3300014969 Bacteria 2568
163 Ga0157376_10224723 3300014969 Bacteria 1741
164 Ga0157376_10749573 3300014969 Bacteria 985
165 Ga0163161_10463795 3300017792 Bacteria 1026
166 Ga0228598_1003692 3300024227 Bacteria 3274
167 Ga0207697_10159667 3300025315 Bacteria 983
168 Ga0207642_10354005 3300025899 Bacteria 867
169 Ga0207710_10029727 3300025900 Bacteria 2380
170 Ga0207688_10190060 3300025901 Bacteria 1228
171 Ga0207680_10358180 3300025903 Bacteria 1026
172 Ga0207647_10251005 3300025904 Bacteria 1015
173 Ga0207645_10452494 3300025907 Bacteria 867
174 Ga0207643_10173790 3300025908 Bacteria 1301
175 Ga0207684_10028285 3300025910 Bacteria 4776
176 Ga0207684_10110393 3300025910 Bacteria 2354
177 Ga0207654_10007087 3300025911 Bacteria 5649
178 Ga0207654_10442706 3300025911 Unclassified 910
179 Ga0207671_10019579 3300025914 Bacteria 5174
180 Ga0207671_10568077 3300025914 Unclassified 904
181 Ga0207663_10107013 3300025916 Bacteria 1891
182 Ga0207663_10135907 3300025916 Bacteria 1706
183 Ga0207663_10721507 3300025916 Unclassified 790
184 Ga0207662_10470018 3300025918 Bacteria 862
185 Ga0207649_10382641 3300025920 Bacteria 1049
186 Ga0207681_10238943 3300025923 Bacteria 1413
187 Ga0207694_10880876 3300025924 Bacteria 757
188 Ga0207694_11507320 3300025924 Bacteria 567
189 Ga0207650_10075775 3300025925 Plasmid 2540
190 Ga0207650_10399981 3300025925 Bacteria 1137
191 Ga0207659_10306014 3300025926 Unclassified 1307
192 Ga0207687_10027364 3300025927 Bacteria 3826
193 Ga0207687_10149317 3300025927 Unclassified 1781
194 Ga0207664_10606363 3300025929 Bacteria 983
195 Ga0207644_10003060 3300025931 Bacteria 10765
196 Ga0207644_10055921 3300025931 Bacteria 2846
197 Ga0207644_10868996 3300025931 Bacteria 755
198 Ga0207706_10177441 3300025933 Bacteria 1871
199 Ga0207706_10220027 3300025933 Bacteria 1663
200 Ga0207706_10406683 3300025933 Bacteria 1180
201 Ga0207709_10170513 3300025935 Bacteria 1527
202 Ga0207669_10063199 3300025937 Bacteria 2284
203 Ga0207669_10103714 3300025937 Bacteria 1887
204 Ga0207704_10042640 3300025938 Bacteria 2672
205 Ga0207704_10294936 3300025938 Bacteria 1239
206 Ga0207665_10739323 3300025939 Bacteria 775
207 Ga0207691_10222319 3300025940 Bacteria 1637
208 Ga0207689_10447251 3300025942 Bacteria 1080
209 Ga0207679_11072104 3300025945 Unclassified 739
210 Ga0207651_10151933 3300025960 Bacteria 1804
211 Ga0207640_10215404 3300025981 Bacteria 1466
212 Ga0207658_10211650 3300025986 Bacteria 1625
213 Ga0207658_10456297 3300025986 Bacteria 1132
214 Ga0207677_10062886 3300026023 Bacteria 2577
215 Ga0207703_10066265 3300026035 Bacteria 2970
216 Ga0207639_10080934 3300026041 Bacteria 2571
217 Ga0207678_10517524 3300026067 Bacteria 1041
218 Ga0207641_10568441 3300026088 Bacteria 1107
219 Ga0207641_10960389 3300026088 Bacteria 850
220 Ga0207648_10242681 3300026089 Bacteria 1604
221 Ga0207676_10006429 3300026095 Bacteria 8303
222 Ga0207674_10139383 3300026116 Bacteria 2386
223 Ga0207675_100423129 3300026118 Bacteria 1316
224 Ga0207683_10041585 3300026121 Bacteria 4014
225 Ga0207683_10086116 3300026121 Bacteria 2793
226 Ga0207683_10238958 3300026121 Bacteria 1657
227 Ga0207683_10276731 3300026121 Bacteria 1534
228 Ga0207698_10721935 3300026142 Bacteria 993
229 Ga0209179_1044222 3300027512 Bacteria 943
230 Ga0209588_1023475 3300027671 Bacteria 1944
231 Ga0209588_1038254 3300027671 Bacteria 1545
232 Ga0209588_1053151 3300027671 Bacteria 1310
233 Ga0268266_10001439 3300028379 Bacteria 28336
234 Ga0268266_10033226 3300028379 Bacteria 4386
235 Ga0268266_10360225 3300028379 Unclassified 1368
236 Ga0268264_10596011 3300028381 Bacteria 1088
237 Ga0307517_10000098 3300028786 Bacteria 126044
238 Ga0307517_10366646 3300028786 Bacteria 776
239 Ga0307515_10016400 3300028794 Bacteria 13559
240 Ga0307515_10258556 3300028794 Unclassified 1481
241 Ga0307515_10562728 3300028794 Bacteria 750
242 Ga0265332_10187929 3300031238 Unclassified 860
243 Ga0307513_10043066 3300031456 Bacteria 4963
244 Ga0307513_10253885 3300031456 Bacteria 1553
245 Ga0307509_10071932 3300031507 Bacteria 3605
246 Ga0307509_10302743 3300031507 Bacteria 1346
247 Ga0307508_10207351 3300031616 Bacteria 1560
248 Ga0307508_10231057 3300031616 Bacteria 1448
249 Ga0307508_10344327 3300031616 Bacteria 1082
250 Ga0307508_10612551 3300031616 Unclassified 691
251 Ga0307516_10003537 3300031730 Bacteria 19981
252 Ga0307516_10083064 3300031730 Bacteria 3045
253 Ga0307516_10576725 3300031730 Bacteria 779
254 Ga0373944_0036587 3300035089 Bacteria 1500
255 Ga0373944_0105194 3300035089 Unclassified 958
256 Ga0373923_0127280 3300035111 Bacteria 1142
257 Ga0373936_0021072 3300035113 Unclassified 2535
258 Ga0373939_0161553 3300035114 Unclassified 823
259 Ga0373945_0116584 3300035116 Bacteria 1058
260 Ga0373945_0290541 3300035116 Unclassified 698
261 Ga0373954_0013494 3300035118 Bacteria 3642
262 Ga0373943_0000806 3300035170 Bacteria 13730
263 Ga0373943_0461627 3300035170 Unclassified 739
264 Ga0373946_0040364 3300035171 Bacteria 1909
265 Ga0373935_0003421 3300035692 Bacteria 9218
266 Ga0373935_0501514 3300035692 Unclassified 881
267 Ga0373927_0000046 3300035695 Bacteria 88401
268 Ga0373927_0043815 3300035695 Bacteria 2896
269 Ga0373927_0613437 3300035695 Unclassified 719
270 Ga0373927_0858133 3300035695 Unclassified 599
271 Ga0373947_0002296 3300035725 Bacteria 11558
272 Ga0373925_0003178 3300037068 Bacteria 12843
273 Ga0373925_0227374 3300037068 Bacteria 1491
274 Ga0395905_0160938 3300037471 Unclassified 2109
275 Ga0451791_0477269 3300041451 Bacteria 896
276 Ga0466972_0000740 3300044658 Bacteria 15601
277 Ga0495592_0080841 3300046454 Bacteria 2350
278 Ga0495592_0167965 3300046454 Bacteria 1504
279 Ga0495603_0000051 3300046455 Bacteria 50402
280 Ga0495603_0119464 3300046455 Bacteria 1536
281 Ga0495603_0133660 3300046455 Bacteria 1444
282 Ga0495603_0167436 3300046455 Bacteria 1273
283 Ga0495603_0475457 3300046455 Unclassified 716
284 Ga0495629_0020958 3300046459 Bacteria 4665
285 Ga0495629_0151596 3300046459 Bacteria 1611
286 Ga0495629_0352029 3300046459 Bacteria 1004
287 Ga0495629_0357386 3300046459 Bacteria 996
288 Ga0495638_0071723 3300046460 Bacteria 2118
289 Ga0495638_0458846 3300046460 Bacteria 649
290 Ga0495641_0014250 3300046461 Bacteria 4310
291 Ga0495651_0561460 3300046462 Unclassified 724
292 Ga0495580_0054957 3300046472 Bacteria 2807
293 Ga0495582_0000025 3300046473 Bacteria 82063
294 Ga0495582_0157321 3300046473 Bacteria 1292
295 Ga0495582_0270459 3300046473 Bacteria 975
296 Ga0495605_0039602 3300046474 Bacteria 2360
297 Ga0495639_0004907 3300046475 Bacteria 5735
298 Ga0495662_0000583 3300046476 Bacteria 16810
299 Ga0495662_0367889 3300046476 Unclassified 706
300 Ga0495664_0065727 3300046477 Bacteria 2162
301 Ga0495664_0133862 3300046477 Bacteria 1502
302 Ga0495664_0209090 3300046477 Unclassified 1182
303 Ga0495585_0030348 3300046492 Bacteria 3075
304 Ga0495585_0297926 3300046492 Bacteria 793
305 Ga0495594_0003321 3300046499 Bacteria 8321
306 Ga0495583_0116703 3300046506 Bacteria 1127
307 Ga0495606_0283860 3300046507 Bacteria 904
308 Ga0495606_0645009 3300046507 Bacteria 513
309 Ga0495616_0178145 3300046513 Bacteria 946
310 Ga0495618_0405387 3300046514 Unclassified 833
311 Ga0495628_0097570 3300046516 Bacteria 2270
312 Ga0495628_0115651 3300046516 Bacteria 2060
313 Ga0495628_0181444 3300046516 Unclassified 1592
314 Ga0495628_0300908 3300046516 Bacteria 1187
315 Ga0495628_0354929 3300046516 Bacteria 1077
316 Ga0495630_0009655 3300046517 Bacteria 6940
317 Ga0495630_0117156 3300046517 Bacteria 2019
318 Ga0495630_0547437 3300046517 Unclassified 887
319 Ga0495630_1434806 3300046517 Unclassified 519
320 Ga0495643_0111012 3300046522 Bacteria 1394
321 Ga0495643_0266659 3300046522 Bacteria 793
322 Ga0495663_0031042 3300046525 Bacteria 1586
323 Ga0495666_0372064 3300046526 Bacteria 643
324 Ga0495642_0075538 3300046528 Bacteria 1414
325 Ga0495652_0173293 3300046529 Bacteria 1663
326 Ga0495652_0287374 3300046529 Bacteria 1201
327 Ga0495654_0146248 3300046530 Bacteria 1049
328 Ga0495640_0009977 3300046533 Bacteria 7361
329 Ga0495640_0023128 3300046533 Bacteria 4536
330 Ga0495640_0571605 3300046533 Unclassified 684
331 Ga0495586_0246384 3300046535 Bacteria 1019
332 Ga0495597_0242728 3300046542 Bacteria 710
333 Ga0495622_0021185 3300046557 Bacteria 3028
334 Ga0495667_0033121 3300046559 Bacteria 3458
335 Ga0495667_0220514 3300046559 Unclassified 1210
336 Ga0495656_0002496 3300046615 Bacteria 6121
337 Ga0495656_0029456 3300046615 Bacteria 2210
338 Ga0495634_0008013 3300046642 Bacteria 7882
339 Ga0495634_0225745 3300046642 Bacteria 1154
340 Ga0495611_0044027 3300046648 Bacteria 1996
341 Ga0495611_0249474 3300046648 Bacteria 823
342 Ga0495625_0151423 3300046660 Bacteria 1559
343 Ga0495625_0491730 3300046660 Bacteria 751
344 Ga0495635_0004315 3300046663 Bacteria 9844
345 Ga0495635_0363086 3300046663 Bacteria 965
346 Ga0495659_0002773 3300046664 Bacteria 5638
347 Ga0495659_0167607 3300046664 Bacteria 889
348 Ga0495661_0425816 3300046665 Bacteria 642
349 Ga0495588_0021822 3300046674 Bacteria 3159
350 Ga0495588_0042330 3300046674 Bacteria 2328
351 Ga0495599_0307306 3300046678 Unclassified 956
352 Ga0495646_0205646 3300046680 Bacteria 1070
353 Ga0495647_0000616 3300046681 Bacteria 10500
354 Ga0495658_0000155 3300046683 Bacteria 38298
355 Ga0495658_0135401 3300046683 Unclassified 1503
356 Ga0495669_0116564 3300046684 Bacteria 1250
357 Ga0495669_0131069 3300046684 Bacteria 1180
358 Ga0495669_0183106 3300046684 Bacteria 999
359 Ga0495669_0346981 3300046684 Bacteria 717
360 Ga0495613_0012528 3300046689 Bacteria 6302
361 Ga0495613_0225688 3300046689 Bacteria 1314
362 Ga0495624_0014936 3300046690 Bacteria 5259
363 Ga0495624_0232865 3300046690 Unclassified 1115
364 Ga0495624_0308912 3300046690 Bacteria 953
365 Ga0495670_0120694 3300046691 Bacteria 1361
366 Ga0495649_0218993 3300046694 Bacteria 985
367 Ga0495600_0133057 3300046809 Bacteria 1616
368 Ga0495600_0370416 3300046809 Bacteria 895
369 Ga0495660_0261107 3300046810 Bacteria 800
370 Ga0495581_0000187 3300047315 Bacteria 28682
371 Ga0495636_0277983 3300047318 Bacteria 779
372 Ga0495674_0003575 3300047319 Bacteria 15109
373 Ga0495674_0377338 3300047319 Bacteria 1148
374 Ga0495672_0045098 3300047320 Bacteria 2641
375 Ga0495676_0041979 3300047321 Bacteria 3760
376 Ga0495676_0195981 3300047321 Bacteria 1406
377 Ga0495683_0167869 3300047323 Bacteria 1011
378 Ga0495675_0424550 3300047444 Unclassified 772
379 Ga0495679_121405 3300047446 Bacteria 714
380 Ga0495684_0276826 3300047471 Bacteria 1212
381 Ga0495686_0110380 3300047472 Bacteria 1650
382 Ga0495686_0173961 3300047472 Bacteria 1251
383 Ga0495593_0000469 3300047673 Bacteria 22695
384 Ga0495614_0014072 3300048089 Bacteria 3508
385 Ga0495626_0095411 3300048091 Bacteria 1303
386 Ga0496100_0438150 3300048903 Bacteria 1000
387 Ga0496100_0824993 3300048903 Bacteria 727
388 Ga0496100_1265024 3300048903 Unclassified 582
389 Ga0496101_0310484 3300048904 Bacteria 1236
390 Ga0496101_0436471 3300048904 Bacteria 1033
391 Ga0496101_1197382 3300048904 Unclassified 595
392 Ga0496102_0176059 3300048905 Bacteria 2014
393 Ga0496102_0988290 3300048905 Unclassified 762
394 Ga0496104_0289596 3300048907 Bacteria 1550
395 Ga0496105_0237739 3300048908 Bacteria 1479
396 Ga0496106_0672600 3300048909 Bacteria 826
397 Ga0496107_0436114 3300048910 Bacteria 974
398 Ga0496108_0251538 3300048911 Bacteria 1537
399 Ga0496108_0934092 3300048911 Unclassified 743
400 Ga0496109_0365747 3300048912 Bacteria 1362
401 Ga0496109_0615766 3300048912 Unclassified 1022
402 Ga0496110_0377346 3300048913 Bacteria 1292
403 Ga0496110_0509370 3300048913 Bacteria 1095
404 Ga0496111_0472047 3300048914 Bacteria 925
405 Ga0496112_0000040 3300048915 Bacteria 89057
406 Ga0496112_0024838 3300048915 Bacteria 5748
407 Ga0496112_0101473 3300048915 Bacteria 2847
408 Ga0496113_0625708 3300048916 Bacteria 861
409 Ga0496114_0365865 3300048917 Bacteria 1276
410 Ga0496115_0071097 3300048918 Bacteria 2822
411 Ga0496119_0340756 3300048922 Bacteria 729
412 Ga0496125_0321461 3300048928 Bacteria 938
413 Ga0496126_0118157 3300048929 Bacteria 2302
414 Ga0496126_0291155 3300048929 Bacteria 1350
415 nmdc:mga03683_173094_c1 3300050489 Bacteria 982
416 nmdc:mga03n38_8316_c1 3300050490 Bacteria 3718
417 nmdc:mga00v17_42604_c1 3300050491 Bacteria 2731
418 nmdc:mga0yw44_120720_c1 3300050492 Bacteria 1688
419 nmdc:mga0yw44_21272_c1 3300050492 Bacteria 3615
420 nmdc:mga0yw44_296842_c1 3300050492 Bacteria 1082
421 nmdc:mga0yw44_443007_c1 3300050492 Bacteria 880
422 nmdc:mga0k408_112619_c1 3300050493 Bacteria 1609
423 nmdc:mga0k408_218553_c1 3300050493 Bacteria 1138
424 nmdc:mga07m45_238716_c1 3300050496 Bacteria 1058
425 nmdc:mga07m45_397714_c1 3300050496 Bacteria 800
426 nmdc:mga05p37_822163_c1 3300050507 Bacteria 1013
427 nmdc:mga08y16_1238540_c1 3300050511 Bacteria 715
428 nmdc:mga0n895_1257591_c1 3300050512 Unclassified 712
429 nmdc:mga0n895_164318_c1 3300050512 Bacteria 2251
430 nmdc:mga0n895_309762_c1 3300050512 Bacteria 1600
431 nmdc:mga0a205_547148_c1 3300050515 Bacteria 1013
432 nmdc:mga0sz30_72943_c2 3300050516 Bacteria 651
433 Ga0495601_0084857 3300053077 Bacteria 2034
434 Ga0495601_0173906 3300053077 Bacteria 1408
435 Ga0495601_0242538 3300053077 Bacteria 1176
436 Ga0500610_0159710 3300053079 Bacteria 1122
437 Ga0500635_0005076 3300053080 Bacteria 3432
438 Ga0495619_0508044 3300053085 Bacteria 829
439 Ga0495619_0605656 3300053085 Unclassified 749
440 Ga0500578_0219336 3300053086 Bacteria 1157
441 Ga0500583_0027332 3300053092 Bacteria 2462
442 Ga0500651_0501854 3300053093 Bacteria 669
443 Ga0500650_0229800 3300053098 Bacteria 837
444 Ga0500554_022341 3300053102 Bacteria 1766
445 Ga0500555_093957 3300053103 Bacteria 768
446 Ga0500592_031423 3300053116 Bacteria 857
447 Ga0500595_012930 3300053119 Bacteria 3211
448 Ga0500617_189294 3300053124 Bacteria 768
449 Ga0500577_0047147 3300053142 Bacteria 1600
450 Ga0500588_0060025 3300053146 Bacteria 1215
451 Ga0500603_000340 3300053150 Bacteria 12205
452 Ga0500633_0157225 3300053160 Bacteria 853
453 Ga0500634_0078007 3300053161 Bacteria 1715
454 Ga0500637_0052453 3300053178 Bacteria 2326
455 Ga0500637_0053768 3300053178 Bacteria 2299
456 Ga0500645_046095 3300053730 Bacteria 1279
457 Ga0500645_105821 3300053730 Bacteria 791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046517 Ga0495630_1434806 Ga0495630_1434806_11_445 104
2 3300046529 Ga0495652_0173293 Ga0495652_0173293_1211_1645 104
3 3300046507 Ga0495606_0645009 Ga0495606_0645009_26_496 116
4 3300046642 Ga0495634_0225745 Ga0495634_0225745_41_511 116
5 3300046678 Ga0495599_0307306 Ga0495599_0307306_469_939 116
6 3300050496 nmdc:mga07m45_397714_c1 nmdc:mga07m45_397714_c1_205_675 116
7 3300046477 Ga0495664_0209090 Ga0495664_0209090_657_1142 121
8 3300046514 Ga0495618_0405387 Ga0495618_0405387_154_639 121
9 3300046516 Ga0495628_0181444 Ga0495628_0181444_460_945 121
10 3300046533 Ga0495640_0571605 Ga0495640_0571605_124_609 121
11 3300046689 Ga0495613_0225688 Ga0495613_0225688_364_849 121
12 3300046809 Ga0495600_0370416 Ga0495600_0370416_28_513 121
13 3300047444 Ga0495675_0424550 Ga0495675_0424550_22_507 121
14 3300053077 Ga0495601_0084857 Ga0495601_0084857_501_986 121
15 3300053085 Ga0495619_0605656 Ga0495619_0605656_202_687 121
16 3300046459 Ga0495629_0357386 Ga0495629_0357386_402_950 124
17 iso_pu_bacteria 2513237104 2513723954 129
18 3300047323 Ga0495683_0167869 Ga0495683_0167869_467_979 130
19 3300007788 Ga0099795_10069526 Ga0099795_100695262 131
20 3300010159 Ga0099796_10006692 Ga0099796_100066923 131
21 3300006038 Ga0075365_10166813 Ga0075365_101668133 132
22 3300006177 Ga0075362_10074756 Ga0075362_100747562 132
23 3300006178 Ga0075367_10195079 Ga0075367_101950792 132
24 3300031238 Ga0265332_10187929 Ga0265332_101879291 132
25 3300044658 Ga0466972_0000740 Ga0466972_0000740_11281_11910 132
26 3300050489 nmdc:mga03683_173094_c1 nmdc:mga03683_173094_c1_167_685 132
27 3300053085 Ga0495619_0508044 Ga0495619_0508044_156_674 132
28 3300003320 rootH2_10250460 rootH2_102504603 133
29 3300003322 rootL2_10120592 rootL2_101205923 133
30 3300003659 JGI25404J52841_10002183 JGI25404J52841_100021832 133
31 3300003659 JGI25404J52841_10003051 JGI25404J52841_100030512 133
32 3300003659 JGI25404J52841_10020429 JGI25404J52841_100204292 133
33 3300003659 JGI25404J52841_10031721 JGI25404J52841_100317212 133
34 3300003659 JGI25404J52841_10053020 JGI25404J52841_100530201 133
35 3300003659 JGI25404J52841_10059641 JGI25404J52841_100596412 133
36 3300005328 Ga0070676_10221451 Ga0070676_102214511 133
37 3300005331 Ga0070670_100012085 Ga0070670_1000120854 133
38 3300005334 Ga0068869_100096137 Ga0068869_1000961372 133
39 3300005335 Ga0070666_10358207 Ga0070666_103582071 133
40 3300005338 Ga0068868_100042893 Ga0068868_1000428932 133
41 3300005340 Ga0070689_101119713 Ga0070689_1011197131 133
42 3300005341 Ga0070691_10596228 Ga0070691_105962281 133
43 3300005343 Ga0070687_100517977 Ga0070687_1005179771 133
44 3300005344 Ga0070661_100417800 Ga0070661_1004178002 133
45 3300005347 Ga0070668_100157891 Ga0070668_1001578912 133
46 3300005353 Ga0070669_100086432 Ga0070669_1000864322 133
47 3300005354 Ga0070675_100178875 Ga0070675_1001788751 133
48 3300005354 Ga0070675_100689870 Ga0070675_1006898702 133
49 3300005355 Ga0070671_100002121 Ga0070671_1000021216 133
50 3300005355 Ga0070671_100425375 Ga0070671_1004253752 133
51 3300005356 Ga0070674_100180883 Ga0070674_1001808832 133
52 3300005356 Ga0070674_100349479 Ga0070674_1003494791 133
53 3300005356 Ga0070674_100632634 Ga0070674_1006326342 133
54 3300005364 Ga0070673_100090885 Ga0070673_1000908852 133
55 3300005364 Ga0070673_100280037 Ga0070673_1002800372 133
56 3300005364 Ga0070673_100435481 Ga0070673_1004354812 133
57 3300005365 Ga0070688_100322675 Ga0070688_1003226752 133
58 3300005365 Ga0070688_100788336 Ga0070688_1007883361 133
59 3300005366 Ga0070659_100858242 Ga0070659_1008582421 133
60 3300005367 Ga0070667_100311629 Ga0070667_1003116292 133
61 3300005434 Ga0070709_10425601 Ga0070709_104256011 133
62 3300005435 Ga0070714_100524085 Ga0070714_1005240852 133
63 3300005439 Ga0070711_100272519 Ga0070711_1002725191 133
64 3300005439 Ga0070711_100337041 Ga0070711_1003370411 133
65 3300005445 Ga0070708_100051719 Ga0070708_1000517195 133
66 3300005455 Ga0070663_100051325 Ga0070663_1000513252 133
67 3300005455 Ga0070663_100827377 Ga0070663_1008273771 133
68 3300005456 Ga0070678_100057818 Ga0070678_1000578182 133
69 3300005456 Ga0070678_100078551 Ga0070678_1000785512 133
70 3300005456 Ga0070678_100200831 Ga0070678_1002008312 133
71 3300005457 Ga0070662_100675536 Ga0070662_1006755362 133
72 3300005459 Ga0068867_100109506 Ga0068867_1001095062 133
73 3300005466 Ga0070685_10368303 Ga0070685_103683031 133
74 3300005467 Ga0070706_100069687 Ga0070706_1000696872 133
75 3300005471 Ga0070698_100298518 Ga0070698_1002985182 133
76 3300005471 Ga0070698_101090973 Ga0070698_1010909731 133
77 3300005536 Ga0070697_100169745 Ga0070697_1001697453 133
78 3300005539 Ga0068853_100228733 Ga0068853_1002287332 133
79 3300005543 Ga0070672_100126926 Ga0070672_1001269262 133
80 3300005548 Ga0070665_100066611 Ga0070665_1000666111 133
81 3300005548 Ga0070665_100090506 Ga0070665_1000905062 133
82 3300005548 Ga0070665_100336739 Ga0070665_1003367392 133
83 3300005548 Ga0070665_100738303 Ga0070665_1007383032 133
84 3300005563 Ga0068855_100473784 Ga0068855_1004737842 133
85 3300005564 Ga0070664_100083929 Ga0070664_1000839292 133
86 3300005577 Ga0068857_100666717 Ga0068857_1006667171 133
87 3300005578 Ga0068854_100256882 Ga0068854_1002568822 133
88 3300005614 Ga0068856_100273146 Ga0068856_1002731462 133
89 3300005616 Ga0068852_100248430 Ga0068852_1002484302 133
90 3300005617 Ga0068859_100367682 Ga0068859_1003676822 133
91 3300005617 Ga0068859_100877472 Ga0068859_1008774722 133
92 3300005618 Ga0068864_100141637 Ga0068864_1001416372 133
93 3300005840 Ga0068870_10361172 Ga0068870_103611722 133
94 3300005841 Ga0068863_100367327 Ga0068863_1003673272 133
95 3300005841 Ga0068863_100675244 Ga0068863_1006752442 133
96 3300005842 Ga0068858_100494347 Ga0068858_1004943472 133
97 3300005844 Ga0068862_100148897 Ga0068862_1001488972 133
98 3300005937 Ga0081455_10009859 Ga0081455_100098597 133
99 3300005937 Ga0081455_10010351 Ga0081455_100103512 133
100 3300005937 Ga0081455_10271713 Ga0081455_102717132 133
101 3300005937 Ga0081455_10352407 Ga0081455_103524072 133
102 3300005983 Ga0081540_1002409 Ga0081540_100240912 133
103 3300005983 Ga0081540_1004015 Ga0081540_10040159 133
104 3300005983 Ga0081540_1005098 Ga0081540_10050983 133
105 3300005983 Ga0081540_1005864 Ga0081540_100586413 133
106 3300005983 Ga0081540_1006387 Ga0081540_10063878 133
107 3300005983 Ga0081540_1015259 Ga0081540_10152597 133
108 3300005983 Ga0081540_1058525 Ga0081540_10585252 133
109 3300005983 Ga0081540_1067209 Ga0081540_10672093 133
110 3300005983 Ga0081540_1095723 Ga0081540_10957231 133
111 3300005983 Ga0081540_1131936 Ga0081540_11319361 133
112 3300005985 Ga0081539_10016758 Ga0081539_100167583 133
113 3300005985 Ga0081539_10170022 Ga0081539_101700222 133
114 3300006038 Ga0075365_10307119 Ga0075365_103071192 133
115 3300006042 Ga0075368_10220649 Ga0075368_102206492 133
116 3300006048 Ga0075363_100068592 Ga0075363_1000685922 133
117 3300006048 Ga0075363_100232179 Ga0075363_1002321792 133
118 3300006051 Ga0075364_10100606 Ga0075364_101006062 133
119 3300006173 Ga0070716_100200191 Ga0070716_1002001912 133
120 3300006175 Ga0070712_100992842 Ga0070712_1009928422 133
121 3300006178 Ga0075367_10110032 Ga0075367_101100322 133
122 3300006178 Ga0075367_10221277 Ga0075367_102212771 133
123 3300006178 Ga0075367_10258959 Ga0075367_102589592 133
124 3300006195 Ga0075366_10342841 Ga0075366_103428412 133
125 3300006353 Ga0075370_10138859 Ga0075370_101388592 133
126 3300006358 Ga0068871_100586661 Ga0068871_1005866612 133
127 3300006852 Ga0075433_10194301 Ga0075433_101943012 133
128 3300006852 Ga0075433_11039782 Ga0075433_110397821 133
129 3300006871 Ga0075434_100243387 Ga0075434_1002433872 133
130 3300006871 Ga0075434_100500998 Ga0075434_1005009981 133
131 3300006881 Ga0068865_100047409 Ga0068865_1000474092 133
132 3300006881 Ga0068865_100739871 Ga0068865_1007398711 133
133 3300006881 Ga0068865_101097232 Ga0068865_1010972321 133
134 3300006931 Ga0097620_100367663 Ga0097620_1003676632 133
135 3300006931 Ga0097620_100877446 Ga0097620_1008774462 133
136 3300007265 Ga0099794_10091806 Ga0099794_100918062 133
137 3300007265 Ga0099794_10107997 Ga0099794_101079972 133
138 3300007265 Ga0099794_10181834 Ga0099794_101818341 133
139 3300007788 Ga0099795_10066715 Ga0099795_100667152 133
140 3300007788 Ga0099795_10205062 Ga0099795_102050622 133
141 3300009098 Ga0105245_10278389 Ga0105245_102783892 133
142 3300009098 Ga0105245_10702634 Ga0105245_107026341 133
143 3300009101 Ga0105247_10073237 Ga0105247_100732372 133
144 3300009101 Ga0105247_10379792 Ga0105247_103797922 133
145 3300009147 Ga0114129_11192802 Ga0114129_111928022 133
146 3300009148 Ga0105243_11199680 Ga0105243_111996801 133
147 3300009174 Ga0105241_10059652 Ga0105241_100596522 133
148 3300009174 Ga0105241_10163740 Ga0105241_101637402 133
149 3300009174 Ga0105241_10658625 Ga0105241_106586252 133
150 3300009177 Ga0105248_10761857 Ga0105248_107618572 133
151 3300009545 Ga0105237_10432007 Ga0105237_104320072 133
152 3300009545 Ga0105237_10495747 Ga0105237_104957471 133
153 3300009545 Ga0105237_11358637 Ga0105237_113586371 133
154 3300009551 Ga0105238_10417185 Ga0105238_104171851 133
155 3300009551 Ga0105238_10452204 Ga0105238_104522042 133
156 3300009551 Ga0105238_11059663 Ga0105238_110596631 133
157 3300009553 Ga0105249_10682143 Ga0105249_106821432 133
158 3300010159 Ga0099796_10033287 Ga0099796_100332871 133
159 3300010375 Ga0105239_10172092 Ga0105239_101720921 133
160 3300010375 Ga0105239_10276810 Ga0105239_102768102 133
161 3300011119 Ga0105246_10071550 Ga0105246_100715502 133
162 3300011119 Ga0105246_10276904 Ga0105246_102769042 133
163 3300011119 Ga0105246_10400633 Ga0105246_104006331 133
164 3300011119 Ga0105246_11267330 Ga0105246_112673301 133
165 3300013296 Ga0157374_10085037 Ga0157374_100850373 133
166 3300013296 Ga0157374_10428633 Ga0157374_104286332 133
167 3300013297 Ga0157378_10395161 Ga0157378_103951612 133
168 3300013297 Ga0157378_10519856 Ga0157378_105198562 133
169 3300013297 Ga0157378_11790895 Ga0157378_117908951 133
170 3300013306 Ga0163162_10773005 Ga0163162_107730052 133
171 3300013306 Ga0163162_10837879 Ga0163162_108378792 133
172 3300013306 Ga0163162_11402380 Ga0163162_114023801 133
173 3300013308 Ga0157375_10170023 Ga0157375_101700233 133
174 3300013308 Ga0157375_10889715 Ga0157375_108897151 133
175 3300014325 Ga0163163_10064119 Ga0163163_100641192 133
176 3300014325 Ga0163163_10329094 Ga0163163_103290942 133
177 3300014325 Ga0163163_10377532 Ga0163163_103775322 133
178 3300014326 Ga0157380_11022320 Ga0157380_110223202 133
179 3300014745 Ga0157377_10169897 Ga0157377_101698972 133
180 3300014745 Ga0157377_10546024 Ga0157377_105460242 133
181 3300014968 Ga0157379_10030271 Ga0157379_100302712 133
182 3300014968 Ga0157379_10272952 Ga0157379_102729522 133
183 3300014969 Ga0157376_10096943 Ga0157376_100969432 133
184 3300014969 Ga0157376_10224723 Ga0157376_102247232 133
185 3300014969 Ga0157376_10749573 Ga0157376_107495731 133
186 3300017792 Ga0163161_10463795 Ga0163161_104637952 133
187 3300024227 Ga0228598_1003692 Ga0228598_10036921 133
188 3300025315 Ga0207697_10159667 Ga0207697_101596672 133
189 3300025899 Ga0207642_10354005 Ga0207642_103540051 133
190 3300025900 Ga0207710_10029727 Ga0207710_100297272 133
191 3300025901 Ga0207688_10190060 Ga0207688_101900602 133
192 3300025903 Ga0207680_10358180 Ga0207680_103581802 133
193 3300025904 Ga0207647_10251005 Ga0207647_102510052 133
194 3300025907 Ga0207645_10452494 Ga0207645_104524941 133
195 3300025908 Ga0207643_10173790 Ga0207643_101737902 133
196 3300025910 Ga0207684_10028285 Ga0207684_100282854 133
197 3300025910 Ga0207684_10110393 Ga0207684_101103932 133
198 3300025911 Ga0207654_10007087 Ga0207654_100070872 133
199 3300025911 Ga0207654_10442706 Ga0207654_104427062 133
200 3300025914 Ga0207671_10019579 Ga0207671_100195794 133
201 3300025914 Ga0207671_10568077 Ga0207671_105680772 133
202 3300025916 Ga0207663_10107013 Ga0207663_101070133 133
203 3300025916 Ga0207663_10135907 Ga0207663_101359072 133
204 3300025916 Ga0207663_10721507 Ga0207663_107215071 133
205 3300025918 Ga0207662_10470018 Ga0207662_104700182 133
206 3300025920 Ga0207649_10382641 Ga0207649_103826412 133
207 3300025923 Ga0207681_10238943 Ga0207681_102389432 133
208 3300025924 Ga0207694_10880876 Ga0207694_108808761 133
209 3300025924 Ga0207694_11507320 Ga0207694_115073201 133
210 3300025925 Ga0207650_10075775 Ga0207650_100757752 133
211 3300025925 Ga0207650_10399981 Ga0207650_103999811 133
212 3300025926 Ga0207659_10306014 Ga0207659_103060142 133
213 3300025927 Ga0207687_10027364 Ga0207687_100273642 133
214 3300025927 Ga0207687_10149317 Ga0207687_101493172 133
215 3300025929 Ga0207664_10606363 Ga0207664_106063632 133
216 3300025931 Ga0207644_10003060 Ga0207644_100030604 133
217 3300025931 Ga0207644_10055921 Ga0207644_100559213 133
218 3300025931 Ga0207644_10868996 Ga0207644_108689961 133
219 3300025933 Ga0207706_10177441 Ga0207706_101774412 133
220 3300025933 Ga0207706_10220027 Ga0207706_102200271 133
221 3300025933 Ga0207706_10406683 Ga0207706_104066831 133
222 3300025935 Ga0207709_10170513 Ga0207709_101705132 133
223 3300025937 Ga0207669_10063199 Ga0207669_100631992 133
224 3300025937 Ga0207669_10103714 Ga0207669_101037142 133
225 3300025938 Ga0207704_10042640 Ga0207704_100426402 133
226 3300025938 Ga0207704_10294936 Ga0207704_102949362 133
227 3300025939 Ga0207665_10739323 Ga0207665_107393231 133
228 3300025940 Ga0207691_10222319 Ga0207691_102223192 133
229 3300025942 Ga0207689_10447251 Ga0207689_104472512 133
230 3300025945 Ga0207679_11072104 Ga0207679_110721041 133
231 3300025960 Ga0207651_10151933 Ga0207651_101519332 133
232 3300025981 Ga0207640_10215404 Ga0207640_102154042 133
233 3300025986 Ga0207658_10211650 Ga0207658_102116502 133
234 3300025986 Ga0207658_10456297 Ga0207658_104562972 133
235 3300026023 Ga0207677_10062886 Ga0207677_100628861 133
236 3300026035 Ga0207703_10066265 Ga0207703_100662652 133
237 3300026041 Ga0207639_10080934 Ga0207639_100809342 133
238 3300026067 Ga0207678_10517524 Ga0207678_105175242 133
239 3300026088 Ga0207641_10568441 Ga0207641_105684412 133
240 3300026088 Ga0207641_10960389 Ga0207641_109603891 133
241 3300026089 Ga0207648_10242681 Ga0207648_102426812 133
242 3300026095 Ga0207676_10006429 Ga0207676_100064298 133
243 3300026116 Ga0207674_10139383 Ga0207674_101393833 133
244 3300026118 Ga0207675_100423129 Ga0207675_1004231292 133
245 3300026121 Ga0207683_10041585 Ga0207683_100415852 133
246 3300026121 Ga0207683_10086116 Ga0207683_100861162 133
247 3300026121 Ga0207683_10276731 Ga0207683_102767311 133
248 3300026142 Ga0207698_10721935 Ga0207698_107219351 133
249 3300027512 Ga0209179_1044222 Ga0209179_10442222 133
250 3300027671 Ga0209588_1023475 Ga0209588_10234752 133
251 3300027671 Ga0209588_1038254 Ga0209588_10382542 133
252 3300027671 Ga0209588_1053151 Ga0209588_10531512 133
253 3300028379 Ga0268266_10001439 Ga0268266_100014392 133
254 3300028379 Ga0268266_10033226 Ga0268266_100332264 133
255 3300028379 Ga0268266_10360225 Ga0268266_103602251 133
256 3300028381 Ga0268264_10596011 Ga0268264_105960112 133
257 3300028786 Ga0307517_10000098 Ga0307517_1000009889 133
258 3300028786 Ga0307517_10366646 Ga0307517_103666461 133
259 3300028794 Ga0307515_10016400 Ga0307515_100164003 133
260 3300028794 Ga0307515_10258556 Ga0307515_102585562 133
261 3300028794 Ga0307515_10562728 Ga0307515_105627282 133
262 3300031456 Ga0307513_10043066 Ga0307513_100430664 133
263 3300031456 Ga0307513_10253885 Ga0307513_102538852 133
264 3300031507 Ga0307509_10071932 Ga0307509_100719322 133
265 3300031507 Ga0307509_10302743 Ga0307509_103027432 133
266 3300031616 Ga0307508_10207351 Ga0307508_102073512 133
267 3300031616 Ga0307508_10231057 Ga0307508_102310573 133
268 3300031616 Ga0307508_10344327 Ga0307508_103443272 133
269 3300031616 Ga0307508_10612551 Ga0307508_106125511 133
270 3300031730 Ga0307516_10003537 Ga0307516_1000353718 133
271 3300031730 Ga0307516_10083064 Ga0307516_100830642 133
272 3300031730 Ga0307516_10576725 Ga0307516_105767251 133
273 3300035089 Ga0373944_0036587 Ga0373944_0036587_715_1236 133
274 3300035089 Ga0373944_0105194 Ga0373944_0105194_41_562 133
275 3300035111 Ga0373923_0127280 Ga0373923_0127280_420_941 133
276 3300035113 Ga0373936_0021072 Ga0373936_0021072_158_679 133
277 3300035114 Ga0373939_0161553 Ga0373939_0161553_209_772 133
278 3300035116 Ga0373945_0116584 Ga0373945_0116584_260_781 133
279 3300035116 Ga0373945_0290541 Ga0373945_0290541_115_636 133
280 3300035118 Ga0373954_0013494 Ga0373954_0013494_2573_3094 133
281 3300035170 Ga0373943_0000806 Ga0373943_0000806_1252_1773 133
282 3300035170 Ga0373943_0461627 Ga0373943_0461627_120_641 133
283 3300035171 Ga0373946_0040364 Ga0373946_0040364_183_704 133
284 3300035692 Ga0373935_0003421 Ga0373935_0003421_1044_1565 133
285 3300035692 Ga0373935_0501514 Ga0373935_0501514_219_740 133
286 3300035695 Ga0373927_0000046 Ga0373927_0000046_68606_69127 133
287 3300035695 Ga0373927_0043815 Ga0373927_0043815_2044_2565 133
288 3300035695 Ga0373927_0613437 Ga0373927_0613437_24_545 133
289 3300035695 Ga0373927_0858133 Ga0373927_0858133_54_575 133
290 3300035725 Ga0373947_0002296 Ga0373947_0002296_2657_3178 133
291 3300037068 Ga0373925_0003178 Ga0373925_0003178_11099_11620 133
292 3300037068 Ga0373925_0227374 Ga0373925_0227374_224_745 133
293 3300037471 Ga0395905_0160938 Ga0395905_0160938_210_731 133
294 3300041451 Ga0451791_0477269 Ga0451791_0477269_300_821 133
295 3300046454 Ga0495592_0080841 Ga0495592_0080841_485_1006 133
296 3300046454 Ga0495592_0167965 Ga0495592_0167965_364_885 133
297 3300046455 Ga0495603_0000051 Ga0495603_0000051_31767_32288 133
298 3300046455 Ga0495603_0119464 Ga0495603_0119464_368_889 133
299 3300046455 Ga0495603_0133660 Ga0495603_0133660_213_734 133
300 3300046455 Ga0495603_0167436 Ga0495603_0167436_151_672 133
301 3300046455 Ga0495603_0475457 Ga0495603_0475457_86_607 133
302 3300046459 Ga0495629_0020958 Ga0495629_0020958_3122_3643 133
303 3300046459 Ga0495629_0151596 Ga0495629_0151596_474_995 133
304 3300046459 Ga0495629_0352029 Ga0495629_0352029_141_662 133
305 3300046460 Ga0495638_0071723 Ga0495638_0071723_781_1302 133
306 3300046460 Ga0495638_0458846 Ga0495638_0458846_42_563 133
307 3300046461 Ga0495641_0014250 Ga0495641_0014250_2479_3000 133
308 3300046462 Ga0495651_0561460 Ga0495651_0561460_47_568 133
309 3300046472 Ga0495580_0054957 Ga0495580_0054957_1952_2473 133
310 3300046473 Ga0495582_0000025 Ga0495582_0000025_9021_9542 133
311 3300046473 Ga0495582_0157321 Ga0495582_0157321_457_978 133
312 3300046473 Ga0495582_0270459 Ga0495582_0270459_57_578 133
313 3300046474 Ga0495605_0039602 Ga0495605_0039602_1163_1684 133
314 3300046475 Ga0495639_0004907 Ga0495639_0004907_895_1416 133
315 3300046476 Ga0495662_0000583 Ga0495662_0000583_16132_16653 133
316 3300046476 Ga0495662_0367889 Ga0495662_0367889_63_584 133
317 3300046477 Ga0495664_0065727 Ga0495664_0065727_1138_1659 133
318 3300046477 Ga0495664_0133862 Ga0495664_0133862_553_1074 133
319 3300046492 Ga0495585_0030348 Ga0495585_0030348_1752_2264 133
320 3300046492 Ga0495585_0297926 Ga0495585_0297926_235_783 133
321 3300046499 Ga0495594_0003321 Ga0495594_0003321_4149_4670 133
322 3300046506 Ga0495583_0116703 Ga0495583_0116703_407_928 133
323 3300046507 Ga0495606_0283860 Ga0495606_0283860_293_814 133
324 3300046513 Ga0495616_0178145 Ga0495616_0178145_196_717 133
325 3300046516 Ga0495628_0097570 Ga0495628_0097570_202_723 133
326 3300046516 Ga0495628_0115651 Ga0495628_0115651_963_1484 133
327 3300046516 Ga0495628_0300908 Ga0495628_0300908_34_555 133
328 3300046516 Ga0495628_0354929 Ga0495628_0354929_354_920 133
329 3300046517 Ga0495630_0009655 Ga0495630_0009655_3622_4143 133
330 3300046517 Ga0495630_0117156 Ga0495630_0117156_1286_1807 133
331 3300046517 Ga0495630_0547437 Ga0495630_0547437_94_615 133
332 3300046522 Ga0495643_0111012 Ga0495643_0111012_343_864 133
333 3300046522 Ga0495643_0266659 Ga0495643_0266659_240_761 133
334 3300046525 Ga0495663_0031042 Ga0495663_0031042_558_1079 133
335 3300046526 Ga0495666_0372064 Ga0495666_0372064_59_580 133
336 3300046528 Ga0495642_0075538 Ga0495642_0075538_483_1004 133
337 3300046529 Ga0495652_0287374 Ga0495652_0287374_178_699 133
338 3300046530 Ga0495654_0146248 Ga0495654_0146248_289_810 133
339 3300046533 Ga0495640_0009977 Ga0495640_0009977_4323_4844 133
340 3300046533 Ga0495640_0023128 Ga0495640_0023128_1123_1644 133
341 3300046535 Ga0495586_0246384 Ga0495586_0246384_95_616 133
342 3300046542 Ga0495597_0242728 Ga0495597_0242728_155_676 133
343 3300046557 Ga0495622_0021185 Ga0495622_0021185_2040_2561 133
344 3300046559 Ga0495667_0033121 Ga0495667_0033121_991_1512 133
345 3300046559 Ga0495667_0220514 Ga0495667_0220514_101_670 133
346 3300046615 Ga0495656_0002496 Ga0495656_0002496_329_850 133
347 3300046615 Ga0495656_0029456 Ga0495656_0029456_963_1484 133
348 3300046642 Ga0495634_0008013 Ga0495634_0008013_335_856 133
349 3300046648 Ga0495611_0044027 Ga0495611_0044027_589_1110 133
350 3300046648 Ga0495611_0249474 Ga0495611_0249474_165_686 133
351 3300046660 Ga0495625_0151423 Ga0495625_0151423_323_844 133
352 3300046660 Ga0495625_0491730 Ga0495625_0491730_25_546 133
353 3300046663 Ga0495635_0004315 Ga0495635_0004315_6838_7359 133
354 3300046663 Ga0495635_0363086 Ga0495635_0363086_73_594 133
355 3300046664 Ga0495659_0002773 Ga0495659_0002773_3891_4412 133
356 3300046664 Ga0495659_0167607 Ga0495659_0167607_242_763 133
357 3300046665 Ga0495661_0425816 Ga0495661_0425816_93_614 133
358 3300046674 Ga0495588_0021822 Ga0495588_0021822_1344_1865 133
359 3300046674 Ga0495588_0042330 Ga0495588_0042330_127_648 133
360 3300046680 Ga0495646_0205646 Ga0495646_0205646_412_933 133
361 3300046681 Ga0495647_0000616 Ga0495647_0000616_8724_9245 133
362 3300046683 Ga0495658_0000155 Ga0495658_0000155_77_598 133
363 3300046683 Ga0495658_0135401 Ga0495658_0135401_266_787 133
364 3300046684 Ga0495669_0116564 Ga0495669_0116564_521_1042 133
365 3300046684 Ga0495669_0131069 Ga0495669_0131069_75_596 133
366 3300046684 Ga0495669_0183106 Ga0495669_0183106_135_683 133
367 3300046684 Ga0495669_0346981 Ga0495669_0346981_182_703 133
368 3300046689 Ga0495613_0012528 Ga0495613_0012528_5622_6143 133
369 3300046690 Ga0495624_0014936 Ga0495624_0014936_3426_3947 133
370 3300046690 Ga0495624_0232865 Ga0495624_0232865_79_600 133
371 3300046690 Ga0495624_0308912 Ga0495624_0308912_209_730 133
372 3300046691 Ga0495670_0120694 Ga0495670_0120694_540_1061 133
373 3300046694 Ga0495649_0218993 Ga0495649_0218993_274_795 133
374 3300046809 Ga0495600_0133057 Ga0495600_0133057_157_678 133
375 3300046810 Ga0495660_0261107 Ga0495660_0261107_197_718 133
376 3300047315 Ga0495581_0000187 Ga0495581_0000187_19269_19790 133
377 3300047318 Ga0495636_0277983 Ga0495636_0277983_240_761 133
378 3300047319 Ga0495674_0003575 Ga0495674_0003575_11988_12509 133
379 3300047319 Ga0495674_0377338 Ga0495674_0377338_532_1053 133
380 3300047320 Ga0495672_0045098 Ga0495672_0045098_1053_1574 133
381 3300047321 Ga0495676_0041979 Ga0495676_0041979_350_871 133
382 3300047321 Ga0495676_0195981 Ga0495676_0195981_722_1243 133
383 3300047446 Ga0495679_121405 Ga0495679_121405_80_601 133
384 3300047471 Ga0495684_0276826 Ga0495684_0276826_343_912 133
385 3300047472 Ga0495686_0110380 Ga0495686_0110380_635_1156 133
386 3300047472 Ga0495686_0173961 Ga0495686_0173961_698_1219 133
387 3300047673 Ga0495593_0000469 Ga0495593_0000469_1023_1544 133
388 3300048089 Ga0495614_0014072 Ga0495614_0014072_944_1465 133
389 3300048091 Ga0495626_0095411 Ga0495626_0095411_235_756 133
390 3300048903 Ga0496100_0438150 Ga0496100_0438150_468_989 133
391 3300048903 Ga0496100_0824993 Ga0496100_0824993_80_601 133
392 3300048903 Ga0496100_1265024 Ga0496100_1265024_24_545 133
393 3300048904 Ga0496101_0310484 Ga0496101_0310484_468_989 133
394 3300048904 Ga0496101_0436471 Ga0496101_0436471_157_678 133
395 3300048904 Ga0496101_1197382 Ga0496101_1197382_44_565 133
396 3300048905 Ga0496102_0176059 Ga0496102_0176059_969_1490 133
397 3300048905 Ga0496102_0988290 Ga0496102_0988290_67_588 133
398 3300048907 Ga0496104_0289596 Ga0496104_0289596_116_637 133
399 3300048908 Ga0496105_0237739 Ga0496105_0237739_426_947 133
400 3300048909 Ga0496106_0672600 Ga0496106_0672600_244_765 133
401 3300048910 Ga0496107_0436114 Ga0496107_0436114_182_703 133
402 3300048911 Ga0496108_0251538 Ga0496108_0251538_451_972 133
403 3300048911 Ga0496108_0934092 Ga0496108_0934092_50_598 133
404 3300048912 Ga0496109_0365747 Ga0496109_0365747_562_1083 133
405 3300048912 Ga0496109_0615766 Ga0496109_0615766_409_930 133
406 3300048913 Ga0496110_0377346 Ga0496110_0377346_157_678 133
407 3300048913 Ga0496110_0509370 Ga0496110_0509370_255_776 133
408 3300048914 Ga0496111_0472047 Ga0496111_0472047_187_708 133
409 3300048915 Ga0496112_0000040 Ga0496112_0000040_60435_60956 133
410 3300048915 Ga0496112_0024838 Ga0496112_0024838_4997_5518 133
411 3300048915 Ga0496112_0101473 Ga0496112_0101473_1480_2001 133
412 3300048916 Ga0496113_0625708 Ga0496113_0625708_199_720 133
413 3300048917 Ga0496114_0365865 Ga0496114_0365865_398_919 133
414 3300048918 Ga0496115_0071097 Ga0496115_0071097_1497_2018 133
415 3300048922 Ga0496119_0340756 Ga0496119_0340756_187_708 133
416 3300048928 Ga0496125_0321461 Ga0496125_0321461_249_770 133
417 3300048929 Ga0496126_0118157 Ga0496126_0118157_1508_2029 133
418 3300048929 Ga0496126_0291155 Ga0496126_0291155_217_738 133
419 3300050490 nmdc:mga03n38_8316_c1 nmdc:mga03n38_8316_c1_825_1346 133
420 3300050491 nmdc:mga00v17_42604_c1 nmdc:mga00v17_42604_c1_152_673 133
421 3300050492 nmdc:mga0yw44_120720_c1 nmdc:mga0yw44_120720_c1_322_843 133
422 3300050492 nmdc:mga0yw44_21272_c1 nmdc:mga0yw44_21272_c1_2891_3412 133
423 3300050492 nmdc:mga0yw44_296842_c1 nmdc:mga0yw44_296842_c1_99_611 133
424 3300050492 nmdc:mga0yw44_443007_c1 nmdc:mga0yw44_443007_c1_161_682 133
425 3300050493 nmdc:mga0k408_112619_c1 nmdc:mga0k408_112619_c1_314_835 133
426 3300050493 nmdc:mga0k408_218553_c1 nmdc:mga0k408_218553_c1_335_856 133
427 3300050496 nmdc:mga07m45_238716_c1 nmdc:mga07m45_238716_c1_469_990 133
428 3300050507 nmdc:mga05p37_822163_c1 nmdc:mga05p37_822163_c1_74_595 133
429 3300050511 nmdc:mga08y16_1238540_c1 nmdc:mga08y16_1238540_c1_28_549 133
430 3300050512 nmdc:mga0n895_164318_c1 nmdc:mga0n895_164318_c1_205_768 133
431 3300050512 nmdc:mga0n895_309762_c1 nmdc:mga0n895_309762_c1_976_1497 133
432 3300050515 nmdc:mga0a205_547148_c1 nmdc:mga0a205_547148_c1_100_621 133
433 3300050516 nmdc:mga0sz30_72943_c2 nmdc:mga0sz30_72943_c2_101_622 133
434 3300053077 Ga0495601_0173906 Ga0495601_0173906_41_562 133
435 3300053077 Ga0495601_0242538 Ga0495601_0242538_342_863 133
436 3300053079 Ga0500610_0159710 Ga0500610_0159710_276_797 133
437 3300053080 Ga0500635_0005076 Ga0500635_0005076_2818_3339 133
438 3300053086 Ga0500578_0219336 Ga0500578_0219336_584_1105 133
439 3300053092 Ga0500583_0027332 Ga0500583_0027332_1134_1655 133
440 3300053093 Ga0500651_0501854 Ga0500651_0501854_57_578 133
441 3300053098 Ga0500650_0229800 Ga0500650_0229800_288_809 133
442 3300053102 Ga0500554_022341 Ga0500554_022341_223_744 133
443 3300053103 Ga0500555_093957 Ga0500555_093957_34_555 133
444 3300053116 Ga0500592_031423 Ga0500592_031423_324_845 133
445 3300053119 Ga0500595_012930 Ga0500595_012930_209_730 133
446 3300053124 Ga0500617_189294 Ga0500617_189294_82_603 133
447 3300053142 Ga0500577_0047147 Ga0500577_0047147_251_772 133
448 3300053146 Ga0500588_0060025 Ga0500588_0060025_468_989 133
449 3300053150 Ga0500603_000340 Ga0500603_000340_3015_3536 133
450 3300053160 Ga0500633_0157225 Ga0500633_0157225_65_586 133
451 3300053161 Ga0500634_0078007 Ga0500634_0078007_330_851 133
452 3300053178 Ga0500637_0052453 Ga0500637_0052453_19_540 133
453 3300053178 Ga0500637_0053768 Ga0500637_0053768_120_641 133
454 3300053730 Ga0500645_046095 Ga0500645_046095_468_1013 133
455 3300053730 Ga0500645_105821 Ga0500645_105821_99_620 133
456 3300026121 Ga0207683_10238958 Ga0207683_102389581 134
457 3300003203 JGI25406J46586_10007230 JGI25406J46586_100072304 141
458 3300050512 nmdc:mga0n895_1257591_c1 nmdc:mga0n895_1257591_c1_12_611 141

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11066

DUF2867

Protein of unknown function (DUF2867)

55

199

0.91

Feature Viewer

pLDDT pTM Quality
54.77 0.31 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map