F447853

General Info

Members Datasets Scaffolds Average Seq Length
456 279 912 194

Family's Representative Sequence

Representative Sequence 3300046507|Ga0495606_0001203|Ga0495606_0001203_26826_27437
Length 203
Sequence MARAGLSAHRVTLAAADLADTAGLDGVTISAVARGFGVKDASLYSHVRNLQDLRHRIALLAGGELVDRIGAAVAGRSGRDALLAFADAYRAYALAHPGRYAATQLPVPPELVAADPVAFRRTYELTYGMLRGYGLSEPDLTDAVRLLRSTFHGFVSLEATGGFGHPRDVELSWRRSVEALHVLLEHWPAATPGDTPREETPAP

Samples

Sample ID Description Type Environment
1 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
19 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
20 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
21 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
44 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
55 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
56 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
57 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
58 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
59 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
60 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
65 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
71 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
72 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
73 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
76 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
77 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
78 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
79 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
80 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
81 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
82 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
83 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
84 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
85 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
86 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
87 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
88 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
94 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
95 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
104 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
139 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
164 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
171 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
210 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
211 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
212 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
213 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
219 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
220 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
221 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
222 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
223 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
224 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
225 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
226 2643221647 Streptomyces sp. Root369 Isolate Unclassified
227 2643221670 Streptomyces sp. Root431 Isolate Unclassified
228 2671180195 Frankia sp. CcI49 Isolate Nodule
229 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
230 2687453737 Frankia sp. BMG5.36 Isolate Nodule
231 2773857922 Frankia sp. CcI49 Isolate Nodule
232 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
233 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
234 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
235 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
236 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
237 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
238 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
239 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
240 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
241 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
242 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
243 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
244 2867428634 Streptomyces sp. RP5T Isolate Unclassified
245 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
246 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
247 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
248 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
249 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
250 2891562705 Microbispora tritici MT50 Isolate Unclassified
251 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
252 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
253 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
254 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
255 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
256 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
257 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
258 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
259 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
260 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
261 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
262 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
263 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
264 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
265 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
266 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
267 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
268 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
269 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
270 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
271 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
272 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
273 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
274 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
275 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
276 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
277 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
278 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
279 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.4
Metatranscriptomes 0
Isolates 13.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 1.32
Rhizoplane 1.32
Rhizosphere 80.48
Stem 0
Stem Tuber 0
Unclassified 1.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495606_0001203 3300046507 Bacteria 36438
2 rootH1_10003580 3300003316 Bacteria 17788
3 rootH1_10013355 3300003316 Bacteria 11118
4 rootH2_10059930 3300003320 Bacteria 2820
5 rootH2_10064650 3300003320 Bacteria 4046
6 rootH2_10102852 3300003320 Bacteria 3564
7 rootH1_10018825 3300003323 Bacteria 14606
8 rootH1_10025532 3300003323 Bacteria 3818
9 rootH1_10053368 3300003323 Bacteria 3910
10 Ga0070683_100016718 3300005329 Bacteria 6472
11 Ga0070683_100338752 3300005329 Bacteria 1432
12 Ga0070683_100640920 3300005329 Bacteria 1017
13 Ga0070670_101185504 3300005331 Unclassified 698
14 Ga0070710_10007167 3300005437 Bacteria 5388
15 Ga0070711_100099505 3300005439 Bacteria 2113
16 Ga0070681_10338582 3300005458 Bacteria 1414
17 Ga0070679_100588301 3300005530 Bacteria 1056
18 Ga0068853_100140574 3300005539 Bacteria 2167
19 Ga0070665_100211351 3300005548 Bacteria 1941
20 Ga0070664_100425031 3300005564 Bacteria 1217
21 Ga0068857_100223675 3300005577 Bacteria 1720
22 Ga0068854_100851127 3300005578 Bacteria 798
23 Ga0068852_101401977 3300005616 Bacteria 721
24 Ga0075363_100001592 3300006048 Bacteria 8732
25 Ga0075363_100082567 3300006048 Bacteria 1759
26 Ga0070712_100090800 3300006175 Bacteria 2237
27 Ga0075370_10063893 3300006353 Bacteria 2099
28 Ga0075370_10339654 3300006353 Bacteria 896
29 Ga0075436_100309129 3300006914 Bacteria 1134
30 Ga0099826_10233816 3300006948 Bacteria 980
31 Ga0105245_10317199 3300009098 Bacteria 1534
32 Ga0105243_10619930 3300009148 Bacteria 1044
33 Ga0105243_10662550 3300009148 Bacteria 1013
34 Ga0105248_11071760 3300009177 Bacteria 911
35 Ga0105248_11827542 3300009177 Unclassified 689
36 Ga0105238_10790275 3300009551 Bacteria 964
37 Ga0105239_11380951 3300010375 Unclassified 813
38 Ga0157369_11045444 3300013105 Bacteria 835
39 Ga0157372_10491953 3300013307 Bacteria 1430
40 Ga0157380_10687491 3300014326 Bacteria 1026
41 Ga0157377_10471868 3300014745 Bacteria 871
42 Ga0183367_1001 3300015688 Bacteria 1225545
43 Ga0209758_1004157 3300025297 Bacteria 12331
44 Ga0207692_10004824 3300025898 Bacteria 5362
45 Ga0207693_10101283 3300025915 Bacteria 2258
46 Ga0207663_10153803 3300025916 Bacteria 1616
47 Ga0207687_10166007 3300025927 Bacteria 1698
48 Ga0207661_10004233 3300025944 Bacteria 10045
49 Ga0207661_10233422 3300025944 Bacteria 1630
50 Ga0207661_10911070 3300025944 Bacteria 810
51 Ga0207679_10012979 3300025945 Bacteria 5451
52 Ga0207640_10677602 3300025981 Bacteria 881
53 Ga0207639_10149822 3300026041 Bacteria 1953
54 Ga0207678_10190970 3300026067 Unclassified 1750
55 Ga0207674_10188531 3300026116 Bacteria 2012
56 Ga0307515_10412321 3300028794 Bacteria 973
57 Ga0307511_10000220 3300030521 Bacteria 57569
58 Ga0307511_10024240 3300030521 Bacteria 5629
59 Ga0307513_10068975 3300031456 Bacteria 3701
60 Ga0307509_10003119 3300031507 Bacteria 25717
61 Ga0307509_10021772 3300031507 Bacteria 7241
62 Ga0307508_10151063 3300031616 Bacteria 1927
63 Ga0307508_10337409 3300031616 Bacteria 1099
64 Ga0307508_10349566 3300031616 Bacteria 1070
65 Ga0307514_10005344 3300031649 Bacteria 11513
66 Ga0307514_10049072 3300031649 Bacteria 3284
67 Ga0307516_10007223 3300031730 Bacteria 12808
68 Ga0307518_10068659 3300031838 Bacteria 2568
69 Ga0307518_10076825 3300031838 Bacteria 2413
70 Ga0307518_10194141 3300031838 Bacteria 1356
71 Ga0307518_10303573 3300031838 Bacteria 968
72 Ga0307518_10436491 3300031838 Bacteria 709
73 Ga0307415_100674285 3300032126 Bacteria 930
74 Ga0307507_10005212 3300033179 Bacteria 21681
75 Ga0307507_10010746 3300033179 Bacteria 11731
76 Ga0307510_10030041 3300033180 Bacteria 6168
77 Ga0307510_10030484 3300033180 Bacteria 6113
78 Ga0307510_10096452 3300033180 Bacteria 2773
79 Ga0373926_0077901 3300035083 Bacteria 1223
80 Ga0373934_0033634 3300035086 Bacteria 2013
81 Ga0373923_0037001 3300035111 Bacteria 1995
82 Ga0373936_0331614 3300035113 Archaea 690
83 Ga0373953_0068889 3300035117 Bacteria 1457
84 Ga0373956_0085480 3300035119 Bacteria 1451
85 Ga0373957_0068361 3300035120 Bacteria 1386
86 Ga0373946_0008064 3300035171 Bacteria 3869
87 Ga0373955_0041960 3300035172 Bacteria 2455
88 Ga0373931_0247801 3300035691 Bacteria 1082
89 Ga0373935_0357278 3300035692 Unclassified 1042
90 Ga0373947_0030027 3300035725 Bacteria 3191
91 Ga0373947_0228711 3300035725 Bacteria 1224
92 Ga0373937_0077463 3300036401 Bacteria 3072
93 Ga0373925_0034037 3300037068 Bacteria 3755
94 Ga0395900_0493238 3300037418 Bacteria 1176
95 Ga0395900_0830851 3300037418 Bacteria 850
96 Ga0395898_0007272 3300037466 Bacteria 11753
97 Ga0395901_0641522 3300038443 Bacteria 1066
98 Ga0439436_0010550 3300041404 Bacteria 2815
99 Ga0451837_0083936 3300041494 Bacteria 3368
100 Ga0451843_0167119 3300041509 Bacteria 980
101 Ga0451853_1526283 3300041512 Bacteria 2377
102 Ga0451853_3660180 3300041512 Bacteria 830
103 Ga0439448_0034893 3300042005 Bacteria 1609
104 Ga0439432_068971 3300042006 Bacteria 1080
105 Ga0439449_0001341 3300042007 Bacteria 9649
106 Ga0439455_0010123 3300042012 Bacteria 2064
107 Ga0439457_001645 3300042014 Bacteria 6655
108 Ga0450894_011143 3300042131 Bacteria 1169
109 Ga0450896_000733 3300042133 Bacteria 3662
110 Ga0450898_002627 3300042134 Bacteria 2516
111 Ga0450903_000102 3300042138 Bacteria 18034
112 Ga0450903_004372 3300042138 Bacteria 2415
113 Ga0450906_003648 3300042145 Bacteria 3284
114 Ga0439458_0003922 3300042157 Bacteria 3436
115 Ga0450908_006633 3300042184 Bacteria 2193
116 Ga0466969_0027814 3300044656 Bacteria 2894
117 Ga0466972_0001461 3300044658 Bacteria 11489
118 Ga0466972_0006210 3300044658 Bacteria 6002
119 Ga0466972_0040010 3300044658 Bacteria 2286
120 Ga0466972_0053419 3300044658 Bacteria 1945
121 Ga0466965_0008698 3300044683 Bacteria 4700
122 Ga0466965_0194258 3300044683 Bacteria 1074
123 Ga0466966_0020962 3300044684 Bacteria 4295
124 Ga0466966_0047573 3300044684 Bacteria 2734
125 Ga0466961_0007830 3300044693 Bacteria 6802
126 Ga0466961_0010007 3300044693 Bacteria 6042
127 Ga0466961_0013137 3300044693 Bacteria 5298
128 Ga0466963_0002052 3300044694 Bacteria 11101
129 Ga0466963_0016576 3300044694 Bacteria 4584
130 Ga0466971_0004523 3300044719 Bacteria 6011
131 Ga0466968_0004389 3300044735 Bacteria 5268
132 Ga0466970_0001053 3300044765 Bacteria 13339
133 Ga0466970_0001485 3300044765 Bacteria 11306
134 Ga0466957_0017612 3300044842 Bacteria 4188
135 Ga0466957_0372775 3300044842 Bacteria 972
136 Ga0466960_0024762 3300044901 Bacteria 2710
137 Ga0466959_0469189 3300045049 Bacteria 852
138 Ga0466958_0007829 3300045836 Bacteria 5901
139 Ga0466967_0002157 3300045976 Bacteria 12081
140 Ga0466967_0221393 3300045976 Bacteria 1798
141 Ga0466967_1224566 3300045976 Bacteria 748
142 Ga0495592_0015536 3300046454 Bacteria 5776
143 Ga0495603_0016402 3300046455 Bacteria 4481
144 Ga0495603_0240200 3300046455 Bacteria 1043
145 Ga0495590_0060515 3300046457 Bacteria 1326
146 Ga0495629_0002554 3300046459 Bacteria 13956
147 Ga0495629_0011067 3300046459 Bacteria 6555
148 Ga0495629_0016195 3300046459 Bacteria 5352
149 Ga0495629_0020337 3300046459 Bacteria 4741
150 Ga0495629_0061299 3300046459 Bacteria 2628
151 Ga0495629_0437423 3300046459 Bacteria 886
152 Ga0495638_0273401 3300046460 Bacteria 921
153 Ga0495641_0006050 3300046461 Bacteria 7959
154 Ga0495651_0026258 3300046462 Bacteria 4536
155 Ga0495653_0012402 3300046463 Bacteria 6959
156 Ga0495653_0075251 3300046463 Bacteria 2513
157 Ga0495580_0130284 3300046472 Bacteria 1745
158 Ga0495582_0005608 3300046473 Bacteria 6988
159 Ga0495582_0034848 3300046473 Bacteria 2767
160 Ga0495582_0427590 3300046473 Bacteria 764
161 Ga0495605_0096508 3300046474 Bacteria 1363
162 Ga0495662_0001041 3300046476 Bacteria 13618
163 Ga0495662_0004088 3300046476 Bacteria 7346
164 Ga0495662_0004821 3300046476 Bacteria 6761
165 Ga0495662_0012262 3300046476 Bacteria 4186
166 Ga0495664_0009682 3300046477 Bacteria 5396
167 Ga0495664_0010293 3300046477 Bacteria 5246
168 Ga0495664_0084432 3300046477 Bacteria 1906
169 Ga0495584_0297800 3300046491 Bacteria 819
170 Ga0495585_0202293 3300046492 Bacteria 1010
171 Ga0495594_0002133 3300046499 Bacteria 10291
172 Ga0495596_0081142 3300046500 Bacteria 1259
173 Ga0495607_0341713 3300046501 Bacteria 693
174 Ga0495583_0028901 3300046506 Bacteria 2719
175 Ga0495606_0020417 3300046507 Bacteria 4883
176 Ga0495608_0007981 3300046511 Bacteria 7439
177 Ga0495608_0122748 3300046511 Bacteria 1665
178 Ga0495610_0046109 3300046512 Bacteria 2153
179 Ga0495616_0127618 3300046513 Bacteria 1168
180 Ga0495618_0008973 3300046514 Bacteria 6035
181 Ga0495620_0074316 3300046515 Bacteria 1384
182 Ga0495620_0090087 3300046515 Bacteria 1231
183 Ga0495628_0014168 3300046516 Bacteria 6692
184 Ga0495628_0034268 3300046516 Bacteria 4085
185 Ga0495628_0073666 3300046516 Bacteria 2660
186 Ga0495630_0051553 3300046517 Bacteria 3080
187 Ga0495631_0051886 3300046518 Bacteria 1791
188 Ga0495643_0050556 3300046522 Bacteria 2238
189 Ga0495643_0182488 3300046522 Bacteria 1019
190 Ga0495666_0024308 3300046526 Bacteria 2994
191 Ga0495666_0031710 3300046526 Bacteria 2589
192 Ga0495666_0286351 3300046526 Bacteria 746
193 Ga0495652_0086976 3300046529 Bacteria 2564
194 Ga0495652_0090664 3300046529 Bacteria 2501
195 Ga0495665_0001348 3300046531 Bacteria 13123
196 Ga0495640_0001549 3300046533 Bacteria 18108
197 Ga0495640_0013160 3300046533 Bacteria 6295
198 Ga0495586_0041293 3300046535 Bacteria 2484
199 Ga0495587_0009317 3300046536 Bacteria 6294
200 Ga0495609_0030887 3300046538 Bacteria 2438
201 Ga0495597_0035704 3300046542 Bacteria 2241
202 Ga0495645_0061986 3300046543 Bacteria 2709
203 Ga0495622_0031142 3300046557 Bacteria 2494
204 Ga0495622_0036282 3300046557 Bacteria 2299
205 Ga0495622_0047056 3300046557 Bacteria 2005
206 Ga0495633_0085139 3300046558 Bacteria 1470
207 Ga0495667_0023394 3300046559 Bacteria 4162
208 Ga0495667_0109795 3300046559 Bacteria 1782
209 Ga0495667_0286662 3300046559 Bacteria 1045
210 Ga0495668_0000184 3300046616 Bacteria 93069
211 Ga0495668_0228871 3300046616 Bacteria 1018
212 Ga0495634_0001513 3300046642 Bacteria 20538
213 Ga0495634_0095452 3300046642 Bacteria 1926
214 Ga0495634_0109274 3300046642 Bacteria 1779
215 Ga0495625_0001986 3300046660 Bacteria 23080
216 Ga0495625_0005261 3300046660 Bacteria 11889
217 Ga0495625_0528099 3300046660 Bacteria 718
218 Ga0495625_0531634 3300046660 Bacteria 714
219 Ga0495635_0012314 3300046663 Bacteria 5994
220 Ga0495635_0013598 3300046663 Bacteria 5694
221 Ga0495635_0088053 3300046663 Bacteria 2124
222 Ga0495635_0195060 3300046663 Bacteria 1374
223 Ga0495661_0241452 3300046665 Bacteria 926
224 Ga0495588_0008208 3300046674 Bacteria 4781
225 Ga0495588_0035873 3300046674 Bacteria 2514
226 Ga0495588_0050671 3300046674 Bacteria 2136
227 Ga0495588_0228694 3300046674 Bacteria 981
228 Ga0495657_0001322 3300046675 Bacteria 21594
229 Ga0495657_0009042 3300046675 Bacteria 7574
230 Ga0495657_0021966 3300046675 Bacteria 4575
231 Ga0495657_0023059 3300046675 Bacteria 4452
232 Ga0495657_0054790 3300046675 Bacteria 2662
233 Ga0495657_0064462 3300046675 Bacteria 2413
234 Ga0495657_0079066 3300046675 Bacteria 2130
235 Ga0495599_0397911 3300046678 Bacteria 821
236 Ga0495623_0056773 3300046679 Bacteria 2464
237 Ga0495647_0091382 3300046681 Bacteria 1248
238 Ga0495658_0007329 3300046683 Bacteria 5453
239 Ga0495658_0021307 3300046683 Bacteria 3416
240 Ga0495613_0004862 3300046689 Bacteria 10086
241 Ga0495613_0005185 3300046689 Bacteria 9784
242 Ga0495613_0011516 3300046689 Bacteria 6579
243 Ga0495613_0091360 3300046689 Bacteria 2204
244 Ga0495613_0114765 3300046689 Bacteria 1938
245 Ga0495613_0201513 3300046689 Bacteria 1403
246 Ga0495613_0353440 3300046689 Bacteria 1009
247 Ga0495624_0001394 3300046690 Bacteria 18836
248 Ga0495624_0171421 3300046690 Bacteria 1324
249 Ga0495624_0214442 3300046690 Bacteria 1167
250 Ga0495671_0010535 3300046692 Bacteria 5115
251 Ga0495671_0225369 3300046692 Bacteria 907
252 Ga0495649_0043824 3300046694 Bacteria 2442
253 Ga0495649_0162880 3300046694 Bacteria 1169
254 Ga0495649_0169369 3300046694 Bacteria 1143
255 Ga0495589_0066674 3300046794 Bacteria 1762
256 Ga0495600_0050492 3300046809 Bacteria 2714
257 Ga0495600_0247932 3300046809 Bacteria 1133
258 Ga0495581_0013037 3300047315 Bacteria 4818
259 Ga0495581_0017071 3300047315 Bacteria 4219
260 Ga0495581_0028748 3300047315 Bacteria 3223
261 Ga0495604_0005845 3300047317 Bacteria 9753
262 Ga0495604_0032947 3300047317 Bacteria 4103
263 Ga0495604_0064335 3300047317 Bacteria 2795
264 Ga0495604_0232997 3300047317 Bacteria 1262
265 Ga0495636_0021406 3300047318 Bacteria 2610
266 Ga0495636_0050892 3300047318 Bacteria 1735
267 Ga0495674_0010621 3300047319 Bacteria 8711
268 Ga0495674_0064701 3300047319 Bacteria 3178
269 Ga0495674_0244913 3300047319 Bacteria 1476
270 Ga0495676_0006846 3300047321 Bacteria 10475
271 Ga0495676_0009946 3300047321 Bacteria 8640
272 Ga0495676_0034429 3300047321 Bacteria 4251
273 Ga0495676_0047296 3300047321 Bacteria 3480
274 Ga0495676_0175500 3300047321 Bacteria 1505
275 Ga0495676_0566351 3300047321 Bacteria 741
276 Ga0495680_0080607 3300047322 Bacteria 2459
277 Ga0495680_0137077 3300047322 Bacteria 1793
278 Ga0495687_004735 3300047443 Bacteria 9008
279 Ga0495687_033705 3300047443 Bacteria 2320
280 Ga0495687_077324 3300047443 Bacteria 1314
281 Ga0495675_0050470 3300047444 Bacteria 2644
282 Ga0495675_0051566 3300047444 Bacteria 2613
283 Ga0495685_019059 3300047447 Bacteria 2355
284 Ga0495685_041752 3300047447 Bacteria 1567
285 Ga0495673_0152650 3300047469 Bacteria 892
286 Ga0495681_0007962 3300047470 Bacteria 6692
287 Ga0495681_0111449 3300047470 Bacteria 1184
288 Ga0495684_0020692 3300047471 Bacteria 5069
289 Ga0495686_0025096 3300047472 Bacteria 3909
290 Ga0495593_0008335 3300047673 Bacteria 6031
291 Ga0495593_0054431 3300047673 Bacteria 2109
292 Ga0495593_0119234 3300047673 Unclassified 1343
293 Ga0495593_0139246 3300047673 Bacteria 1229
294 Ga0495602_0002426 3300048088 Bacteria 18977
295 Ga0495602_0316289 3300048088 Bacteria 1137
296 Ga0495614_0003445 3300048089 Bacteria 7081
297 Ga0495614_0006225 3300048089 Bacteria 5362
298 Ga0495614_0007373 3300048089 Bacteria 4898
299 Ga0495614_0083142 3300048089 Bacteria 1388
300 Ga0495614_0091199 3300048089 Bacteria 1325
301 Ga0495626_0000106 3300048091 Bacteria 109700
302 Ga0495626_0091684 3300048091 Bacteria 1335
303 Ga0496104_0959895 3300048907 Unclassified 759
304 Ga0496108_0538620 3300048911 Unclassified 1019
305 Ga0496110_0801224 3300048913 Bacteria 846
306 Ga0496112_0482686 3300048915 Bacteria 1176
307 Ga0496113_0169309 3300048916 Bacteria 1730
308 Ga0496114_0074084 3300048917 Bacteria 2866
309 Ga0496126_0102503 3300048929 Bacteria 2502
310 Ga0501032_0003232 3300049569 Bacteria 12530
311 Ga0501032_0009610 3300049569 Bacteria 7009
312 Ga0501033_0004235 3300049570 Bacteria 11540
313 Ga0501033_0028971 3300049570 Bacteria 4160
314 Ga0501033_0042575 3300049570 Bacteria 3385
315 Ga0501033_0301340 3300049570 Bacteria 1128
316 Ga0501034_0007906 3300049571 Bacteria 11297
317 Ga0501034_0009838 3300049571 Bacteria 9997
318 Ga0501034_0049105 3300049571 Bacteria 4259
319 Ga0501034_0077341 3300049571 Bacteria 3333
320 Ga0501036_0002232 3300049572 Bacteria 15141
321 Ga0501036_0026775 3300049572 Bacteria 4871
322 Ga0501036_0053747 3300049572 Bacteria 3410
323 Ga0501036_0194102 3300049572 Bacteria 1708
324 Ga0501036_0242346 3300049572 Bacteria 1512
325 Ga0501037_0004243 3300049573 Bacteria 10392
326 Ga0501037_0025369 3300049573 Bacteria 4380
327 Ga0501037_0095565 3300049573 Bacteria 2148
328 Ga0501038_0007085 3300049574 Bacteria 10354
329 Ga0501038_0037126 3300049574 Bacteria 4274
330 Ga0501038_0084069 3300049574 Bacteria 2678
331 Ga0501038_0491079 3300049574 Bacteria 940
332 Ga0501038_0541848 3300049574 Bacteria 886
333 Ga0501039_0005727 3300049575 Bacteria 9414
334 Ga0501039_0169232 3300049575 Bacteria 1718
335 Ga0501042_0147209 3300049578 Bacteria 1698
336 Ga0501043_0036420 3300049579 Bacteria 3870
337 Ga0501043_0149379 3300049579 Bacteria 1829
338 Ga0501046_0250710 3300049580 Bacteria 1303
339 Ga0501046_0301495 3300049580 Bacteria 1170
340 Ga0501047_0005169 3300049581 Bacteria 12246
341 Ga0501047_0046661 3300049581 Bacteria 4187
342 Ga0501047_0049541 3300049581 Bacteria 4056
343 Ga0501047_0062685 3300049581 Bacteria 3586
344 Ga0501047_0092892 3300049581 Bacteria 2896
345 Ga0501047_0375606 3300049581 Bacteria 1256
346 Ga0501047_0382701 3300049581 Bacteria 1241
347 Ga0501048_0201971 3300049582 Bacteria 1409
348 Ga0501068_0317974 3300049584 Bacteria 998
349 Ga0501069_0053919 3300049585 Bacteria 2239
350 Ga0501070_0002851 3300049586 Bacteria 15073
351 Ga0501070_0083286 3300049586 Bacteria 2648
352 Ga0501070_0118610 3300049586 Bacteria 2187
353 Ga0501073_0148647 3300049589 Bacteria 1624
354 Ga0501074_0002212 3300049590 Bacteria 13490
355 Ga0501225_0083448 3300049705 Bacteria 920
356 Ga0501035_0004519 3300049822 Bacteria 13205
357 Ga0501035_0006312 3300049822 Bacteria 11144
358 Ga0501035_0036109 3300049822 Bacteria 4481
359 Ga0501035_0050345 3300049822 Bacteria 3733
360 Ga0501044_0018057 3300049823 Bacteria 7564
361 Ga0501044_0049201 3300049823 Bacteria 4352
362 Ga0501044_0079921 3300049823 Bacteria 3312
363 Ga0501044_0092494 3300049823 Bacteria 3050
364 Ga0501044_0247442 3300049823 Bacteria 1725
365 Ga0501044_0347044 3300049823 Bacteria 1405
366 Ga0501044_0530936 3300049823 Bacteria 1075
367 Ga0501044_0590530 3300049823 Bacteria 1004
368 Ga0501044_0714405 3300049823 Bacteria 887
369 nmdc:mga03n38_213430_c1 3300050490 Bacteria 1004
370 nmdc:mga03n38_38040_c1 3300050490 Bacteria 2079
371 nmdc:mga03n38_71121_c1 3300050490 Bacteria 1610
372 nmdc:mga06z11_175870_c1 3300050494 Bacteria 1232
373 nmdc:mga07m45_333775_c1 3300050496 Bacteria 881
374 Ga0495601_0030676 3300053077 Bacteria 3339
375 Ga0495612_0022508 3300053078 Bacteria 2525
376 Ga0495612_0045823 3300053078 Bacteria 1790
377 Ga0495595_0044766 3300053084 Bacteria 2033
378 Ga0495595_0272767 3300053084 Bacteria 848
379 Ga0495595_0312102 3300053084 Bacteria 792
380 Ga0495619_0123292 3300053085 Bacteria 1777
381 Ga0495619_0314156 3300053085 Bacteria 1085
382 Ga0495619_0409106 3300053085 Bacteria 936
383 Ga0495619_0602343 3300053085 Bacteria 752
384 Ga0500583_0026258 3300053092 Bacteria 2498
385 Ga0500640_017121 3300053095 Bacteria 3069
386 Ga0500660_093227 3300053100 Bacteria 1338
387 Ga0500553_014474 3300053101 Bacteria 3999
388 Ga0500553_092226 3300053101 Bacteria 1329
389 Ga0500572_006351 3300053111 Bacteria 2705
390 Ga0500614_023613 3300053123 Bacteria 1447
391 Ga0500600_0126462 3300053149 Bacteria 1309
392 Ga0500636_0151578 3300053177 Bacteria 1273
393 Ga0466962_0000134 3300061719 Bacteria 30435
394 Ga0466962_0064153 3300061719 Bacteria 1754
395 2547407574 2547132111 Bacteria 8013147
396 2552112753 2551306166 Bacteria 9731570
397 2585309332 2582581313 Bacteria 10042643
398 2585316622 2582581314 Bacteria 11452267
399 2616699832 2616644814 Bacteria 11555299
400 2616905764 2616644941 Bacteria 8510691
401 2644019036 2643221601 Bacteria 7493239
402 2644180169 2643221631 Bacteria 8168043
403 2644264687 2643221647 Bacteria 10741251
404 2644388796 2643221670 Bacteria 6497041
405 2671836919 2671180195 Bacteria 9757215
406 2676494525 2675903060 Bacteria 10051191
407 2689962044 2687453737 Bacteria 11203906
408 2774855075 2773857922 Bacteria 9757215
409 2785372383 2784746768 Bacteria 10036182
410 2786673516 2786546132 Bacteria 10419719
411 2808914375 2808606375 Bacteria 9466072
412 2812353413 2811994879 Bacteria 9313447
413 2812477871 2811994917 Bacteria 7761064
414 2856742346 2856741275 Bacteria 8096094
415 2862186600 2862178590 Bacteria 8583590
416 2862283695 2862281513 Bacteria 9621493
417 2862296670 2862290372 Bacteria 7471434
418 2862383631 2862382967 Bacteria 10317375
419 2862707031 2862705112 Bacteria 6563286
420 2863409471 2863404153 Bacteria 9672205
421 2867434158 2867428634 Bacteria 9590268
422 2873151999 2873151551 Bacteria 8625867
423 2877678273 2877676314 Bacteria 9512378
424 2887483212 2887478801 Bacteria 8972725
425 2891400890 2891395885 Bacteria 9251614
426 2891561555 2891554331 Bacteria 8812224
427 2891566165 2891562705 Bacteria 8039471
428 2895438240 2895427314 Bacteria 13147766
429 2912716774 2912715099 Bacteria 9460473
430 2912764504 2912757875 Bacteria 7940295
431 2935390976 2935390628 Bacteria 7043367
432 2954383178 2954380949 Bacteria 10050426
433 2954679822 2954673503 Bacteria 9685905
434 2954684331 2954682443 Bacteria 9862841
435 2954693887 2954691527 Bacteria 10720516
436 2954708998 2954701450 Bacteria 10834262
437 2954713514 2954711539 Bacteria 10867210
438 2954723479 2954721474 Bacteria 10456478
439 2954738352 2954731030 Bacteria 10243860
440 2954742382 2954740390 Bacteria 10229294
441 2954757212 2954749733 Bacteria 10366972
442 2954761352 2954759201 Bacteria 9358192
443 2990067879 2990059506 Bacteria 9321252
444 2997453603 2997451912 Bacteria 8492419
445 2997607374 2997600082 Bacteria 9896405
446 3006321792 3006321560 Bacteria 8247479
447 8008488692 8008485437 Bacteria 7198341
448 8008563747 8008558824 Bacteria 10610750
449 8008576412 8008574985 Bacteria 7815457
450 8025480918 8025478263 Bacteria 8209203
451 8025527540 8025524527 Bacteria 7197316
452 8048412880 8048406513 Bacteria 8936924
453 8054164661 8054160619 Bacteria 7783213
454 8056214820 8056207758 Bacteria 8639239
455 8056668635 8056667051 Bacteria 6953971
456 8056829783 8056829672 Bacteria 9045328
457 Ga0495606_0001203
458 rootH1_10003580
459 rootH1_10013355
460 rootH2_10059930
461 rootH2_10064650
462 rootH2_10102852
463 rootH1_10018825
464 rootH1_10025532
465 rootH1_10053368
466 Ga0070683_100016718
467 Ga0070683_100338752
468 Ga0070683_100640920
469 Ga0070670_101185504
470 Ga0070710_10007167
471 Ga0070711_100099505
472 Ga0070681_10338582
473 Ga0070679_100588301
474 Ga0068853_100140574
475 Ga0070665_100211351
476 Ga0070664_100425031
477 Ga0068857_100223675
478 Ga0068854_100851127
479 Ga0068852_101401977
480 Ga0075363_100001592
481 Ga0075363_100082567
482 Ga0070712_100090800
483 Ga0075370_10063893
484 Ga0075370_10339654
485 Ga0075436_100309129
486 Ga0099826_10233816
487 Ga0105245_10317199
488 Ga0105243_10619930
489 Ga0105243_10662550
490 Ga0105248_11071760
491 Ga0105248_11827542
492 Ga0105238_10790275
493 Ga0105239_11380951
494 Ga0157369_11045444
495 Ga0157372_10491953
496 Ga0157380_10687491
497 Ga0157377_10471868
498 Ga0183367_1001
499 Ga0209758_1004157
500 Ga0207692_10004824
501 Ga0207693_10101283
502 Ga0207663_10153803
503 Ga0207687_10166007
504 Ga0207661_10004233
505 Ga0207661_10233422
506 Ga0207661_10911070
507 Ga0207679_10012979
508 Ga0207640_10677602
509 Ga0207639_10149822
510 Ga0207678_10190970
511 Ga0207674_10188531
512 Ga0307515_10412321
513 Ga0307511_10000220
514 Ga0307511_10024240
515 Ga0307513_10068975
516 Ga0307509_10003119
517 Ga0307509_10021772
518 Ga0307508_10151063
519 Ga0307508_10337409
520 Ga0307508_10349566
521 Ga0307514_10005344
522 Ga0307514_10049072
523 Ga0307516_10007223
524 Ga0307518_10068659
525 Ga0307518_10076825
526 Ga0307518_10194141
527 Ga0307518_10303573
528 Ga0307518_10436491
529 Ga0307415_100674285
530 Ga0307507_10005212
531 Ga0307507_10010746
532 Ga0307510_10030041
533 Ga0307510_10030484
534 Ga0307510_10096452
535 Ga0373926_0077901
536 Ga0373934_0033634
537 Ga0373923_0037001
538 Ga0373936_0331614
539 Ga0373953_0068889
540 Ga0373956_0085480
541 Ga0373957_0068361
542 Ga0373946_0008064
543 Ga0373955_0041960
544 Ga0373931_0247801
545 Ga0373935_0357278
546 Ga0373947_0030027
547 Ga0373947_0228711
548 Ga0373937_0077463
549 Ga0373925_0034037
550 Ga0395900_0493238
551 Ga0395900_0830851
552 Ga0395898_0007272
553 Ga0395901_0641522
554 Ga0439436_0010550
555 Ga0451837_0083936
556 Ga0451843_0167119
557 Ga0451853_1526283
558 Ga0451853_3660180
559 Ga0439448_0034893
560 Ga0439432_068971
561 Ga0439449_0001341
562 Ga0439455_0010123
563 Ga0439457_001645
564 Ga0450894_011143
565 Ga0450896_000733
566 Ga0450898_002627
567 Ga0450903_000102
568 Ga0450903_004372
569 Ga0450906_003648
570 Ga0439458_0003922
571 Ga0450908_006633
572 Ga0466969_0027814
573 Ga0466972_0001461
574 Ga0466972_0006210
575 Ga0466972_0040010
576 Ga0466972_0053419
577 Ga0466965_0008698
578 Ga0466965_0194258
579 Ga0466966_0020962
580 Ga0466966_0047573
581 Ga0466961_0007830
582 Ga0466961_0010007
583 Ga0466961_0013137
584 Ga0466963_0002052
585 Ga0466963_0016576
586 Ga0466971_0004523
587 Ga0466968_0004389
588 Ga0466970_0001053
589 Ga0466970_0001485
590 Ga0466957_0017612
591 Ga0466957_0372775
592 Ga0466960_0024762
593 Ga0466959_0469189
594 Ga0466958_0007829
595 Ga0466967_0002157
596 Ga0466967_0221393
597 Ga0466967_1224566
598 Ga0495592_0015536
599 Ga0495603_0016402
600 Ga0495603_0240200
601 Ga0495590_0060515
602 Ga0495629_0002554
603 Ga0495629_0011067
604 Ga0495629_0016195
605 Ga0495629_0020337
606 Ga0495629_0061299
607 Ga0495629_0437423
608 Ga0495638_0273401
609 Ga0495641_0006050
610 Ga0495651_0026258
611 Ga0495653_0012402
612 Ga0495653_0075251
613 Ga0495580_0130284
614 Ga0495582_0005608
615 Ga0495582_0034848
616 Ga0495582_0427590
617 Ga0495605_0096508
618 Ga0495662_0001041
619 Ga0495662_0004088
620 Ga0495662_0004821
621 Ga0495662_0012262
622 Ga0495664_0009682
623 Ga0495664_0010293
624 Ga0495664_0084432
625 Ga0495584_0297800
626 Ga0495585_0202293
627 Ga0495594_0002133
628 Ga0495596_0081142
629 Ga0495607_0341713
630 Ga0495583_0028901
631 Ga0495606_0020417
632 Ga0495608_0007981
633 Ga0495608_0122748
634 Ga0495610_0046109
635 Ga0495616_0127618
636 Ga0495618_0008973
637 Ga0495620_0074316
638 Ga0495620_0090087
639 Ga0495628_0014168
640 Ga0495628_0034268
641 Ga0495628_0073666
642 Ga0495630_0051553
643 Ga0495631_0051886
644 Ga0495643_0050556
645 Ga0495643_0182488
646 Ga0495666_0024308
647 Ga0495666_0031710
648 Ga0495666_0286351
649 Ga0495652_0086976
650 Ga0495652_0090664
651 Ga0495665_0001348
652 Ga0495640_0001549
653 Ga0495640_0013160
654 Ga0495586_0041293
655 Ga0495587_0009317
656 Ga0495609_0030887
657 Ga0495597_0035704
658 Ga0495645_0061986
659 Ga0495622_0031142
660 Ga0495622_0036282
661 Ga0495622_0047056
662 Ga0495633_0085139
663 Ga0495667_0023394
664 Ga0495667_0109795
665 Ga0495667_0286662
666 Ga0495668_0000184
667 Ga0495668_0228871
668 Ga0495634_0001513
669 Ga0495634_0095452
670 Ga0495634_0109274
671 Ga0495625_0001986
672 Ga0495625_0005261
673 Ga0495625_0528099
674 Ga0495625_0531634
675 Ga0495635_0012314
676 Ga0495635_0013598
677 Ga0495635_0088053
678 Ga0495635_0195060
679 Ga0495661_0241452
680 Ga0495588_0008208
681 Ga0495588_0035873
682 Ga0495588_0050671
683 Ga0495588_0228694
684 Ga0495657_0001322
685 Ga0495657_0009042
686 Ga0495657_0021966
687 Ga0495657_0023059
688 Ga0495657_0054790
689 Ga0495657_0064462
690 Ga0495657_0079066
691 Ga0495599_0397911
692 Ga0495623_0056773
693 Ga0495647_0091382
694 Ga0495658_0007329
695 Ga0495658_0021307
696 Ga0495613_0004862
697 Ga0495613_0005185
698 Ga0495613_0011516
699 Ga0495613_0091360
700 Ga0495613_0114765
701 Ga0495613_0201513
702 Ga0495613_0353440
703 Ga0495624_0001394
704 Ga0495624_0171421
705 Ga0495624_0214442
706 Ga0495671_0010535
707 Ga0495671_0225369
708 Ga0495649_0043824
709 Ga0495649_0162880
710 Ga0495649_0169369
711 Ga0495589_0066674
712 Ga0495600_0050492
713 Ga0495600_0247932
714 Ga0495581_0013037
715 Ga0495581_0017071
716 Ga0495581_0028748
717 Ga0495604_0005845
718 Ga0495604_0032947
719 Ga0495604_0064335
720 Ga0495604_0232997
721 Ga0495636_0021406
722 Ga0495636_0050892
723 Ga0495674_0010621
724 Ga0495674_0064701
725 Ga0495674_0244913
726 Ga0495676_0006846
727 Ga0495676_0009946
728 Ga0495676_0034429
729 Ga0495676_0047296
730 Ga0495676_0175500
731 Ga0495676_0566351
732 Ga0495680_0080607
733 Ga0495680_0137077
734 Ga0495687_004735
735 Ga0495687_033705
736 Ga0495687_077324
737 Ga0495675_0050470
738 Ga0495675_0051566
739 Ga0495685_019059
740 Ga0495685_041752
741 Ga0495673_0152650
742 Ga0495681_0007962
743 Ga0495681_0111449
744 Ga0495684_0020692
745 Ga0495686_0025096
746 Ga0495593_0008335
747 Ga0495593_0054431
748 Ga0495593_0119234
749 Ga0495593_0139246
750 Ga0495602_0002426
751 Ga0495602_0316289
752 Ga0495614_0003445
753 Ga0495614_0006225
754 Ga0495614_0007373
755 Ga0495614_0083142
756 Ga0495614_0091199
757 Ga0495626_0000106
758 Ga0495626_0091684
759 Ga0496104_0959895
760 Ga0496108_0538620
761 Ga0496110_0801224
762 Ga0496112_0482686
763 Ga0496113_0169309
764 Ga0496114_0074084
765 Ga0496126_0102503
766 Ga0501032_0003232
767 Ga0501032_0009610
768 Ga0501033_0004235
769 Ga0501033_0028971
770 Ga0501033_0042575
771 Ga0501033_0301340
772 Ga0501034_0007906
773 Ga0501034_0009838
774 Ga0501034_0049105
775 Ga0501034_0077341
776 Ga0501036_0002232
777 Ga0501036_0026775
778 Ga0501036_0053747
779 Ga0501036_0194102
780 Ga0501036_0242346
781 Ga0501037_0004243
782 Ga0501037_0025369
783 Ga0501037_0095565
784 Ga0501038_0007085
785 Ga0501038_0037126
786 Ga0501038_0084069
787 Ga0501038_0491079
788 Ga0501038_0541848
789 Ga0501039_0005727
790 Ga0501039_0169232
791 Ga0501042_0147209
792 Ga0501043_0036420
793 Ga0501043_0149379
794 Ga0501046_0250710
795 Ga0501046_0301495
796 Ga0501047_0005169
797 Ga0501047_0046661
798 Ga0501047_0049541
799 Ga0501047_0062685
800 Ga0501047_0092892
801 Ga0501047_0375606
802 Ga0501047_0382701
803 Ga0501048_0201971
804 Ga0501068_0317974
805 Ga0501069_0053919
806 Ga0501070_0002851
807 Ga0501070_0083286
808 Ga0501070_0118610
809 Ga0501073_0148647
810 Ga0501074_0002212
811 Ga0501225_0083448
812 Ga0501035_0004519
813 Ga0501035_0006312
814 Ga0501035_0036109
815 Ga0501035_0050345
816 Ga0501044_0018057
817 Ga0501044_0049201
818 Ga0501044_0079921
819 Ga0501044_0092494
820 Ga0501044_0247442
821 Ga0501044_0347044
822 Ga0501044_0530936
823 Ga0501044_0590530
824 Ga0501044_0714405
825 nmdc:mga03n38_213430_c1
826 nmdc:mga03n38_38040_c1
827 nmdc:mga03n38_71121_c1
828 nmdc:mga06z11_175870_c1
829 nmdc:mga07m45_333775_c1
830 Ga0495601_0030676
831 Ga0495612_0022508
832 Ga0495612_0045823
833 Ga0495595_0044766
834 Ga0495595_0272767
835 Ga0495595_0312102
836 Ga0495619_0123292
837 Ga0495619_0314156
838 Ga0495619_0409106
839 Ga0495619_0602343
840 Ga0500583_0026258
841 Ga0500640_017121
842 Ga0500660_093227
843 Ga0500553_014474
844 Ga0500553_092226
845 Ga0500572_006351
846 Ga0500614_023613
847 Ga0500600_0126462
848 Ga0500636_0151578
849 Ga0466962_0000134
850 Ga0466962_0064153
851 2547407574
852 2552112753
853 2585309332
854 2585316622
855 2616699832
856 2616905764
857 2644019036
858 2644180169
859 2644264687
860 2644388796
861 2671836919
862 2676494525
863 2689962044
864 2774855075
865 2785372383
866 2786673516
867 2808914375
868 2812353413
869 2812477871
870 2856742346
871 2862186600
872 2862283695
873 2862296670
874 2862383631
875 2862707031
876 2863409471
877 2867434158
878 2873151999
879 2877678273
880 2887483212
881 2891400890
882 2891561555
883 2891566165
884 2895438240
885 2912716774
886 2912764504
887 2935390976
888 2954383178
889 2954679822
890 2954684331
891 2954693887
892 2954708998
893 2954713514
894 2954723479
895 2954738352
896 2954742382
897 2954757212
898 2954761352
899 2990067879
900 2997453603
901 2997607374
902 3006321792
903 8008488692
904 8008563747
905 8008576412
906 8025480918
907 8025527540
908 8048412880
909 8054164661
910 8056214820
911 8056668635
912 8056829783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13305

TetR_C_33

Tetracyclin repressor-like, C-terminal domain

82

180

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.926 6 184
1zk8-assembly1.cif.gz_B crystal structure of transcriptional regulator from bacillus cereus atcc 14579 0.9161 6 184
3bqy-assembly1.cif.gz_A-2 crystal structure of a possible tetr family transcriptional regulator from streptomyces coelicolor a3(2). 0.7994 8 187
3on2-assembly3.cif.gz_C structure of a protein with unknown function from rhodococcus sp. rha1 0.7942 4 184
6rxb-assembly1.cif.gz_A crystal structure of tetr-q116a from acinetobacter baumannii aye in complex with minocycline 0.7904 5 189
ID Description Score Start End Superfamily
1zk8B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9577 6 49 1.10.10.60
1zk8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9511 5 49 1.10.10.60
3fiwB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9469 9 56 1.10.10.60
3fiwD01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9421 9 53 1.10.10.60
2y31B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.941 6 53 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2G7EDJ0-F1-model_v4 deleted 0.9869 1 193
AF-A0A7W3M4S4-F1-model_v4 deleted 0.985 1 191
AF-S2YPR4-F1-model_v4 HTH-type transcriptional regulator MT1864/Rv1816-like C-terminal domain-containing protein 0.984 58 193 GO:0003677
AF-A0A560X398-F1-model_v4 TetR family transcriptional regulator 0.9836 1 192 GO:0003677
GO:0006355
AF-A0A2G7EDJ0-F1-model_v4 deleted 0.9819 1 193

Map