F448149

General Info

Members Datasets Scaffolds Average Seq Length
458 246 916 501

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100013307|Ga0070679_1000133074
Length 577
Sequence MPSAGGRAHAERAAPAGNASLGALRYRKRCRAHTSKNSDIDPKTAAAWSGPPGEFMRDSSFGTSFLHRGATGVAATALLLALAACGNGDRPATAALRDDPYDASKMDYKTPPAVLSAERHAGEFASGASLNKNGAIAPLDPSPVKEIRLDTTHKIIEIAPGVHFSAWTFGDQVPGPVIRARVGDRIKFTMTNRSDEPAPGIQLTAAPMMHSMDFHSAMVSPQDKYRSIAPGHTISFEFTLNYPGVFMYHCGTPMVLEHIASGMYGMMIVEPRGGYPTKVDREYAVVQSEFYTKPDPGKRKIDGRPLYVLDGDRVRAKAPTYTVFNGRYNKMVDTPLEAKPGERVRLFVMNVGPSNTSSFHVVGTIFDRVWIDGNPDNQFRGMQTVLLGSSSGAVVEFVIPEAGNYVMVDHHFANASQGAIGIIAAGGGAGDPEHHNIPATAAPTDPLAVQGKLAFESKCLACHSIAAGDKLGPDLYGVTKHRDDAWLTRWLKSPEQMLQSDPHAKAMLDKYKVPMPNQGLSDQEIKQYLAYFKWADANLQPQGTIQPQPSAPGTSLPPSQTKSATPMPGHAMEGAKR

Samples

Sample ID Description Type Environment
1 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 3.49
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070679_100013307 3300005530 Bacteria 7876
2 Ga0070658_10026661 3300005327 Bacteria 4637
3 Ga0070658_10032995 3300005327 Bacteria 4164
4 Ga0070676_10009762 3300005328 Bacteria 5192
5 Ga0070676_10018119 3300005328 Bacteria 3898
6 Ga0070676_10059119 3300005328 Bacteria 2273
7 Ga0070683_100016711 3300005329 Bacteria 6474
8 Ga0070690_100005377 3300005330 Bacteria 7188
9 Ga0070670_100033287 3300005331 Bacteria 4439
10 Ga0068869_100002189 3300005334 Bacteria 11757
11 Ga0068869_100033914 3300005334 Bacteria 3607
12 Ga0068868_100044770 3300005338 Bacteria 3460
13 Ga0068868_100092961 3300005338 Bacteria 2431
14 Ga0068868_100209988 3300005338 Bacteria 1627
15 Ga0070660_100003730 3300005339 Bacteria 10526
16 Ga0070689_100010023 3300005340 Bacteria 6747
17 Ga0070689_100011898 3300005340 Bacteria 6247
18 Ga0070691_10044793 3300005341 Bacteria 2098
19 Ga0070661_100007714 3300005344 Bacteria 7433
20 Ga0070661_100120311 3300005344 Bacteria 1966
21 Ga0070692_10017520 3300005345 Bacteria 3426
22 Ga0070669_100021638 3300005353 Bacteria 4596
23 Ga0070675_100002975 3300005354 Bacteria 12797
24 Ga0070675_100056625 3300005354 Bacteria 3231
25 Ga0070671_100004006 3300005355 Bacteria 11605
26 Ga0070674_100002905 3300005356 Bacteria 9491
27 Ga0070674_100019899 3300005356 Bacteria 4275
28 Ga0070688_100016703 3300005365 Bacteria 4201
29 Ga0070659_100003292 3300005366 Bacteria 11501
30 Ga0070659_100027265 3300005366 Bacteria 4400
31 Ga0070667_100013453 3300005367 Bacteria 6764
32 Ga0070714_100033095 3300005435 Bacteria 4319
33 Ga0070701_10006428 3300005438 Bacteria 4944
34 Ga0070700_100001451 3300005441 Bacteria 11791
35 Ga0070694_100048183 3300005444 Bacteria 2866
36 Ga0070708_100004822 3300005445 Bacteria 10638
37 Ga0070663_100007512 3300005455 Bacteria 6637
38 Ga0070678_100005774 3300005456 Bacteria 7198
39 Ga0070662_100049364 3300005457 Bacteria 3034
40 Ga0070681_10007835 3300005458 Bacteria 10445
41 Ga0070681_10013040 3300005458 Bacteria 8253
42 Ga0068867_100009509 3300005459 Bacteria 6856
43 Ga0068867_100027476 3300005459 Bacteria 4090
44 Ga0070707_100021265 3300005468 Bacteria 6132
45 Ga0070707_100025863 3300005468 Bacteria 5572
46 Ga0070698_100022962 3300005471 Bacteria 6523
47 Ga0070679_100045816 3300005530 Bacteria 4357
48 Ga0070697_100013922 3300005536 Bacteria 6315
49 Ga0068853_100007217 3300005539 Bacteria 8900
50 Ga0068853_100050358 3300005539 Bacteria 3583
51 Ga0068853_100059094 3300005539 Bacteria 3312
52 Ga0070672_100001986 3300005543 Bacteria 12823
53 Ga0070672_100017773 3300005543 Bacteria 5125
54 Ga0070672_100025234 3300005543 Bacteria 4406
55 Ga0070686_100001871 3300005544 Bacteria 11724
56 Ga0070695_100021588 3300005545 Bacteria 3943
57 Ga0070696_100017187 3300005546 Bacteria 4882
58 Ga0070693_100000729 3300005547 Bacteria 14479
59 Ga0070693_100011147 3300005547 Bacteria 4524
60 Ga0070693_100066144 3300005547 Unclassified 2115
61 Ga0068855_100004013 3300005563 Bacteria 17975
62 Ga0068855_100012925 3300005563 Bacteria 10073
63 Ga0068855_100023590 3300005563 Bacteria 7367
64 Ga0068855_100028064 3300005563 Bacteria 6732
65 Ga0070664_100005922 3300005564 Bacteria 9873
66 Ga0070664_100053351 3300005564 Bacteria 3427
67 Ga0068857_100010506 3300005577 Bacteria 8046
68 Ga0068857_100024179 3300005577 Bacteria 5348
69 Ga0068857_100027759 3300005577 Bacteria 4992
70 Ga0068854_100011443 3300005578 Bacteria 5779
71 Ga0068854_100020146 3300005578 Bacteria 4507
72 Ga0068856_100020444 3300005614 Bacteria 6430
73 Ga0068856_100026722 3300005614 Bacteria 5628
74 Ga0068856_100184502 3300005614 Bacteria 2100
75 Ga0068856_100199118 3300005614 Bacteria 2017
76 Ga0070702_100000854 3300005615 Bacteria 11764
77 Ga0070702_100015385 3300005615 Bacteria 3905
78 Ga0068852_100004636 3300005616 Bacteria 9742
79 Ga0068852_100016830 3300005616 Bacteria 5716
80 Ga0068852_100022362 3300005616 Bacteria 5070
81 Ga0068852_100170695 3300005616 Bacteria 2038
82 Ga0068852_100199725 3300005616 Bacteria 1892
83 Ga0068859_100019407 3300005617 Bacteria 6828
84 Ga0068859_100122085 3300005617 Bacteria 2672
85 Ga0068864_100051134 3300005618 Bacteria 3558
86 Ga0068864_100214090 3300005618 Bacteria 1775
87 Ga0068866_10001619 3300005718 Bacteria 9533
88 Ga0068866_10005830 3300005718 Bacteria 5113
89 Ga0068861_100007067 3300005719 Bacteria 7677
90 Ga0068861_100014421 3300005719 Bacteria 5548
91 Ga0068861_100150780 3300005719 Bacteria 1907
92 Ga0068851_10005460 3300005834 Bacteria 5766
93 Ga0068851_10009226 3300005834 Bacteria 4579
94 Ga0068870_10013809 3300005840 Bacteria 3804
95 Ga0068863_100041175 3300005841 Bacteria 4392
96 Ga0068863_100068382 3300005841 Bacteria 3360
97 Ga0068858_100009280 3300005842 Bacteria 9394
98 Ga0068860_100024170 3300005843 Bacteria 5875
99 Ga0068860_100040284 3300005843 Bacteria 4465
100 Ga0068860_100144043 3300005843 Bacteria 2292
101 Ga0068862_100001127 3300005844 Bacteria 25370
102 Ga0068862_100024775 3300005844 Bacteria 5034
103 Ga0068862_100044739 3300005844 Bacteria 3776
104 Ga0075362_10024137 3300006177 Bacteria 2578
105 Ga0075367_10005177 3300006178 Bacteria 6444
106 Ga0075370_10018927 3300006353 Bacteria 3740
107 Ga0068871_100003933 3300006358 Bacteria 10254
108 Ga0068871_100031169 3300006358 Bacteria 4203
109 Ga0068871_100065866 3300006358 Bacteria 2968
110 Ga0075428_100004732 3300006844 Bacteria 15072
111 Ga0075428_100087520 3300006844 Bacteria 3398
112 Ga0075430_100056534 3300006846 Bacteria 3299
113 Ga0075431_100041848 3300006847 Bacteria 4725
114 Ga0075433_10066145 3300006852 Bacteria 3171
115 Ga0075429_100020567 3300006880 Bacteria 5727
116 Ga0075429_100051024 3300006880 Bacteria 3600
117 Ga0068865_100013708 3300006881 Bacteria 5133
118 Ga0068865_100016342 3300006881 Bacteria 4748
119 Ga0075436_100000680 3300006914 Bacteria 22407
120 Ga0075436_100034828 3300006914 Bacteria 3473
121 Ga0097620_100019408 3300006931 Bacteria 6828
122 Ga0097620_100089614 3300006931 Bacteria 3126
123 Ga0097620_100122083 3300006931 Bacteria 2672
124 Ga0075435_100019873 3300007076 Bacteria 5138
125 Ga0105240_10003610 3300009093 Bacteria 23962
126 Ga0105240_10003662 3300009093 Bacteria 23770
127 Ga0105240_10004747 3300009093 Bacteria 20520
128 Ga0105240_10013938 3300009093 Bacteria 11004
129 Ga0105240_10058153 3300009093 Bacteria 4828
130 Ga0105240_10256700 3300009093 Bacteria 2018
131 Ga0111539_10000770 3300009094 Bacteria 41689
132 Ga0111539_10009287 3300009094 Bacteria 12418
133 Ga0111539_10019858 3300009094 Bacteria 8279
134 Ga0111539_10127305 3300009094 Bacteria 2983
135 Ga0111539_10183157 3300009094 Bacteria 2446
136 Ga0105245_10011499 3300009098 Bacteria 7709
137 Ga0105243_10001776 3300009148 Bacteria 18517
138 Ga0105243_10004141 3300009148 Bacteria 11526
139 Ga0105243_10099577 3300009148 Bacteria 2409
140 Ga0105241_10018654 3300009174 Bacteria 5107
141 Ga0105241_10020025 3300009174 Bacteria 4942
142 Ga0105242_10003224 3300009176 Bacteria 12720
143 Ga0105242_10005836 3300009176 Bacteria 9485
144 Ga0105248_10027727 3300009177 Bacteria 6307
145 Ga0105248_10054010 3300009177 Bacteria 4506
146 Ga0105248_10210030 3300009177 Bacteria 2193
147 Ga0105248_10278168 3300009177 Bacteria 1884
148 Ga0105237_10023390 3300009545 Bacteria 6331
149 Ga0105237_10026796 3300009545 Bacteria 5891
150 Ga0105237_10071669 3300009545 Bacteria 3459
151 Ga0105238_10002074 3300009551 Bacteria 20251
152 Ga0105238_10010097 3300009551 Bacteria 9464
153 Ga0105238_10022737 3300009551 Bacteria 6389
154 Ga0105238_10107926 3300009551 Bacteria 2765
155 Ga0105249_10016416 3300009553 Bacteria 6569
156 Ga0105249_10022900 3300009553 Bacteria 5600
157 Ga0105249_10058256 3300009553 Bacteria 3541
158 Ga0105249_10230159 3300009553 Bacteria 1828
159 Ga0105239_10029982 3300010375 Bacteria 5983
160 Ga0105239_10242169 3300010375 Bacteria 2024
161 Ga0157371_10067492 3300013102 Bacteria 2531
162 Ga0157370_10005279 3300013104 Bacteria 14514
163 Ga0157370_10007435 3300013104 Bacteria 11916
164 Ga0157370_10022887 3300013104 Bacteria 6213
165 Ga0157369_10006974 3300013105 Bacteria 13029
166 Ga0157369_10009701 3300013105 Bacteria 11009
167 Ga0157369_10063097 3300013105 Bacteria 3993
168 Ga0157374_10031967 3300013296 Bacteria 4788
169 Ga0157374_10072918 3300013296 Bacteria 3240
170 Ga0157378_10034434 3300013297 Bacteria 4479
171 Ga0157378_10187456 3300013297 Bacteria 1949
172 Ga0163162_10007085 3300013306 Bacteria 10880
173 Ga0163162_10112298 3300013306 Bacteria 2823
174 Ga0163162_10126849 3300013306 Bacteria 2659
175 Ga0157372_10004478 3300013307 Bacteria 14904
176 Ga0157372_10004745 3300013307 Bacteria 14429
177 Ga0157372_10041785 3300013307 Bacteria 5069
178 Ga0157372_10071432 3300013307 Bacteria 3909
179 Ga0157375_10038973 3300013308 Bacteria 4568
180 Ga0157375_10056820 3300013308 Bacteria 3866
181 Ga0163163_10019425 3300014325 Bacteria 6382
182 Ga0157380_10002488 3300014326 Bacteria 12421
183 Ga0157377_10003372 3300014745 Bacteria 7226
184 Ga0157379_10007643 3300014968 Bacteria 9355
185 Ga0157376_10049203 3300014969 Bacteria 3490
186 Ga0157376_10144784 3300014969 Bacteria 2136
187 Ga0163161_10048551 3300017792 Bacteria 3065
188 Ga0207656_10004543 3300025321 Bacteria 4856
189 Ga0207642_10002553 3300025899 Bacteria 5666
190 Ga0207642_10004480 3300025899 Bacteria 4510
191 Ga0207680_10021741 3300025903 Bacteria 3476
192 Ga0207645_10009790 3300025907 Bacteria 6612
193 Ga0207645_10019470 3300025907 Bacteria 4449
194 Ga0207705_10014125 3300025909 Bacteria 5752
195 Ga0207705_10021839 3300025909 Bacteria 4566
196 Ga0207684_10006566 3300025910 Bacteria 10589
197 Ga0207684_10036888 3300025910 Bacteria 4149
198 Ga0207654_10069490 3300025911 Bacteria 2087
199 Ga0207654_10105967 3300025911 Bacteria 1740
200 Ga0207707_10012730 3300025912 Bacteria 7314
201 Ga0207695_10021453 3300025913 Bacteria 7367
202 Ga0207695_10088742 3300025913 Bacteria 3111
203 Ga0207693_10054056 3300025915 Bacteria 3150
204 Ga0207657_10010565 3300025919 Bacteria 9205
205 Ga0207657_10012724 3300025919 Bacteria 8287
206 Ga0207649_10002752 3300025920 Bacteria 9738
207 Ga0207649_10050995 3300025920 Bacteria 2561
208 Ga0207652_10029945 3300025921 Bacteria 4556
209 Ga0207652_10032536 3300025921 Bacteria 4386
210 Ga0207652_10052124 3300025921 Bacteria 3510
211 Ga0207646_10050425 3300025922 Bacteria 3725
212 Ga0207681_10005013 3300025923 Bacteria 8136
213 Ga0207681_10049152 3300025923 Bacteria 2849
214 Ga0207681_10049458 3300025923 Bacteria 2841
215 Ga0207694_10025983 3300025924 Bacteria 4452
216 Ga0207694_10032978 3300025924 Bacteria 3967
217 Ga0207694_10087975 3300025924 Bacteria 2448
218 Ga0207650_10000586 3300025925 Bacteria 29222
219 Ga0207659_10001806 3300025926 Bacteria 12661
220 Ga0207659_10024071 3300025926 Bacteria 4074
221 Ga0207687_10002479 3300025927 Bacteria 12536
222 Ga0207687_10028734 3300025927 Bacteria 3736
223 Ga0207687_10074393 3300025927 Bacteria 2435
224 Ga0207687_10089318 3300025927 Bacteria 2244
225 Ga0207664_10003648 3300025929 Bacteria 10312
226 Ga0207664_10058260 3300025929 Bacteria 3072
227 Ga0207644_10000698 3300025931 Bacteria 21250
228 Ga0207644_10090726 3300025931 Bacteria 2277
229 Ga0207644_10113988 3300025931 Bacteria 2048
230 Ga0207644_10162090 3300025931 Bacteria 1739
231 Ga0207706_10008084 3300025933 Bacteria 9708
232 Ga0207706_10008886 3300025933 Bacteria 9249
233 Ga0207706_10011152 3300025933 Bacteria 8192
234 Ga0207686_10003697 3300025934 Bacteria 8201
235 Ga0207686_10008523 3300025934 Bacteria 5537
236 Ga0207686_10035376 3300025934 Bacteria 2998
237 Ga0207709_10010915 3300025935 Bacteria 5006
238 Ga0207709_10012360 3300025935 Bacteria 4704
239 Ga0207670_10005320 3300025936 Bacteria 7053
240 Ga0207670_10011368 3300025936 Bacteria 5164
241 Ga0207670_10069360 3300025936 Bacteria 2432
242 Ga0207669_10010385 3300025937 Bacteria 4481
243 Ga0207704_10008417 3300025938 Bacteria 4932
244 Ga0207704_10011786 3300025938 Bacteria 4319
245 Ga0207691_10002196 3300025940 Bacteria 19083
246 Ga0207691_10003022 3300025940 Bacteria 16417
247 Ga0207691_10038411 3300025940 Bacteria 4430
248 Ga0207711_10007816 3300025941 Bacteria 8938
249 Ga0207689_10002213 3300025942 Bacteria 18225
250 Ga0207689_10007686 3300025942 Bacteria 9442
251 Ga0207689_10031260 3300025942 Bacteria 4434
252 Ga0207661_10019100 3300025944 Bacteria 5103
253 Ga0207661_10039860 3300025944 Bacteria 3689
254 Ga0207679_10002933 3300025945 Bacteria 10557
255 Ga0207679_10016665 3300025945 Bacteria 4881
256 Ga0207679_10031360 3300025945 Bacteria 3720
257 Ga0207679_10079783 3300025945 Bacteria 2497
258 Ga0207667_10005648 3300025949 Bacteria 15261
259 Ga0207667_10007401 3300025949 Bacteria 13205
260 Ga0207667_10049777 3300025949 Bacteria 4423
261 Ga0207667_10083515 3300025949 Bacteria 3307
262 Ga0207667_10103310 3300025949 Bacteria 2939
263 Ga0207667_10212234 3300025949 Bacteria 1984
264 Ga0207712_10015580 3300025961 Bacteria 4909
265 Ga0207712_10017197 3300025961 Bacteria 4693
266 Ga0207712_10127149 3300025961 Bacteria 1936
267 Ga0207640_10005681 3300025981 Bacteria 6796
268 Ga0207640_10018865 3300025981 Bacteria 4062
269 Ga0207658_10019179 3300025986 Bacteria 4729
270 Ga0207658_10031459 3300025986 Bacteria 3768
271 Ga0207677_10004387 3300026023 Bacteria 7561
272 Ga0207677_10031456 3300026023 Bacteria 3399
273 Ga0207677_10069109 3300026023 Bacteria 2483
274 Ga0207703_10003191 3300026035 Bacteria 13798
275 Ga0207703_10003559 3300026035 Bacteria 13020
276 Ga0207703_10024846 3300026035 Bacteria 4714
277 Ga0207639_10015810 3300026041 Bacteria 5328
278 Ga0207639_10016068 3300026041 Bacteria 5288
279 Ga0207639_10017572 3300026041 Bacteria 5072
280 Ga0207639_10021202 3300026041 Bacteria 4664
281 Ga0207678_10071323 3300026067 Bacteria 2978
282 Ga0207708_10000230 3300026075 Bacteria 44125
283 Ga0207702_10002992 3300026078 Bacteria 15731
284 Ga0207702_10010533 3300026078 Bacteria 7730
285 Ga0207702_10048368 3300026078 Bacteria 3586
286 Ga0207702_10103023 3300026078 Bacteria 2524
287 Ga0207702_10154086 3300026078 Bacteria 2093
288 Ga0207641_10002940 3300026088 Bacteria 15408
289 Ga0207641_10057335 3300026088 Bacteria 3312
290 Ga0207648_10000484 3300026089 Bacteria 44276
291 Ga0207648_10013657 3300026089 Bacteria 7540
292 Ga0207648_10023467 3300026089 Bacteria 5525
293 Ga0207648_10045151 3300026089 Bacteria 3865
294 Ga0207648_10117643 3300026089 Bacteria 2335
295 Ga0207676_10007520 3300026095 Bacteria 7731
296 Ga0207676_10134297 3300026095 Bacteria 2108
297 Ga0207674_10000155 3300026116 Bacteria 80715
298 Ga0207674_10005976 3300026116 Bacteria 14409
299 Ga0207674_10029284 3300026116 Bacteria 5798
300 Ga0207675_100001972 3300026118 Bacteria 20452
301 Ga0207675_100003497 3300026118 Bacteria 15329
302 Ga0207675_100103094 3300026118 Bacteria 2688
303 Ga0207683_10002567 3300026121 Bacteria 15839
304 Ga0207683_10003946 3300026121 Bacteria 12871
305 Ga0207698_10013527 3300026142 Bacteria 5388
306 Ga0207698_10033855 3300026142 Bacteria 3717
307 Ga0207698_10043274 3300026142 Bacteria 3372
308 Ga0207698_10163186 3300026142 Bacteria 1952
309 Ga0209983_1000587 3300027665 Bacteria 7849
310 Ga0209971_1000992 3300027682 Bacteria 7298
311 Ga0209974_10000098 3300027876 Bacteria 24576
312 Ga0207428_10000628 3300027907 Bacteria 41501
313 Ga0207428_10007339 3300027907 Bacteria 10062
314 Ga0207428_10085363 3300027907 Bacteria 2458
315 Ga0268265_10001675 3300028380 Bacteria 18077
316 Ga0268265_10035571 3300028380 Bacteria 3641
317 Ga0268264_10133586 3300028381 Bacteria 2204
318 Ga0307516_10045186 3300031730 Bacteria 4352
319 Ga0307405_10017536 3300031731 Bacteria 3931
320 Ga0307406_10058000 3300031901 Bacteria 2486
321 Ga0307412_10037211 3300031911 Bacteria 3125
322 Ga0307409_100000214 3300031995 Bacteria 23086
323 Ga0307416_100013391 3300032002 Bacteria 5573
324 Ga0307416_100027468 3300032002 Bacteria 4215
325 Ga0307411_10083085 3300032005 Bacteria 2211
326 Ga0307415_100024720 3300032126 Bacteria 3757
327 Ga0373945_0033454 3300035116 Bacteria 1827
328 Ga0373954_0028218 3300035118 Bacteria 2579
329 Ga0373946_0015714 3300035171 Bacteria 2875
330 Ga0373924_0001536 3300035410 Bacteria 7536
331 Ga0373933_0047269 3300035724 Bacteria 2558
332 Ga0373947_0026580 3300035725 Bacteria 3385
333 Ga0373937_0026258 3300036401 Bacteria 5263
334 Ga0373925_0047032 3300037068 Bacteria 3210
335 Ga0453683_0072145 3300044673 Bacteria 2161
336 Ga0453684_0000341 3300044712 Bacteria 194228
337 Ga0453684_0005042 3300044712 Bacteria 26775
338 Ga0451576_0012362 3300045051 Bacteria 9592
339 Ga0451576_0013515 3300045051 Bacteria 9132
340 Ga0451576_0038855 3300045051 Bacteria 5037
341 Ga0495592_0002948 3300046454 Bacteria 12113
342 Ga0495592_0108585 3300046454 Bacteria 1966
343 Ga0495641_0024529 3300046461 Bacteria 2975
344 Ga0495580_0000289 3300046472 Bacteria 40852
345 Ga0495628_0004147 3300046516 Bacteria 12889
346 Ga0495628_0056783 3300046516 Bacteria 3081
347 Ga0495630_0000847 3300046517 Bacteria 21581
348 Ga0495630_0211575 3300046517 Bacteria 1480
349 Ga0495632_0007998 3300046519 Bacteria 6563
350 Ga0495652_0001502 3300046529 Bacteria 25681
351 Ga0495652_0090176 3300046529 Bacteria 2509
352 Ga0495586_0017028 3300046535 Bacteria 3865
353 Ga0495586_0022712 3300046535 Bacteria 3347
354 Ga0495587_0040556 3300046536 Bacteria 2782
355 Ga0495621_0004689 3300046539 Bacteria 3869
356 Ga0495645_0005109 3300046543 Bacteria 8993
357 Ga0495625_0044730 3300046660 Bacteria 3203
358 Ga0495599_0000456 3300046678 Bacteria 23256
359 Ga0495623_0084280 3300046679 Bacteria 1962
360 Ga0495669_0029002 3300046684 Bacteria 2425
361 Ga0495613_0093337 3300046689 Bacteria 2179
362 Ga0495649_0000224 3300046694 Bacteria 49718
363 Ga0495600_0008817 3300046809 Bacteria 6209
364 Ga0495680_0037909 3300047322 Bacteria 3857
365 Ga0495675_0121253 3300047444 Bacteria 1628
366 Ga0495684_0055383 3300047471 Bacteria 3024
367 Ga0495626_0029542 3300048091 Bacteria 2653
368 Ga0496100_0109177 3300048903 Bacteria 1919
369 Ga0496101_0054387 3300048904 Bacteria 2890
370 Ga0496102_0000352 3300048905 Bacteria 55722
371 Ga0496103_0008671 3300048906 Bacteria 6037
372 Ga0496104_0072064 3300048907 Bacteria 3285
373 Ga0496106_0009531 3300048909 Bacteria 7173
374 Ga0496108_0037784 3300048911 Bacteria 4023
375 Ga0496108_0090540 3300048911 Bacteria 2600
376 Ga0496109_0051951 3300048912 Bacteria 3734
377 Ga0496109_0119696 3300048912 Bacteria 2452
378 Ga0496110_0066464 3300048913 Bacteria 3189
379 Ga0496110_0094553 3300048913 Bacteria 2676
380 Ga0496111_0046680 3300048914 Bacteria 3119
381 Ga0496112_0003230 3300048915 Bacteria 13424
382 Ga0496113_0120698 3300048916 Bacteria 2049
383 Ga0496115_0030384 3300048918 Bacteria 4250
384 Ga0501031_0032372 3300049568 Bacteria 3408
385 Ga0501032_0006529 3300049569 Bacteria 8565
386 Ga0501033_0000246 3300049570 Bacteria 52184
387 Ga0501034_0008990 3300049571 Bacteria 10491
388 Ga0501034_0009868 3300049571 Bacteria 9981
389 Ga0501034_0076931 3300049571 Bacteria 3343
390 Ga0501034_0201054 3300049571 Bacteria 1951
391 Ga0501037_0001011 3300049573 Bacteria 20809
392 Ga0501038_0102016 3300049574 Bacteria 2388
393 Ga0501039_0006612 3300049575 Bacteria 8804
394 Ga0501039_0014492 3300049575 Bacteria 6036
395 Ga0501039_0158892 3300049575 Bacteria 1776
396 Ga0501040_0008856 3300049576 Bacteria 6540
397 Ga0501041_0031788 3300049577 Bacteria 3191
398 Ga0501041_0049710 3300049577 Bacteria 2554
399 Ga0501043_0032768 3300049579 Bacteria 4086
400 Ga0501046_0009199 3300049580 Bacteria 8554
401 Ga0501046_0019981 3300049580 Bacteria 5545
402 Ga0501046_0027696 3300049580 Bacteria 4621
403 Ga0501047_0035916 3300049581 Bacteria 4787
404 Ga0501067_0015760 3300049583 Bacteria 4181
405 Ga0501069_0001299 3300049585 Bacteria 12257
406 Ga0501070_0004854 3300049586 Bacteria 11489
407 Ga0501070_0017661 3300049586 Bacteria 5989
408 Ga0501071_0002170 3300049587 Bacteria 11793
409 Ga0501072_0042824 3300049588 Bacteria 3557
410 Ga0501072_0081407 3300049588 Bacteria 2567
411 Ga0501073_0000605 3300049589 Bacteria 25269
412 Ga0501073_0038178 3300049589 Bacteria 3408
413 Ga0501074_0000865 3300049590 Bacteria 19302
414 Ga0501074_0033949 3300049590 Bacteria 3698
415 Ga0501075_0025495 3300049591 Bacteria 4344
416 Ga0501076_0001869 3300049592 Bacteria 14343
417 Ga0501076_0215605 3300049592 Bacteria 1569
418 Ga0501077_0017407 3300049593 Bacteria 4535
419 Ga0501079_0013560 3300049741 Bacteria 6217
420 Ga0501079_0024149 3300049741 Bacteria 4665
421 Ga0501079_0074013 3300049741 Bacteria 2633
422 Ga0501080_0006354 3300049742 Bacteria 10600
423 Ga0501080_0012086 3300049742 Bacteria 7908
424 Ga0501080_0074836 3300049742 Bacteria 3150
425 Ga0501080_0078363 3300049742 Bacteria 3073
426 Ga0501081_0017733 3300049743 Bacteria 4718
427 Ga0501081_0023279 3300049743 Bacteria 4151
428 Ga0501083_0013290 3300049744 Bacteria 5756
429 Ga0501083_0015066 3300049744 Bacteria 5411
430 Ga0501035_0013196 3300049822 Bacteria 7625
431 Ga0501035_0015250 3300049822 Bacteria 7092
432 Ga0501035_0121476 3300049822 Bacteria 2283
433 Ga0501044_0029271 3300049823 Bacteria 5809
434 Ga0501044_0069175 3300049823 Bacteria 3594
435 Ga0501044_0082174 3300049823 Bacteria 3260
436 Ga0501044_0161957 3300049823 Bacteria 2213
437 Ga0501045_0004317 3300049824 Bacteria 9805
438 nmdc:mga0k408_3962_c1 3300050493 Bacteria 7851
439 nmdc:mga07m45_17757_c1 3300050496 Bacteria 3828
440 nmdc:mga05p37_1452_c1 3300050507 Bacteria 27560
441 nmdc:mga09592_301_c1 3300050508 Bacteria 35907
442 nmdc:mga06r32_26997_c1 3300050510 Bacteria 5359
443 nmdc:mga08y16_1492_c1 3300050511 Bacteria 23545
444 nmdc:mga08y16_6386_c1 3300050511 Bacteria 12364
445 nmdc:mga08y16_7256_c1 3300050511 Bacteria 11635
446 nmdc:mga0n895_137209_c1 3300050512 Bacteria 2473
447 nmdc:mga0rr50_20803_c1 3300050513 Bacteria 4465
448 nmdc:mga08x19_7171_c1 3300050514 Bacteria 6623
449 nmdc:mga0a205_184504_c1 3300050515 Bacteria 1980
450 nmdc:mga0a205_35750_c1 3300050515 Bacteria 4771
451 Ga0495595_0015466 3300053084 Bacteria 3255
452 Ga0501084_0011141 3300054114 Bacteria 7448
453 Ga0501084_0021374 3300054114 Bacteria 5393
454 Ga0501082_0006195 3300060353 Bacteria 10380
455 Ga0501082_0017142 3300060353 Bacteria 6239
456 Ga0501082_0079704 3300060353 Bacteria 2825
457 Ga0530510_0001128 3300061734 Bacteria 17750
458 Ga0530510_0035190 3300061734 Bacteria 3608
459 Ga0070679_100013307
460 Ga0070658_10026661
461 Ga0070658_10032995
462 Ga0070676_10009762
463 Ga0070676_10018119
464 Ga0070676_10059119
465 Ga0070683_100016711
466 Ga0070690_100005377
467 Ga0070670_100033287
468 Ga0068869_100002189
469 Ga0068869_100033914
470 Ga0068868_100044770
471 Ga0068868_100092961
472 Ga0068868_100209988
473 Ga0070660_100003730
474 Ga0070689_100010023
475 Ga0070689_100011898
476 Ga0070691_10044793
477 Ga0070661_100007714
478 Ga0070661_100120311
479 Ga0070692_10017520
480 Ga0070669_100021638
481 Ga0070675_100002975
482 Ga0070675_100056625
483 Ga0070671_100004006
484 Ga0070674_100002905
485 Ga0070674_100019899
486 Ga0070688_100016703
487 Ga0070659_100003292
488 Ga0070659_100027265
489 Ga0070667_100013453
490 Ga0070714_100033095
491 Ga0070701_10006428
492 Ga0070700_100001451
493 Ga0070694_100048183
494 Ga0070708_100004822
495 Ga0070663_100007512
496 Ga0070678_100005774
497 Ga0070662_100049364
498 Ga0070681_10007835
499 Ga0070681_10013040
500 Ga0068867_100009509
501 Ga0068867_100027476
502 Ga0070707_100021265
503 Ga0070707_100025863
504 Ga0070698_100022962
505 Ga0070679_100045816
506 Ga0070697_100013922
507 Ga0068853_100007217
508 Ga0068853_100050358
509 Ga0068853_100059094
510 Ga0070672_100001986
511 Ga0070672_100017773
512 Ga0070672_100025234
513 Ga0070686_100001871
514 Ga0070695_100021588
515 Ga0070696_100017187
516 Ga0070693_100000729
517 Ga0070693_100011147
518 Ga0070693_100066144
519 Ga0068855_100004013
520 Ga0068855_100012925
521 Ga0068855_100023590
522 Ga0068855_100028064
523 Ga0070664_100005922
524 Ga0070664_100053351
525 Ga0068857_100010506
526 Ga0068857_100024179
527 Ga0068857_100027759
528 Ga0068854_100011443
529 Ga0068854_100020146
530 Ga0068856_100020444
531 Ga0068856_100026722
532 Ga0068856_100184502
533 Ga0068856_100199118
534 Ga0070702_100000854
535 Ga0070702_100015385
536 Ga0068852_100004636
537 Ga0068852_100016830
538 Ga0068852_100022362
539 Ga0068852_100170695
540 Ga0068852_100199725
541 Ga0068859_100019407
542 Ga0068859_100122085
543 Ga0068864_100051134
544 Ga0068864_100214090
545 Ga0068866_10001619
546 Ga0068866_10005830
547 Ga0068861_100007067
548 Ga0068861_100014421
549 Ga0068861_100150780
550 Ga0068851_10005460
551 Ga0068851_10009226
552 Ga0068870_10013809
553 Ga0068863_100041175
554 Ga0068863_100068382
555 Ga0068858_100009280
556 Ga0068860_100024170
557 Ga0068860_100040284
558 Ga0068860_100144043
559 Ga0068862_100001127
560 Ga0068862_100024775
561 Ga0068862_100044739
562 Ga0075362_10024137
563 Ga0075367_10005177
564 Ga0075370_10018927
565 Ga0068871_100003933
566 Ga0068871_100031169
567 Ga0068871_100065866
568 Ga0075428_100004732
569 Ga0075428_100087520
570 Ga0075430_100056534
571 Ga0075431_100041848
572 Ga0075433_10066145
573 Ga0075429_100020567
574 Ga0075429_100051024
575 Ga0068865_100013708
576 Ga0068865_100016342
577 Ga0075436_100000680
578 Ga0075436_100034828
579 Ga0097620_100019408
580 Ga0097620_100089614
581 Ga0097620_100122083
582 Ga0075435_100019873
583 Ga0105240_10003610
584 Ga0105240_10003662
585 Ga0105240_10004747
586 Ga0105240_10013938
587 Ga0105240_10058153
588 Ga0105240_10256700
589 Ga0111539_10000770
590 Ga0111539_10009287
591 Ga0111539_10019858
592 Ga0111539_10127305
593 Ga0111539_10183157
594 Ga0105245_10011499
595 Ga0105243_10001776
596 Ga0105243_10004141
597 Ga0105243_10099577
598 Ga0105241_10018654
599 Ga0105241_10020025
600 Ga0105242_10003224
601 Ga0105242_10005836
602 Ga0105248_10027727
603 Ga0105248_10054010
604 Ga0105248_10210030
605 Ga0105248_10278168
606 Ga0105237_10023390
607 Ga0105237_10026796
608 Ga0105237_10071669
609 Ga0105238_10002074
610 Ga0105238_10010097
611 Ga0105238_10022737
612 Ga0105238_10107926
613 Ga0105249_10016416
614 Ga0105249_10022900
615 Ga0105249_10058256
616 Ga0105249_10230159
617 Ga0105239_10029982
618 Ga0105239_10242169
619 Ga0157371_10067492
620 Ga0157370_10005279
621 Ga0157370_10007435
622 Ga0157370_10022887
623 Ga0157369_10006974
624 Ga0157369_10009701
625 Ga0157369_10063097
626 Ga0157374_10031967
627 Ga0157374_10072918
628 Ga0157378_10034434
629 Ga0157378_10187456
630 Ga0163162_10007085
631 Ga0163162_10112298
632 Ga0163162_10126849
633 Ga0157372_10004478
634 Ga0157372_10004745
635 Ga0157372_10041785
636 Ga0157372_10071432
637 Ga0157375_10038973
638 Ga0157375_10056820
639 Ga0163163_10019425
640 Ga0157380_10002488
641 Ga0157377_10003372
642 Ga0157379_10007643
643 Ga0157376_10049203
644 Ga0157376_10144784
645 Ga0163161_10048551
646 Ga0207656_10004543
647 Ga0207642_10002553
648 Ga0207642_10004480
649 Ga0207680_10021741
650 Ga0207645_10009790
651 Ga0207645_10019470
652 Ga0207705_10014125
653 Ga0207705_10021839
654 Ga0207684_10006566
655 Ga0207684_10036888
656 Ga0207654_10069490
657 Ga0207654_10105967
658 Ga0207707_10012730
659 Ga0207695_10021453
660 Ga0207695_10088742
661 Ga0207693_10054056
662 Ga0207657_10010565
663 Ga0207657_10012724
664 Ga0207649_10002752
665 Ga0207649_10050995
666 Ga0207652_10029945
667 Ga0207652_10032536
668 Ga0207652_10052124
669 Ga0207646_10050425
670 Ga0207681_10005013
671 Ga0207681_10049152
672 Ga0207681_10049458
673 Ga0207694_10025983
674 Ga0207694_10032978
675 Ga0207694_10087975
676 Ga0207650_10000586
677 Ga0207659_10001806
678 Ga0207659_10024071
679 Ga0207687_10002479
680 Ga0207687_10028734
681 Ga0207687_10074393
682 Ga0207687_10089318
683 Ga0207664_10003648
684 Ga0207664_10058260
685 Ga0207644_10000698
686 Ga0207644_10090726
687 Ga0207644_10113988
688 Ga0207644_10162090
689 Ga0207706_10008084
690 Ga0207706_10008886
691 Ga0207706_10011152
692 Ga0207686_10003697
693 Ga0207686_10008523
694 Ga0207686_10035376
695 Ga0207709_10010915
696 Ga0207709_10012360
697 Ga0207670_10005320
698 Ga0207670_10011368
699 Ga0207670_10069360
700 Ga0207669_10010385
701 Ga0207704_10008417
702 Ga0207704_10011786
703 Ga0207691_10002196
704 Ga0207691_10003022
705 Ga0207691_10038411
706 Ga0207711_10007816
707 Ga0207689_10002213
708 Ga0207689_10007686
709 Ga0207689_10031260
710 Ga0207661_10019100
711 Ga0207661_10039860
712 Ga0207679_10002933
713 Ga0207679_10016665
714 Ga0207679_10031360
715 Ga0207679_10079783
716 Ga0207667_10005648
717 Ga0207667_10007401
718 Ga0207667_10049777
719 Ga0207667_10083515
720 Ga0207667_10103310
721 Ga0207667_10212234
722 Ga0207712_10015580
723 Ga0207712_10017197
724 Ga0207712_10127149
725 Ga0207640_10005681
726 Ga0207640_10018865
727 Ga0207658_10019179
728 Ga0207658_10031459
729 Ga0207677_10004387
730 Ga0207677_10031456
731 Ga0207677_10069109
732 Ga0207703_10003191
733 Ga0207703_10003559
734 Ga0207703_10024846
735 Ga0207639_10015810
736 Ga0207639_10016068
737 Ga0207639_10017572
738 Ga0207639_10021202
739 Ga0207678_10071323
740 Ga0207708_10000230
741 Ga0207702_10002992
742 Ga0207702_10010533
743 Ga0207702_10048368
744 Ga0207702_10103023
745 Ga0207702_10154086
746 Ga0207641_10002940
747 Ga0207641_10057335
748 Ga0207648_10000484
749 Ga0207648_10013657
750 Ga0207648_10023467
751 Ga0207648_10045151
752 Ga0207648_10117643
753 Ga0207676_10007520
754 Ga0207676_10134297
755 Ga0207674_10000155
756 Ga0207674_10005976
757 Ga0207674_10029284
758 Ga0207675_100001972
759 Ga0207675_100003497
760 Ga0207675_100103094
761 Ga0207683_10002567
762 Ga0207683_10003946
763 Ga0207698_10013527
764 Ga0207698_10033855
765 Ga0207698_10043274
766 Ga0207698_10163186
767 Ga0209983_1000587
768 Ga0209971_1000992
769 Ga0209974_10000098
770 Ga0207428_10000628
771 Ga0207428_10007339
772 Ga0207428_10085363
773 Ga0268265_10001675
774 Ga0268265_10035571
775 Ga0268264_10133586
776 Ga0307516_10045186
777 Ga0307405_10017536
778 Ga0307406_10058000
779 Ga0307412_10037211
780 Ga0307409_100000214
781 Ga0307416_100013391
782 Ga0307416_100027468
783 Ga0307411_10083085
784 Ga0307415_100024720
785 Ga0373945_0033454
786 Ga0373954_0028218
787 Ga0373946_0015714
788 Ga0373924_0001536
789 Ga0373933_0047269
790 Ga0373947_0026580
791 Ga0373937_0026258
792 Ga0373925_0047032
793 Ga0453683_0072145
794 Ga0453684_0000341
795 Ga0453684_0005042
796 Ga0451576_0012362
797 Ga0451576_0013515
798 Ga0451576_0038855
799 Ga0495592_0002948
800 Ga0495592_0108585
801 Ga0495641_0024529
802 Ga0495580_0000289
803 Ga0495628_0004147
804 Ga0495628_0056783
805 Ga0495630_0000847
806 Ga0495630_0211575
807 Ga0495632_0007998
808 Ga0495652_0001502
809 Ga0495652_0090176
810 Ga0495586_0017028
811 Ga0495586_0022712
812 Ga0495587_0040556
813 Ga0495621_0004689
814 Ga0495645_0005109
815 Ga0495625_0044730
816 Ga0495599_0000456
817 Ga0495623_0084280
818 Ga0495669_0029002
819 Ga0495613_0093337
820 Ga0495649_0000224
821 Ga0495600_0008817
822 Ga0495680_0037909
823 Ga0495675_0121253
824 Ga0495684_0055383
825 Ga0495626_0029542
826 Ga0496100_0109177
827 Ga0496101_0054387
828 Ga0496102_0000352
829 Ga0496103_0008671
830 Ga0496104_0072064
831 Ga0496106_0009531
832 Ga0496108_0037784
833 Ga0496108_0090540
834 Ga0496109_0051951
835 Ga0496109_0119696
836 Ga0496110_0066464
837 Ga0496110_0094553
838 Ga0496111_0046680
839 Ga0496112_0003230
840 Ga0496113_0120698
841 Ga0496115_0030384
842 Ga0501031_0032372
843 Ga0501032_0006529
844 Ga0501033_0000246
845 Ga0501034_0008990
846 Ga0501034_0009868
847 Ga0501034_0076931
848 Ga0501034_0201054
849 Ga0501037_0001011
850 Ga0501038_0102016
851 Ga0501039_0006612
852 Ga0501039_0014492
853 Ga0501039_0158892
854 Ga0501040_0008856
855 Ga0501041_0031788
856 Ga0501041_0049710
857 Ga0501043_0032768
858 Ga0501046_0009199
859 Ga0501046_0019981
860 Ga0501046_0027696
861 Ga0501047_0035916
862 Ga0501067_0015760
863 Ga0501069_0001299
864 Ga0501070_0004854
865 Ga0501070_0017661
866 Ga0501071_0002170
867 Ga0501072_0042824
868 Ga0501072_0081407
869 Ga0501073_0000605
870 Ga0501073_0038178
871 Ga0501074_0000865
872 Ga0501074_0033949
873 Ga0501075_0025495
874 Ga0501076_0001869
875 Ga0501076_0215605
876 Ga0501077_0017407
877 Ga0501079_0013560
878 Ga0501079_0024149
879 Ga0501079_0074013
880 Ga0501080_0006354
881 Ga0501080_0012086
882 Ga0501080_0074836
883 Ga0501080_0078363
884 Ga0501081_0017733
885 Ga0501081_0023279
886 Ga0501083_0013290
887 Ga0501083_0015066
888 Ga0501035_0013196
889 Ga0501035_0015250
890 Ga0501035_0121476
891 Ga0501044_0029271
892 Ga0501044_0069175
893 Ga0501044_0082174
894 Ga0501044_0161957
895 Ga0501045_0004317
896 nmdc:mga0k408_3962_c1
897 nmdc:mga07m45_17757_c1
898 nmdc:mga05p37_1452_c1
899 nmdc:mga09592_301_c1
900 nmdc:mga06r32_26997_c1
901 nmdc:mga08y16_1492_c1
902 nmdc:mga08y16_6386_c1
903 nmdc:mga08y16_7256_c1
904 nmdc:mga0n895_137209_c1
905 nmdc:mga0rr50_20803_c1
906 nmdc:mga08x19_7171_c1
907 nmdc:mga0a205_184504_c1
908 nmdc:mga0a205_35750_c1
909 Ga0495595_0015466
910 Ga0501084_0011141
911 Ga0501084_0021374
912 Ga0501082_0006195
913 Ga0501082_0017142
914 Ga0501082_0079704
915 Ga0530510_0001128
916 Ga0530510_0035190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

448

536

0.91

PF07731

Cu-oxidase_2

Multicopper oxidase

162

273

0.87

PF07732

Cu-oxidase_3

Multicopper oxidase

150

274

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cp5-assembly1.cif.gz_A cytochrome c from rhodothermus marinus 0.9647 389 480
6cuk-assembly1.cif.gz_A engineered cytochrome c from rhodothermus marinus, rma tde 0.9429 389 481
6cun-assembly1.cif.gz_A engineered cytochrome c from rhodothermus marinus (rma tde) bound to carbene intermediate (1-ethoxy-1-oxopropan-2-ylidene) 0.9265 389 481
6hbe-assembly1.cif.gz_B cu-containing nitrite reductase (nirk) from thermus scotoductus sa-01 0.9223 85 364
1kbw-assembly2.cif.gz_F crystal structure of the soluble domain of ania from neisseria gonorrhoeae 0.9021 64 368
ID Description Score Start End Superfamily
6cunA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9265 389 481 1.10.760.10
3gdcB02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9177 216 364 2.60.40.420
3gdcB02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.9042 216 364 2.60.40.420
5ue6F02 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.8834 216 367 2.60.40.420
2l4dA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8792 393 480 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A2D6XML9-F1-model_v4 Cytochrome c domain-containing protein 0.9873 393 480 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A6N8HS06-F1-model_v4 Nitrite reductase (NO-forming) (EC 1.7.2.1) 0.9785 270 366 GO:0005507
GO:0050421
AF-A0A1V9FQY6-F1-model_v4 Copper-containing nitrite reductase (EC 1.7.2.1) (Cu-NIR) 0.9668 45 364 GO:0005507
GO:0042128
GO:0042597
GO:0050421
AF-A0A349M059-F1-model_v4 Copper-containing nitrite reductase (EC 1.7.2.1) 0.9648 70 366 GO:0005507
GO:0016020
GO:0050421
AF-A0A7V9MTH3-F1-model_v4 Nitrite reductase 0.9612 284 360

Map