F448095

General Info

Members Datasets Scaffolds Average Seq Length
457 279 914 273

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2524023228|2524537242
Length 289
Sequence TTRIEAIGSTREGNMMKAIGLAILFWVVAALPQAYAQPANSGVERLYILNCGEGVAGDISRWSPGVNEGKSMDFVDNCYLIKHAQGWFLWDTGIPDAVAEMPNGLAPADPKAVTWRRPKTLAAQLDQLGVKPSDIKAIAVSHTHPDHIGNVELFPAAMLYVQKAEYEWPGTNNAPRFKPEHPATKLEGDRDVFGDGSVTILSTPGHTPGHQSLLVKLPKAGAVVLTGDAVHFKDNWDNRRVPSLNASKDQTLASMQKIADTLTKEKAQLWINHDKAQRDGLKMSPDFYD

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
104 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
118 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
157 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
172 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
186 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
187 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
220 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
232 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
235 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
236 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
237 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
238 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
239 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
240 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
241 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
242 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
243 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
244 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
245 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
246 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
247 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
248 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
249 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
250 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
251 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
252 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
253 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
254 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
255 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
256 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
257 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
258 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
259 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
260 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
261 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
262 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
263 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
264 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
265 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
266 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
267 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
268 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
269 2922425934
270 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
271 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
272 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
273 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
274 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
275 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
276 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
277 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
278 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
279 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.01
Metatranscriptomes 0
Isolates 8.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.91
Nodule 6.78
Rhizoplane 2.84
Rhizosphere 73.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001995 3300003215 Bacteria 12060
2 JGI25153J46596_10021221 3300003215 Bacteria 2427
3 rootH2_10187390 3300003320 Bacteria 1517
4 rootL2_10033638 3300003322 Bacteria 1755
5 JGI25404J52841_10028184 3300003659 Bacteria 1206
6 Ga0055539_1008920 3300003752 Bacteria 1249
7 Ga0070658_10047125 3300005327 Bacteria 3488
8 Ga0070658_10072546 3300005327 Bacteria 2822
9 Ga0070683_100005765 3300005329 Bacteria 10351
10 Ga0070683_100016256 3300005329 Bacteria 6558
11 Ga0070683_100029306 3300005329 Bacteria 4981
12 Ga0070680_100026127 3300005336 Bacteria 4669
13 Ga0070680_100082312 3300005336 Bacteria 2656
14 Ga0070660_100498852 3300005339 Bacteria 1013
15 Ga0070691_10247292 3300005341 Bacteria 955
16 Ga0070661_100039964 3300005344 Bacteria 3420
17 Ga0070668_100109318 3300005347 Bacteria 2200
18 Ga0070668_100295105 3300005347 Bacteria 1358
19 Ga0070688_100299206 3300005365 Bacteria 1162
20 Ga0070659_100109069 3300005366 Bacteria 2233
21 Ga0070659_100270489 3300005366 Bacteria 1412
22 Ga0070709_10002023 3300005434 Bacteria 11016
23 Ga0070709_10021780 3300005434 Bacteria 3739
24 Ga0070709_10056170 3300005434 Bacteria 2488
25 Ga0070709_10237437 3300005434 Bacteria 1307
26 Ga0070714_100020038 3300005435 Bacteria 5457
27 Ga0070714_100022025 3300005435 Bacteria 5222
28 Ga0070714_100093767 3300005435 Bacteria 2634
29 Ga0070714_100125692 3300005435 Bacteria 2286
30 Ga0070714_100171456 3300005435 Bacteria 1969
31 Ga0070713_100003139 3300005436 Bacteria 10877
32 Ga0070713_100022743 3300005436 Bacteria 4849
33 Ga0070713_100146098 3300005436 Bacteria 2099
34 Ga0070713_100411537 3300005436 Bacteria 1264
35 Ga0070710_10001323 3300005437 Bacteria 11692
36 Ga0070710_10098580 3300005437 Bacteria 1736
37 Ga0070711_100007078 3300005439 Bacteria 6802
38 Ga0070711_100029629 3300005439 Bacteria 3614
39 Ga0070711_100093081 3300005439 Bacteria 2176
40 Ga0070700_100258246 3300005441 Bacteria 1253
41 Ga0070708_100259114 3300005445 Bacteria 1635
42 Ga0070678_100373493 3300005456 Bacteria 1232
43 Ga0070681_10043877 3300005458 Bacteria 4476
44 Ga0070681_10106413 3300005458 Bacteria 2746
45 Ga0070681_10183187 3300005458 Bacteria 2015
46 Ga0070707_100082190 3300005468 Bacteria 3111
47 Ga0070679_100035777 3300005530 Bacteria 4926
48 Ga0070679_100420384 3300005530 Bacteria 1282
49 Ga0070684_100003703 3300005535 Bacteria 11534
50 Ga0070684_100095163 3300005535 Bacteria 2653
51 Ga0068853_100023457 3300005539 Bacteria 5166
52 Ga0070704_100222379 3300005549 Bacteria 1536
53 Ga0068855_100026226 3300005563 Bacteria 6972
54 Ga0068855_100256865 3300005563 Bacteria 1948
55 Ga0068855_100326254 3300005563 Bacteria 1695
56 Ga0068857_100044634 3300005577 Bacteria 3932
57 Ga0068857_100197947 3300005577 Bacteria 1831
58 Ga0068856_100230659 3300005614 Bacteria 1867
59 Ga0068852_100002844 3300005616 Bacteria 12008
60 Ga0068852_100186139 3300005616 Bacteria 1956
61 Ga0068861_100119526 3300005719 Bacteria 2124
62 Ga0068860_100000268 3300005843 Bacteria 76328
63 Ga0081455_10034215 3300005937 Bacteria 4555
64 Ga0081455_10057785 3300005937 Bacteria 3286
65 Ga0081540_1000977 3300005983 Bacteria 25775
66 Ga0081540_1058303 3300005983 Bacteria 1861
67 Ga0081540_1067829 3300005983 Bacteria 1665
68 Ga0081539_10042467 3300005985 Bacteria 2648
69 Ga0070717_10002237 3300006028 Bacteria 13562
70 Ga0070717_10004228 3300006028 Bacteria 10350
71 Ga0070717_10072901 3300006028 Bacteria 2868
72 Ga0070717_10237746 3300006028 Bacteria 1605
73 Ga0075368_10013504 3300006042 Bacteria 3001
74 Ga0075363_100041109 3300006048 Bacteria 2438
75 Ga0070715_10016740 3300006163 Bacteria 2761
76 Ga0070716_100001437 3300006173 Bacteria 10586
77 Ga0070716_100077383 3300006173 Bacteria 1974
78 Ga0070716_100122994 3300006173 Bacteria 1627
79 Ga0070712_100016326 3300006175 Bacteria 4796
80 Ga0070712_100214165 3300006175 Bacteria 1521
81 Ga0075362_10051338 3300006177 Bacteria 1845
82 Ga0097621_100109937 3300006237 Bacteria 2329
83 Ga0075431_100169772 3300006847 Bacteria 2242
84 Ga0099794_10001296 3300007265 Bacteria 8678
85 Ga0105240_10060220 3300009093 Bacteria 4734
86 Ga0105240_10079783 3300009093 Bacteria 4027
87 Ga0105240_10209228 3300009093 Bacteria 2281
88 Ga0105247_10099074 3300009101 Bacteria 1861
89 Ga0114129_10176644 3300009147 Bacteria 2909
90 Ga0105243_10137480 3300009148 Bacteria 2081
91 Ga0105237_10088965 3300009545 Bacteria 3077
92 Ga0105237_10185794 3300009545 Bacteria 2078
93 Ga0105238_10112467 3300009551 Bacteria 2702
94 Ga0105238_10419615 3300009551 Bacteria 1333
95 Ga0105249_10236400 3300009553 Bacteria 1804
96 Ga0105249_10925424 3300009553 Bacteria 939
97 Ga0099796_10004691 3300010159 Bacteria 3336
98 Ga0105239_10077070 3300010375 Bacteria 3668
99 Ga0105239_10080541 3300010375 Bacteria 3583
100 Ga0105239_10318459 3300010375 Bacteria 1753
101 Ga0157370_10240576 3300013104 Bacteria 1675
102 Ga0157369_10021083 3300013105 Bacteria 7284
103 Ga0157369_10144689 3300013105 Bacteria 2514
104 Ga0157369_10213610 3300013105 Bacteria 2021
105 Ga0157374_10459603 3300013296 Bacteria 1275
106 Ga0163162_10100855 3300013306 Bacteria 2978
107 Ga0157375_10539352 3300013308 Bacteria 1329
108 Ga0163163_10081713 3300014325 Bacteria 3234
109 Ga0157380_10206451 3300014326 Bacteria 1747
110 Ga0157379_10218122 3300014968 Bacteria 1728
111 Ga0157376_10041062 3300014969 Bacteria 3785
112 Ga0163161_10199791 3300017792 Bacteria 1540
113 Ga0213873_10005370 3300021358 Bacteria 2455
114 Ga0213876_10012821 3300021384 Bacteria 4456
115 Ga0209677_106197 3300025253 Bacteria 2903
116 Ga0209233_1010263 3300025261 Bacteria 2817
117 Ga0209455_1008246 3300025272 Bacteria 2849
118 Ga0209455_1016906 3300025272 Bacteria 1549
119 Ga0209564_1013867 3300025295 Bacteria 3391
120 Ga0209564_1017782 3300025295 Bacteria 2747
121 Ga0209758_1007398 3300025297 Bacteria 7495
122 Ga0207692_10000237 3300025898 Bacteria 18663
123 Ga0207692_10002859 3300025898 Bacteria 6679
124 Ga0207710_10051489 3300025900 Bacteria 1849
125 Ga0207699_10000991 3300025906 Bacteria 13498
126 Ga0207699_10001394 3300025906 Bacteria 11484
127 Ga0207699_10241338 3300025906 Bacteria 1241
128 Ga0207699_10247837 3300025906 Bacteria 1226
129 Ga0207705_10207017 3300025909 Bacteria 1487
130 Ga0207707_10018839 3300025912 Bacteria 6020
131 Ga0207707_10041469 3300025912 Bacteria 4020
132 Ga0207695_10055986 3300025913 Bacteria 4106
133 Ga0207695_10077531 3300025913 Bacteria 3375
134 Ga0207695_10249257 3300025913 Bacteria 1675
135 Ga0207671_10265357 3300025914 Bacteria 1352
136 Ga0207671_10366673 3300025914 Bacteria 1144
137 Ga0207693_10000606 3300025915 Bacteria 32081
138 Ga0207693_10182272 3300025915 Bacteria 1653
139 Ga0207663_10002328 3300025916 Bacteria 9118
140 Ga0207663_10004942 3300025916 Bacteria 6678
141 Ga0207663_10019934 3300025916 Bacteria 3789
142 Ga0207660_10035504 3300025917 Bacteria 3462
143 Ga0207660_10103824 3300025917 Bacteria 2127
144 Ga0207660_10110989 3300025917 Bacteria 2064
145 Ga0207657_10495263 3300025919 Bacteria 957
146 Ga0207649_10048520 3300025920 Bacteria 2619
147 Ga0207652_10037483 3300025921 Bacteria 4104
148 Ga0207652_10091230 3300025921 Bacteria 2679
149 Ga0207652_10189045 3300025921 Bacteria 1852
150 Ga0207646_10070953 3300025922 Bacteria 3111
151 Ga0207700_10011541 3300025928 Bacteria 5640
152 Ga0207700_10012967 3300025928 Bacteria 5400
153 Ga0207700_10021794 3300025928 Bacteria 4382
154 Ga0207700_10062322 3300025928 Bacteria 2832
155 Ga0207664_10033293 3300025929 Bacteria 3958
156 Ga0207664_10047077 3300025929 Bacteria 3387
157 Ga0207664_10146597 3300025929 Bacteria 2002
158 Ga0207690_10427673 3300025932 Bacteria 1060
159 Ga0207665_10000599 3300025939 Bacteria 24202
160 Ga0207665_10013251 3300025939 Bacteria 5420
161 Ga0207665_10080022 3300025939 Bacteria 2247
162 Ga0207661_10006180 3300025944 Bacteria 8464
163 Ga0207661_10030847 3300025944 Bacteria 4133
164 Ga0207679_10211389 3300025945 Bacteria 1627
165 Ga0207667_10230182 3300025949 Bacteria 1898
166 Ga0207712_10077922 3300025961 Bacteria 2403
167 Ga0207703_10456175 3300026035 Bacteria 1195
168 Ga0207639_10149715 3300026041 Bacteria 1953
169 Ga0207708_10437297 3300026075 Bacteria 1087
170 Ga0207702_10187599 3300026078 Bacteria 1908
171 Ga0207702_10594692 3300026078 Bacteria 1085
172 Ga0207676_10571227 3300026095 Bacteria 1083
173 Ga0207674_10081437 3300026116 Bacteria 3239
174 Ga0207674_10218947 3300026116 Bacteria 1852
175 Ga0207675_100443036 3300026118 Bacteria 1286
176 Ga0209389_1000084 3300027296 Bacteria 85267
177 Ga0209589_1000041 3300027357 Bacteria 125191
178 Ga0209489_100070 3300027361 Bacteria 138580
179 Ga0209588_1022032 3300027671 Bacteria 2004
180 Ga0268266_10269609 3300028379 Bacteria 1580
181 Ga0268264_10000233 3300028381 Bacteria 106118
182 Ga0265332_10045301 3300031238 Bacteria 1896
183 Ga0265325_10013019 3300031241 Bacteria 4744
184 Ga0265325_10039529 3300031241 Bacteria 2484
185 Ga0265340_10024566 3300031247 Bacteria 3059
186 Ga0265339_10026091 3300031249 Bacteria 3349
187 Ga0265339_10078878 3300031249 Bacteria 1743
188 Ga0265331_10022693 3300031250 Bacteria 3200
189 Ga0265331_10072055 3300031250 Bacteria 1615
190 Ga0265316_10063516 3300031344 Bacteria 2863
191 Ga0307509_10022837 3300031507 Bacteria 7038
192 Ga0307508_10272089 3300031616 Bacteria 1288
193 Ga0265342_10008968 3300031712 Bacteria 7103
194 Ga0265342_10070381 3300031712 Bacteria 2041
195 Ga0307516_10004439 3300031730 Bacteria 17302
196 Ga0307516_10049732 3300031730 Bacteria 4117
197 Ga0307510_10124007 3300033180 Bacteria 2278
198 Ga0307510_10183924 3300033180 Bacteria 1648
199 Ga0315911_1000029 3300033442 Bacteria 82350
200 Ga0373934_0011530 3300035086 Bacteria 3325
201 Ga0373934_0090521 3300035086 Bacteria 1233
202 Ga0373923_0011563 3300035111 Bacteria 3242
203 Ga0373936_0005149 3300035113 Bacteria 4923
204 Ga0373953_0126847 3300035117 Bacteria 1086
205 Ga0373954_0024247 3300035118 Bacteria 2765
206 Ga0373956_0001864 3300035119 Bacteria 8692
207 Ga0373956_0045160 3300035119 Bacteria 1965
208 Ga0373957_0033319 3300035120 Bacteria 1902
209 Ga0373943_0006048 3300035170 Bacteria 5434
210 Ga0373943_0015294 3300035170 Bacteria 3484
211 Ga0373946_0007983 3300035171 Bacteria 3888
212 Ga0373955_0053603 3300035172 Bacteria 2202
213 Ga0373924_0030986 3300035410 Bacteria 2147
214 Ga0373935_0002358 3300035692 Bacteria 10792
215 Ga0373935_0059464 3300035692 Bacteria 2443
216 Ga0373935_0081588 3300035692 Bacteria 2103
217 Ga0373935_0218582 3300035692 Bacteria 1323
218 Ga0373927_0004777 3300035695 Bacteria 9437
219 Ga0373927_0036233 3300035695 Bacteria 3209
220 Ga0373927_0047835 3300035695 Bacteria 2766
221 Ga0373927_0054417 3300035695 Bacteria 2589
222 Ga0373927_0097392 3300035695 Bacteria 1912
223 Ga0373933_0034880 3300035724 Bacteria 2935
224 Ga0373933_0127518 3300035724 Bacteria 1597
225 Ga0373947_0004058 3300035725 Bacteria 8615
226 Ga0373947_0042176 3300035725 Bacteria 2723
227 Ga0373937_0026114 3300036401 Bacteria 5277
228 Ga0373937_0050396 3300036401 Bacteria 3813
229 Ga0373937_0087410 3300036401 Bacteria 2885
230 Ga0373925_0002066 3300037068 Bacteria 16547
231 Ga0373925_0025959 3300037068 Bacteria 4283
232 Ga0373925_0071569 3300037068 Bacteria 2623
233 Ga0373925_0207546 3300037068 Bacteria 1560
234 Ga0395900_0002015 3300037418 Bacteria 22873
235 Ga0395900_0316807 3300037418 Bacteria 1541
236 Ga0395898_0340258 3300037466 Bacteria 1431
237 Ga0395898_0712315 3300037466 Bacteria 945
238 Ga0395905_0031203 3300037471 Bacteria 5018
239 Ga0395905_0089124 3300037471 Bacteria 2891
240 Ga0395905_0487632 3300037471 Bacteria 1132
241 Ga0395905_0644582 3300037471 Bacteria 961
242 Ga0395901_0028021 3300038443 Bacteria 5793
243 Ga0395901_0445318 3300038443 Bacteria 1325
244 Ga0436365_0273120 3300039437 Bacteria 6795
245 Ga0436365_1620143 3300039437 Bacteria 1898
246 Ga0436361_0242400 3300039447 Bacteria 3265
247 Ga0436363_0528678 3300039450 Bacteria 1372
248 Ga0436362_0344570 3300039453 Bacteria 4671
249 Ga0466969_0010749 3300044656 Bacteria 4850
250 Ga0466972_0030816 3300044658 Bacteria 2640
251 Ga0466972_0050634 3300044658 Bacteria 2004
252 Ga0466966_0001701 3300044684 Bacteria 14207
253 Ga0466966_0048119 3300044684 Bacteria 2717
254 Ga0466961_0000064 3300044693 Bacteria 63553
255 Ga0466963_0026183 3300044694 Bacteria 3729
256 Ga0466960_0011447 3300044901 Bacteria 3712
257 Ga0466959_0004925 3300045049 Bacteria 9043
258 Ga0495592_0002985 3300046454 Bacteria 12039
259 Ga0495592_0003384 3300046454 Bacteria 11438
260 Ga0495592_0023387 3300046454 Bacteria 4699
261 Ga0495592_0054833 3300046454 Bacteria 2951
262 Ga0495603_0000788 3300046455 Bacteria 18071
263 Ga0495629_0000461 3300046459 Bacteria 34016
264 Ga0495629_0000581 3300046459 Bacteria 29697
265 Ga0495638_0001893 3300046460 Bacteria 18076
266 Ga0495641_0001433 3300046461 Bacteria 20263
267 Ga0495651_0023179 3300046462 Bacteria 4827
268 Ga0495651_0031990 3300046462 Bacteria 4103
269 Ga0495653_0010501 3300046463 Bacteria 7579
270 Ga0495580_0001585 3300046472 Bacteria 19968
271 Ga0495580_0207761 3300046472 Bacteria 1348
272 Ga0495582_0000199 3300046473 Bacteria 33381
273 Ga0495639_0000044 3300046475 Bacteria 55019
274 Ga0495662_0003017 3300046476 Bacteria 8492
275 Ga0495662_0038046 3300046476 Bacteria 2325
276 Ga0495662_0070803 3300046476 Bacteria 1690
277 Ga0495664_0039113 3300046477 Bacteria 2802
278 Ga0495664_0057170 3300046477 Bacteria 2320
279 Ga0495664_0249244 3300046477 Bacteria 1074
280 Ga0495594_0000306 3300046499 Bacteria 24070
281 Ga0495606_0014668 3300046507 Bacteria 6095
282 Ga0495608_0002317 3300046511 Bacteria 13740
283 Ga0495608_0302152 3300046511 Bacteria 990
284 Ga0495618_0052970 3300046514 Bacteria 2566
285 Ga0495618_0087857 3300046514 Bacteria 1988
286 Ga0495628_0011633 3300046516 Bacteria 7438
287 Ga0495628_0067225 3300046516 Bacteria 2799
288 Ga0495628_0094423 3300046516 Bacteria 2312
289 Ga0495630_0011706 3300046517 Bacteria 6356
290 Ga0495648_0018917 3300046524 Bacteria 4860
291 Ga0495666_0057435 3300046526 Bacteria 1863
292 Ga0495666_0213515 3300046526 Bacteria 885
293 Ga0495652_0028651 3300046529 Bacteria 4898
294 Ga0495652_0059658 3300046529 Bacteria 3227
295 Ga0495652_0116112 3300046529 Bacteria 2143
296 Ga0495665_0000422 3300046531 Bacteria 21595
297 Ga0495640_0003381 3300046533 Bacteria 12844
298 Ga0495640_0009524 3300046533 Bacteria 7559
299 Ga0495640_0060458 3300046533 Bacteria 2577
300 Ga0495640_0169481 3300046533 Bacteria 1395
301 Ga0495587_0018935 3300046536 Bacteria 4266
302 Ga0495587_0028829 3300046536 Bacteria 3373
303 Ga0495645_0050020 3300046543 Bacteria 3043
304 Ga0495622_0018933 3300046557 Bacteria 3208
305 Ga0495622_0048564 3300046557 Bacteria 1972
306 Ga0495667_0004993 3300046559 Bacteria 8968
307 Ga0495634_0000252 3300046642 Bacteria 50709
308 Ga0495634_0010015 3300046642 Bacteria 6958
309 Ga0495634_0010254 3300046642 Bacteria 6864
310 Ga0495634_0110676 3300046642 Bacteria 1766
311 Ga0495634_0133427 3300046642 Bacteria 1581
312 Ga0495635_0000251 3300046663 Bacteria 34185
313 Ga0495635_0010428 3300046663 Bacteria 6500
314 Ga0495588_0024009 3300046674 Bacteria 3025
315 Ga0495657_0019465 3300046675 Bacteria 4895
316 Ga0495599_0007216 3300046678 Bacteria 6733
317 Ga0495599_0081057 3300046678 Bacteria 2027
318 Ga0495623_0027284 3300046679 Bacteria 3673
319 Ga0495623_0042656 3300046679 Bacteria 2889
320 Ga0495623_0097787 3300046679 Bacteria 1792
321 Ga0495646_0003123 3300046680 Bacteria 10272
322 Ga0495646_0024372 3300046680 Bacteria 3810
323 Ga0495646_0057882 3300046680 Bacteria 2318
324 Ga0495658_0000891 3300046683 Bacteria 16049
325 Ga0495669_0192592 3300046684 Bacteria 973
326 Ga0495613_0024707 3300046689 Bacteria 4476
327 Ga0495613_0186368 3300046689 Bacteria 1468
328 Ga0495624_0000832 3300046690 Bacteria 24417
329 Ga0495624_0007046 3300046690 Bacteria 7920
330 Ga0495649_0092060 3300046694 Bacteria 1615
331 Ga0495600_0046870 3300046809 Bacteria 2819
332 Ga0495600_0069488 3300046809 Bacteria 2302
333 Ga0495581_0002344 3300047315 Bacteria 10678
334 Ga0495581_0223280 3300047315 Bacteria 1102
335 Ga0495604_0132927 3300047317 Bacteria 1786
336 Ga0495674_0006258 3300047319 Bacteria 11421
337 Ga0495674_0021811 3300047319 Bacteria 5918
338 Ga0495674_0069734 3300047319 Bacteria 3039
339 Ga0495674_0151473 3300047319 Bacteria 1944
340 Ga0495680_0004040 3300047322 Bacteria 14143
341 Ga0495680_0081575 3300047322 Bacteria 2441
342 Ga0495675_0006004 3300047444 Bacteria 7426
343 Ga0495675_0022058 3300047444 Bacteria 4058
344 Ga0495673_0041257 3300047469 Bacteria 2078
345 Ga0495684_0004175 3300047471 Bacteria 11280
346 Ga0495684_0030188 3300047471 Bacteria 4161
347 Ga0495684_0123547 3300047471 Bacteria 1948
348 Ga0495593_0000353 3300047673 Bacteria 25428
349 Ga0495602_0128663 3300048088 Bacteria 2023
350 Ga0495602_0152087 3300048088 Bacteria 1817
351 Ga0496101_0111931 3300048904 Bacteria 2056
352 Ga0496102_0121083 3300048905 Bacteria 2444
353 Ga0496102_0149065 3300048905 Bacteria 2197
354 Ga0496104_0061196 3300048907 Bacteria 3569
355 Ga0496105_0087984 3300048908 Bacteria 2566
356 Ga0496106_0001736 3300048909 Bacteria 16280
357 Ga0496106_0322966 3300048909 Bacteria 1239
358 Ga0496107_0102003 3300048910 Bacteria 2104
359 Ga0496107_0442727 3300048910 Bacteria 965
360 Ga0496108_0564661 3300048911 Bacteria 992
361 Ga0496112_0052435 3300048915 Bacteria 4003
362 Ga0496113_0078140 3300048916 Bacteria 2532
363 Ga0496117_0047871 3300048920 Bacteria 3061
364 Ga0496117_0079443 3300048920 Bacteria 2161
365 Ga0496118_0003606 3300048921 Bacteria 19246
366 Ga0496118_0050463 3300048921 Bacteria 3192
367 Ga0496118_0096188 3300048921 Bacteria 2019
368 Ga0496119_0065203 3300048922 Bacteria 2158
369 Ga0496121_0000398 3300048924 Bacteria 87272
370 Ga0496121_0084512 3300048924 Bacteria 2502
371 Ga0496121_0190990 3300048924 Bacteria 1468
372 Ga0496121_0257077 3300048924 Bacteria 1208
373 Ga0496122_0036477 3300048925 Bacteria 3974
374 Ga0496124_0000524 3300048927 Bacteria 65208
375 Ga0496125_0072662 3300048928 Bacteria 2679
376 Ga0496125_0082204 3300048928 Bacteria 2456
377 Ga0496125_0114897 3300048928 Bacteria 1938
378 Ga0496126_0014187 3300048929 Bacteria 8064
379 Ga0496126_0032376 3300048929 Bacteria 4926
380 Ga0496126_0055303 3300048929 Bacteria 3591
381 Ga0496126_0074015 3300048929 Bacteria 3026
382 Ga0496126_0103757 3300048929 Bacteria 2484
383 Ga0496126_0127571 3300048929 Bacteria 2201
384 Ga0496126_0178572 3300048929 Bacteria 1805
385 Ga0496126_0207910 3300048929 Bacteria 1649
386 Ga0496126_0354276 3300048929 Bacteria 1200
387 Ga0496126_0410702 3300048929 Bacteria 1096
388 nmdc:mga0yw44_203317_c1 3300050492 Bacteria 1308
389 nmdc:mga06z11_276442_c1 3300050494 Bacteria 994
390 nmdc:mga06z11_43867_c1 3300050494 Bacteria 2253
391 nmdc:mga07m45_81846_c1 3300050496 Bacteria 1844
392 nmdc:mga06r32_157411_c1 3300050510 Bacteria 2253
393 nmdc:mga0n895_1023394_c1 3300050512 Bacteria 806
394 nmdc:mga0n895_16437_c1 3300050512 Bacteria 6790
395 nmdc:mga0n895_911415_c1 3300050512 Bacteria 864
396 nmdc:mga0rr50_97211_c1 3300050513 Bacteria 2305
397 Ga0495601_0028301 3300053077 Bacteria 3471
398 Ga0495601_0157063 3300053077 Bacteria 1485
399 Ga0495601_0195384 3300053077 Bacteria 1322
400 Ga0495612_0037293 3300053078 Bacteria 1974
401 Ga0495612_0040873 3300053078 Bacteria 1890
402 Ga0495612_0096648 3300053078 Bacteria 1255
403 Ga0500635_0088804 3300053080 Bacteria 1121
404 Ga0495595_0039324 3300053084 Bacteria 2157
405 Ga0495595_0039526 3300053084 Bacteria 2152
406 Ga0495619_0001922 3300053085 Bacteria 13848
407 Ga0500641_0002024 3300053096 Bacteria 7199
408 Ga0500595_009907 3300053119 Bacteria 3817
409 Ga0500597_061453 3300053120 Bacteria 1615
410 Ga0500559_0000274 3300053136 Bacteria 39917
411 Ga0500559_0071856 3300053136 Bacteria 1559
412 Ga0500590_097720 3300053148 Bacteria 1415
413 Ga0500603_000185 3300053150 Bacteria 16153
414 Ga0500637_0188559 3300053178 Bacteria 1179
415 Ga0500576_030113 3300053725 Bacteria 2470
416 2524537242 2524023228 Bacteria 10118060
417 2511393443 2511231028 Bacteria 8046582
418 2513656537 2513237096 Bacteria 8722461
419 2513676783 2513237098 Bacteria 9902361
420 2513717552 2513237104 Bacteria 10034502
421 2513859578 2513237137 Bacteria 9558895
422 2513889315 2513237141 Bacteria 8496279
423 2513917722 2513237145 Bacteria 8979722
424 2517106668 2517093001 Bacteria 9002274
425 2517893205 2517572143 Bacteria 9484767
426 2524439765 2524023205 Bacteria 8918781
427 2524471282 2524023210 Bacteria 9029266
428 2671117841 2667528175 Bacteria 7532676
429 2745078929 2744054633 Bacteria 8678936
430 2793069928 2791355197 Bacteria 8420563
431 2841964451 2841957949 Bacteria 8652217
432 2847945708 2847939898 Bacteria 8606328
433 2874627044 2874620515 Bacteria 8290088
434 2876770862 2876761206 Bacteria 10111113
435 2881672139 2881665667 Bacteria 8175609
436 2885374796 2885374607 Bacteria 8927485
437 2885389400 2885383462 Bacteria 9473874
438 2888383135 2888378607 Bacteria 9652610
439 2903755668 2903748898 Bacteria 9972761
440 2903777457 2903768456 Bacteria 9749579
441 2904669745 2904666416 Bacteria 8226587
442 2906635790 2906635258 Bacteria 8601019
443 2906667906 2906660503 Bacteria 8595048
444 2908743596 2908739725 Bacteria 8628932
445 2922367815 2922361189 Bacteria 7436256
446 2922392283 2922386360 Bacteria 7017218
447 2922429278
448 2935634142 2935630451 Bacteria 8169952
449 2941511033 2941507105 Bacteria 8166816
450 2941518417 2941515067 Bacteria 8166720
451 2941527320 2941523033 Bacteria 8169134
452 3005479442 3005474847 Bacteria 9259049
453 8006941708 8006933436 Bacteria 10410654
454 8006981422 8006973647 Bacteria 10679141
455 8019557612 8019555841 Bacteria 9642137
456 8019567686 8019565922 Bacteria 9639779
457 8019657395 8019648815 Bacteria 10014479
458 JGI25153J46596_10001995
459 JGI25153J46596_10021221
460 rootH2_10187390
461 rootL2_10033638
462 JGI25404J52841_10028184
463 Ga0055539_1008920
464 Ga0070658_10047125
465 Ga0070658_10072546
466 Ga0070683_100005765
467 Ga0070683_100016256
468 Ga0070683_100029306
469 Ga0070680_100026127
470 Ga0070680_100082312
471 Ga0070660_100498852
472 Ga0070691_10247292
473 Ga0070661_100039964
474 Ga0070668_100109318
475 Ga0070668_100295105
476 Ga0070688_100299206
477 Ga0070659_100109069
478 Ga0070659_100270489
479 Ga0070709_10002023
480 Ga0070709_10021780
481 Ga0070709_10056170
482 Ga0070709_10237437
483 Ga0070714_100020038
484 Ga0070714_100022025
485 Ga0070714_100093767
486 Ga0070714_100125692
487 Ga0070714_100171456
488 Ga0070713_100003139
489 Ga0070713_100022743
490 Ga0070713_100146098
491 Ga0070713_100411537
492 Ga0070710_10001323
493 Ga0070710_10098580
494 Ga0070711_100007078
495 Ga0070711_100029629
496 Ga0070711_100093081
497 Ga0070700_100258246
498 Ga0070708_100259114
499 Ga0070678_100373493
500 Ga0070681_10043877
501 Ga0070681_10106413
502 Ga0070681_10183187
503 Ga0070707_100082190
504 Ga0070679_100035777
505 Ga0070679_100420384
506 Ga0070684_100003703
507 Ga0070684_100095163
508 Ga0068853_100023457
509 Ga0070704_100222379
510 Ga0068855_100026226
511 Ga0068855_100256865
512 Ga0068855_100326254
513 Ga0068857_100044634
514 Ga0068857_100197947
515 Ga0068856_100230659
516 Ga0068852_100002844
517 Ga0068852_100186139
518 Ga0068861_100119526
519 Ga0068860_100000268
520 Ga0081455_10034215
521 Ga0081455_10057785
522 Ga0081540_1000977
523 Ga0081540_1058303
524 Ga0081540_1067829
525 Ga0081539_10042467
526 Ga0070717_10002237
527 Ga0070717_10004228
528 Ga0070717_10072901
529 Ga0070717_10237746
530 Ga0075368_10013504
531 Ga0075363_100041109
532 Ga0070715_10016740
533 Ga0070716_100001437
534 Ga0070716_100077383
535 Ga0070716_100122994
536 Ga0070712_100016326
537 Ga0070712_100214165
538 Ga0075362_10051338
539 Ga0097621_100109937
540 Ga0075431_100169772
541 Ga0099794_10001296
542 Ga0105240_10060220
543 Ga0105240_10079783
544 Ga0105240_10209228
545 Ga0105247_10099074
546 Ga0114129_10176644
547 Ga0105243_10137480
548 Ga0105237_10088965
549 Ga0105237_10185794
550 Ga0105238_10112467
551 Ga0105238_10419615
552 Ga0105249_10236400
553 Ga0105249_10925424
554 Ga0099796_10004691
555 Ga0105239_10077070
556 Ga0105239_10080541
557 Ga0105239_10318459
558 Ga0157370_10240576
559 Ga0157369_10021083
560 Ga0157369_10144689
561 Ga0157369_10213610
562 Ga0157374_10459603
563 Ga0163162_10100855
564 Ga0157375_10539352
565 Ga0163163_10081713
566 Ga0157380_10206451
567 Ga0157379_10218122
568 Ga0157376_10041062
569 Ga0163161_10199791
570 Ga0213873_10005370
571 Ga0213876_10012821
572 Ga0209677_106197
573 Ga0209233_1010263
574 Ga0209455_1008246
575 Ga0209455_1016906
576 Ga0209564_1013867
577 Ga0209564_1017782
578 Ga0209758_1007398
579 Ga0207692_10000237
580 Ga0207692_10002859
581 Ga0207710_10051489
582 Ga0207699_10000991
583 Ga0207699_10001394
584 Ga0207699_10241338
585 Ga0207699_10247837
586 Ga0207705_10207017
587 Ga0207707_10018839
588 Ga0207707_10041469
589 Ga0207695_10055986
590 Ga0207695_10077531
591 Ga0207695_10249257
592 Ga0207671_10265357
593 Ga0207671_10366673
594 Ga0207693_10000606
595 Ga0207693_10182272
596 Ga0207663_10002328
597 Ga0207663_10004942
598 Ga0207663_10019934
599 Ga0207660_10035504
600 Ga0207660_10103824
601 Ga0207660_10110989
602 Ga0207657_10495263
603 Ga0207649_10048520
604 Ga0207652_10037483
605 Ga0207652_10091230
606 Ga0207652_10189045
607 Ga0207646_10070953
608 Ga0207700_10011541
609 Ga0207700_10012967
610 Ga0207700_10021794
611 Ga0207700_10062322
612 Ga0207664_10033293
613 Ga0207664_10047077
614 Ga0207664_10146597
615 Ga0207690_10427673
616 Ga0207665_10000599
617 Ga0207665_10013251
618 Ga0207665_10080022
619 Ga0207661_10006180
620 Ga0207661_10030847
621 Ga0207679_10211389
622 Ga0207667_10230182
623 Ga0207712_10077922
624 Ga0207703_10456175
625 Ga0207639_10149715
626 Ga0207708_10437297
627 Ga0207702_10187599
628 Ga0207702_10594692
629 Ga0207676_10571227
630 Ga0207674_10081437
631 Ga0207674_10218947
632 Ga0207675_100443036
633 Ga0209389_1000084
634 Ga0209589_1000041
635 Ga0209489_100070
636 Ga0209588_1022032
637 Ga0268266_10269609
638 Ga0268264_10000233
639 Ga0265332_10045301
640 Ga0265325_10013019
641 Ga0265325_10039529
642 Ga0265340_10024566
643 Ga0265339_10026091
644 Ga0265339_10078878
645 Ga0265331_10022693
646 Ga0265331_10072055
647 Ga0265316_10063516
648 Ga0307509_10022837
649 Ga0307508_10272089
650 Ga0265342_10008968
651 Ga0265342_10070381
652 Ga0307516_10004439
653 Ga0307516_10049732
654 Ga0307510_10124007
655 Ga0307510_10183924
656 Ga0315911_1000029
657 Ga0373934_0011530
658 Ga0373934_0090521
659 Ga0373923_0011563
660 Ga0373936_0005149
661 Ga0373953_0126847
662 Ga0373954_0024247
663 Ga0373956_0001864
664 Ga0373956_0045160
665 Ga0373957_0033319
666 Ga0373943_0006048
667 Ga0373943_0015294
668 Ga0373946_0007983
669 Ga0373955_0053603
670 Ga0373924_0030986
671 Ga0373935_0002358
672 Ga0373935_0059464
673 Ga0373935_0081588
674 Ga0373935_0218582
675 Ga0373927_0004777
676 Ga0373927_0036233
677 Ga0373927_0047835
678 Ga0373927_0054417
679 Ga0373927_0097392
680 Ga0373933_0034880
681 Ga0373933_0127518
682 Ga0373947_0004058
683 Ga0373947_0042176
684 Ga0373937_0026114
685 Ga0373937_0050396
686 Ga0373937_0087410
687 Ga0373925_0002066
688 Ga0373925_0025959
689 Ga0373925_0071569
690 Ga0373925_0207546
691 Ga0395900_0002015
692 Ga0395900_0316807
693 Ga0395898_0340258
694 Ga0395898_0712315
695 Ga0395905_0031203
696 Ga0395905_0089124
697 Ga0395905_0487632
698 Ga0395905_0644582
699 Ga0395901_0028021
700 Ga0395901_0445318
701 Ga0436365_0273120
702 Ga0436365_1620143
703 Ga0436361_0242400
704 Ga0436363_0528678
705 Ga0436362_0344570
706 Ga0466969_0010749
707 Ga0466972_0030816
708 Ga0466972_0050634
709 Ga0466966_0001701
710 Ga0466966_0048119
711 Ga0466961_0000064
712 Ga0466963_0026183
713 Ga0466960_0011447
714 Ga0466959_0004925
715 Ga0495592_0002985
716 Ga0495592_0003384
717 Ga0495592_0023387
718 Ga0495592_0054833
719 Ga0495603_0000788
720 Ga0495629_0000461
721 Ga0495629_0000581
722 Ga0495638_0001893
723 Ga0495641_0001433
724 Ga0495651_0023179
725 Ga0495651_0031990
726 Ga0495653_0010501
727 Ga0495580_0001585
728 Ga0495580_0207761
729 Ga0495582_0000199
730 Ga0495639_0000044
731 Ga0495662_0003017
732 Ga0495662_0038046
733 Ga0495662_0070803
734 Ga0495664_0039113
735 Ga0495664_0057170
736 Ga0495664_0249244
737 Ga0495594_0000306
738 Ga0495606_0014668
739 Ga0495608_0002317
740 Ga0495608_0302152
741 Ga0495618_0052970
742 Ga0495618_0087857
743 Ga0495628_0011633
744 Ga0495628_0067225
745 Ga0495628_0094423
746 Ga0495630_0011706
747 Ga0495648_0018917
748 Ga0495666_0057435
749 Ga0495666_0213515
750 Ga0495652_0028651
751 Ga0495652_0059658
752 Ga0495652_0116112
753 Ga0495665_0000422
754 Ga0495640_0003381
755 Ga0495640_0009524
756 Ga0495640_0060458
757 Ga0495640_0169481
758 Ga0495587_0018935
759 Ga0495587_0028829
760 Ga0495645_0050020
761 Ga0495622_0018933
762 Ga0495622_0048564
763 Ga0495667_0004993
764 Ga0495634_0000252
765 Ga0495634_0010015
766 Ga0495634_0010254
767 Ga0495634_0110676
768 Ga0495634_0133427
769 Ga0495635_0000251
770 Ga0495635_0010428
771 Ga0495588_0024009
772 Ga0495657_0019465
773 Ga0495599_0007216
774 Ga0495599_0081057
775 Ga0495623_0027284
776 Ga0495623_0042656
777 Ga0495623_0097787
778 Ga0495646_0003123
779 Ga0495646_0024372
780 Ga0495646_0057882
781 Ga0495658_0000891
782 Ga0495669_0192592
783 Ga0495613_0024707
784 Ga0495613_0186368
785 Ga0495624_0000832
786 Ga0495624_0007046
787 Ga0495649_0092060
788 Ga0495600_0046870
789 Ga0495600_0069488
790 Ga0495581_0002344
791 Ga0495581_0223280
792 Ga0495604_0132927
793 Ga0495674_0006258
794 Ga0495674_0021811
795 Ga0495674_0069734
796 Ga0495674_0151473
797 Ga0495680_0004040
798 Ga0495680_0081575
799 Ga0495675_0006004
800 Ga0495675_0022058
801 Ga0495673_0041257
802 Ga0495684_0004175
803 Ga0495684_0030188
804 Ga0495684_0123547
805 Ga0495593_0000353
806 Ga0495602_0128663
807 Ga0495602_0152087
808 Ga0496101_0111931
809 Ga0496102_0121083
810 Ga0496102_0149065
811 Ga0496104_0061196
812 Ga0496105_0087984
813 Ga0496106_0001736
814 Ga0496106_0322966
815 Ga0496107_0102003
816 Ga0496107_0442727
817 Ga0496108_0564661
818 Ga0496112_0052435
819 Ga0496113_0078140
820 Ga0496117_0047871
821 Ga0496117_0079443
822 Ga0496118_0003606
823 Ga0496118_0050463
824 Ga0496118_0096188
825 Ga0496119_0065203
826 Ga0496121_0000398
827 Ga0496121_0084512
828 Ga0496121_0190990
829 Ga0496121_0257077
830 Ga0496122_0036477
831 Ga0496124_0000524
832 Ga0496125_0072662
833 Ga0496125_0082204
834 Ga0496125_0114897
835 Ga0496126_0014187
836 Ga0496126_0032376
837 Ga0496126_0055303
838 Ga0496126_0074015
839 Ga0496126_0103757
840 Ga0496126_0127571
841 Ga0496126_0178572
842 Ga0496126_0207910
843 Ga0496126_0354276
844 Ga0496126_0410702
845 nmdc:mga0yw44_203317_c1
846 nmdc:mga06z11_276442_c1
847 nmdc:mga06z11_43867_c1
848 nmdc:mga07m45_81846_c1
849 nmdc:mga06r32_157411_c1
850 nmdc:mga0n895_1023394_c1
851 nmdc:mga0n895_16437_c1
852 nmdc:mga0n895_911415_c1
853 nmdc:mga0rr50_97211_c1
854 Ga0495601_0028301
855 Ga0495601_0157063
856 Ga0495601_0195384
857 Ga0495612_0037293
858 Ga0495612_0040873
859 Ga0495612_0096648
860 Ga0500635_0088804
861 Ga0495595_0039324
862 Ga0495595_0039526
863 Ga0495619_0001922
864 Ga0500641_0002024
865 Ga0500595_009907
866 Ga0500597_061453
867 Ga0500559_0000274
868 Ga0500559_0071856
869 Ga0500590_097720
870 Ga0500603_000185
871 Ga0500637_0188559
872 Ga0500576_030113
873 2524537242
874 2511393443
875 2513656537
876 2513676783
877 2513717552
878 2513859578
879 2513889315
880 2513917722
881 2517106668
882 2517893205
883 2524439765
884 2524471282
885 2671117841
886 2745078929
887 2793069928
888 2841964451
889 2847945708
890 2874627044
891 2876770862
892 2881672139
893 2885374796
894 2885389400
895 2888383135
896 2903755668
897 2903777457
898 2904669745
899 2906635790
900 2906667906
901 2908743596
902 2922367815
903 2922392283
904 2922429278
905 2935634142
906 2941511033
907 2941518417
908 2941527320
909 3005479442
910 8006941708
911 8006981422
912 8019557612
913 8019567686
914 8019657395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

73

264

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8849 29 275
6n9i-assembly2.cif.gz_B structure of the quorum quenching lactonase from parageobacillus caldoxylosilyticus - free 0.8837 32 276
2btn-assembly1.cif.gz_A crystal structure and catalytic mechanism of the quorum-quenching n- acyl homoserine lactone hydrolase 0.8815 29 275
2br6-assembly1.cif.gz_A crystal structure of quorum-quenching n-acyl homoserine lactone lactonase 0.8713 29 275
6cgz-assembly2.cif.gz_C structure of the quorum quenching lactonase from alicyclobacillus acidoterrestris bound to c6-ahl 0.8701 32 276
ID Description Score Start End Superfamily
6n9qD00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8836 32 276 3.60.15.10
2r2dE00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8591 29 276 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8415 29 265 3.60.15.10
3aj0A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.832 29 276 3.60.15.10
5ehtA01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8189 29 265 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2U3Q0S9-F1-model_v4 AttM/AiiB family protein 0.9876 59 276
AF-A0A1I3HTG4-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9876 117 276
AF-A0A2U3Q0S9-F1-model_v4 AttM/AiiB family protein 0.9831 59 276
AF-A0A1I3HTG4-F1-model_v4 Metallo-beta-lactamase superfamily protein 0.9816 117 276
AF-Q8XS86-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9809 147 276

Map