F447851

General Info

Members Datasets Scaffolds Average Seq Length
456 250 912 169

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0433641|Ga0495594_0433641_80_676
Length 198
Sequence MVKPLPDEDIPFNVLFLCTGNSARSILAERLVEHWGKGRFRGFSAGSHPRGTVHPIAIELLEHMHLPTAGSRSKSWDEFAVSGAPRLDFVFTVCDAAAGEVCPVWPGQPMTAHWGVPDPAAVRGADSVRWLAFRNAFRELENRIKIFTSLPIRTLDRMKLKEQLDAIGNTHVDDATRRCRASRLRYGAAGLKPPRPLR

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
152 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
174 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
175 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
183 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
184 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
185 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
224 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 3.07
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0433641 3300046499 Bacteria 747
2 JGI25406J46586_10010118 3300003203 Bacteria 4196
3 rootH1_10212736 3300003323 Bacteria 1625
4 Ga0070658_10130217 3300005327 Bacteria 2096
5 Ga0070658_10149412 3300005327 Bacteria 1955
6 Ga0070683_100047622 3300005329 Bacteria 3962
7 Ga0070683_100097531 3300005329 Bacteria 2765
8 Ga0070683_100868446 3300005329 Bacteria 865
9 Ga0070683_101359967 3300005329 Bacteria 682
10 Ga0070690_101251406 3300005330 Bacteria 593
11 Ga0070670_100527752 3300005331 Bacteria 1052
12 Ga0070677_10044655 3300005333 Bacteria 1764
13 Ga0070666_10129410 3300005335 Bacteria 1753
14 Ga0070680_100095420 3300005336 Bacteria 2465
15 Ga0068868_100051833 3300005338 Bacteria 3229
16 Ga0068868_101297721 3300005338 Bacteria 676
17 Ga0070660_100337633 3300005339 Bacteria 1239
18 Ga0070661_100017352 3300005344 Bacteria 5107
19 Ga0070661_100019500 3300005344 Bacteria 4833
20 Ga0070661_100067695 3300005344 Bacteria 2624
21 Ga0070668_100003994 3300005347 Bacteria 10921
22 Ga0070669_100361619 3300005353 Bacteria 1180
23 Ga0070669_101403726 3300005353 Bacteria 606
24 Ga0070675_100033922 3300005354 Bacteria 4139
25 Ga0070671_100096520 3300005355 Bacteria 2479
26 Ga0070674_100383590 3300005356 Bacteria 1144
27 Ga0070673_100447998 3300005364 Bacteria 1161
28 Ga0070667_100262698 3300005367 Bacteria 1546
29 Ga0070667_100272292 3300005367 Bacteria 1518
30 Ga0070709_10385727 3300005434 Bacteria 1043
31 Ga0070713_100040051 3300005436 Bacteria 3807
32 Ga0070713_100361755 3300005436 Bacteria 1348
33 Ga0070713_100391388 3300005436 Bacteria 1297
34 Ga0070713_100575444 3300005436 Bacteria 1068
35 Ga0070711_100174478 3300005439 Bacteria 1641
36 Ga0070663_100001789 3300005455 Bacteria 11961
37 Ga0070663_100068066 3300005455 Bacteria 2584
38 Ga0070662_100006967 3300005457 Bacteria 7314
39 Ga0070681_10005046 3300005458 Bacteria 12729
40 Ga0070681_10064917 3300005458 Bacteria 3620
41 Ga0070681_10088355 3300005458 Bacteria 3051
42 Ga0070681_10302267 3300005458 Bacteria 1510
43 Ga0068867_100141109 3300005459 Bacteria 1883
44 Ga0068867_100416806 3300005459 Bacteria 1136
45 Ga0070685_10256414 3300005466 Bacteria 1161
46 Ga0070679_100000226 3300005530 Bacteria 46282
47 Ga0070679_100094379 3300005530 Bacteria 2978
48 Ga0070679_100118553 3300005530 Bacteria 2631
49 Ga0070684_100018514 3300005535 Bacteria 5739
50 Ga0070684_100032105 3300005535 Bacteria 4473
51 Ga0070684_100132252 3300005535 Bacteria 2251
52 Ga0070684_101245545 3300005535 Bacteria 700
53 Ga0070697_100175632 3300005536 Bacteria 1814
54 Ga0068853_100004368 3300005539 Bacteria 10942
55 Ga0068853_100119996 3300005539 Bacteria 2344
56 Ga0068853_100652949 3300005539 Bacteria 1001
57 Ga0070672_100010623 3300005543 Bacteria 6392
58 Ga0070672_100341784 3300005543 Bacteria 1275
59 Ga0070695_100045874 3300005545 Bacteria 2787
60 Ga0070696_100631282 3300005546 Bacteria 867
61 Ga0070693_100163241 3300005547 Bacteria 1421
62 Ga0070665_100588641 3300005548 Bacteria 1125
63 Ga0070704_100179139 3300005549 Bacteria 1694
64 Ga0068855_100002133 3300005563 Bacteria 24480
65 Ga0068855_100027679 3300005563 Bacteria 6782
66 Ga0068855_100030239 3300005563 Bacteria 6478
67 Ga0068855_100086957 3300005563 Bacteria 3614
68 Ga0068855_100155483 3300005563 Bacteria 2598
69 Ga0070664_100278745 3300005564 Bacteria 1507
70 Ga0068857_100076403 3300005577 Bacteria 2987
71 Ga0068857_100458983 3300005577 Bacteria 1192
72 Ga0068854_100020044 3300005578 Bacteria 4515
73 Ga0068854_100063432 3300005578 Bacteria 2682
74 Ga0068854_100110859 3300005578 Bacteria 2070
75 Ga0068856_100002879 3300005614 Bacteria 17604
76 Ga0068856_100026428 3300005614 Bacteria 5661
77 Ga0068856_100099883 3300005614 Bacteria 2893
78 Ga0068856_100129459 3300005614 Bacteria 2528
79 Ga0068856_100398185 3300005614 Bacteria 1397
80 Ga0068856_100839798 3300005614 Bacteria 938
81 Ga0070702_100330116 3300005615 Bacteria 1066
82 Ga0068852_100000027 3300005616 Bacteria 113819
83 Ga0068852_100000172 3300005616 Bacteria 43636
84 Ga0068852_100028757 3300005616 Bacteria 4555
85 Ga0068852_100552053 3300005616 Bacteria 1152
86 Ga0068859_101228437 3300005617 Bacteria 825
87 Ga0068864_100502195 3300005618 Bacteria 1167
88 Ga0068864_101635381 3300005618 Bacteria 648
89 Ga0068861_100403532 3300005719 Bacteria 1213
90 Ga0068851_10012204 3300005834 Bacteria 4046
91 Ga0068863_100263555 3300005841 Bacteria 1666
92 Ga0068863_100864502 3300005841 Bacteria 903
93 Ga0068862_100613170 3300005844 Bacteria 1046
94 Ga0081455_10003872 3300005937 Bacteria 17048
95 Ga0081538_10000859 3300005981 Bacteria 32758
96 Ga0081539_10000028 3300005985 Bacteria 328182
97 Ga0070717_10094774 3300006028 Bacteria 2526
98 Ga0070717_10201508 3300006028 Bacteria 1743
99 Ga0070717_10359939 3300006028 Bacteria 1302
100 Ga0070717_10495920 3300006028 Bacteria 1103
101 Ga0070715_10249364 3300006163 Bacteria 927
102 Ga0070716_100001468 3300006173 Bacteria 10513
103 Ga0070716_100576402 3300006173 Bacteria 843
104 Ga0070712_100028682 3300006175 Bacteria 3725
105 Ga0070712_100136841 3300006175 Bacteria 1864
106 Ga0070712_100297954 3300006175 Bacteria 1304
107 Ga0068871_100069597 3300006358 Bacteria 2890
108 Ga0068871_100406484 3300006358 Bacteria 1213
109 Ga0075428_100536985 3300006844 Bacteria 1250
110 Ga0075431_101455449 3300006847 Bacteria 644
111 Ga0075434_100187496 3300006871 Bacteria 2089
112 Ga0097620_101228452 3300006931 Bacteria 825
113 Ga0075435_100964457 3300007076 Bacteria 744
114 Ga0105240_10000222 3300009093 Bacteria 113825
115 Ga0105240_10039103 3300009093 Bacteria 6078
116 Ga0105240_10179895 3300009093 Bacteria 2496
117 Ga0105240_10219921 3300009093 Bacteria 2213
118 Ga0105240_10367357 3300009093 Bacteria 1628
119 Ga0105240_10425170 3300009093 Bacteria 1491
120 Ga0111539_10067860 3300009094 Bacteria 4211
121 Ga0111539_10535704 3300009094 Bacteria 1364
122 Ga0105245_10705608 3300009098 Bacteria 1042
123 Ga0105243_10490212 3300009148 Bacteria 1162
124 Ga0105241_10027342 3300009174 Bacteria 4248
125 Ga0105241_10086936 3300009174 Bacteria 2459
126 Ga0105241_10172904 3300009174 Bacteria 1785
127 Ga0105241_10180882 3300009174 Bacteria 1749
128 Ga0105241_10680815 3300009174 Bacteria 937
129 Ga0105242_10100238 3300009176 Bacteria 2453
130 Ga0105248_10006318 3300009177 Bacteria 13001
131 Ga0105248_10030772 3300009177 Bacteria 5996
132 Ga0105248_10481584 3300009177 Bacteria 1399
133 Ga0105248_10520586 3300009177 Bacteria 1341
134 Ga0105248_10845285 3300009177 Bacteria 1033
135 Ga0105237_10188157 3300009545 Bacteria 2065
136 Ga0105237_10424700 3300009545 Bacteria 1335
137 Ga0105237_10572666 3300009545 Bacteria 1136
138 Ga0105238_10059722 3300009551 Bacteria 3819
139 Ga0105238_10232807 3300009551 Bacteria 1819
140 Ga0105238_10661678 3300009551 Bacteria 1055
141 Ga0105249_11206524 3300009553 Bacteria 828
142 Ga0105239_10116552 3300010375 Bacteria 2964
143 Ga0105239_12227271 3300010375 Bacteria 637
144 Ga0157373_10321809 3300013100 Bacteria 1100
145 Ga0157371_10082350 3300013102 Bacteria 2278
146 Ga0157371_10119777 3300013102 Bacteria 1871
147 Ga0157370_10000012 3300013104 Bacteria 201181
148 Ga0157370_10007377 3300013104 Bacteria 11986
149 Ga0157370_10070753 3300013104 Bacteria 3293
150 Ga0157370_10342732 3300013104 Bacteria 1377
151 Ga0157370_10503721 3300013104 Bacteria 1112
152 Ga0157370_10572398 3300013104 Bacteria 1035
153 Ga0157369_10000112 3300013105 Bacteria 114309
154 Ga0157369_10009468 3300013105 Bacteria 11139
155 Ga0157369_10028548 3300013105 Bacteria 6174
156 Ga0157369_10068155 3300013105 Bacteria 3822
157 Ga0157369_10166205 3300013105 Bacteria 2327
158 Ga0157369_10204763 3300013105 Unclassified 2070
159 Ga0157369_11556975 3300013105 Bacteria 672
160 Ga0157374_10002868 3300013296 Bacteria 14463
161 Ga0157374_10005586 3300013296 Bacteria 10591
162 Ga0157374_10007255 3300013296 Bacteria 9442
163 Ga0157374_10617361 3300013296 Bacteria 1095
164 Ga0157378_10442671 3300013297 Bacteria 1288
165 Ga0157378_11551218 3300013297 Bacteria 708
166 Ga0163162_10072088 3300013306 Bacteria 3508
167 Ga0163162_10094668 3300013306 Bacteria 3073
168 Ga0163162_10183046 3300013306 Bacteria 2221
169 Ga0157372_10000111 3300013307 Bacteria 86033
170 Ga0157372_10004034 3300013307 Bacteria 15745
171 Ga0157372_10028317 3300013307 Bacteria 6114
172 Ga0157372_10104205 3300013307 Bacteria 3242
173 Ga0157372_10152857 3300013307 Bacteria 2664
174 Ga0157375_10256006 3300013308 Bacteria 1912
175 Ga0163163_10466418 3300014325 Bacteria 1323
176 Ga0163163_11661760 3300014325 Bacteria 699
177 Ga0157380_10036708 3300014326 Bacteria 3793
178 Ga0157380_10141390 3300014326 Bacteria 2068
179 Ga0157380_11212210 3300014326 Bacteria 799
180 Ga0157377_10125441 3300014745 Bacteria 1561
181 Ga0157379_10275910 3300014968 Bacteria 1529
182 Ga0157379_10402000 3300014968 Bacteria 1259
183 Ga0157376_10068874 3300014969 Bacteria 2998
184 Ga0157376_10292540 3300014969 Bacteria 1538
185 Ga0224572_1001939 3300024225 Bacteria 3220
186 Ga0228598_1013336 3300024227 Bacteria 1628
187 Ga0228598_1015605 3300024227 Bacteria 1499
188 Ga0207680_10128341 3300025903 Bacteria 1668
189 Ga0207680_10174775 3300025903 Bacteria 1449
190 Ga0207699_10081611 3300025906 Bacteria 2006
191 Ga0207645_10737283 3300025907 Bacteria 670
192 Ga0207705_10061901 3300025909 Bacteria 2703
193 Ga0207654_10000141 3300025911 Bacteria 46154
194 Ga0207654_10017810 3300025911 Bacteria 3721
195 Ga0207654_10018138 3300025911 Bacteria 3690
196 Ga0207654_10087266 3300025911 Bacteria 1893
197 Ga0207707_10014823 3300025912 Bacteria 6789
198 Ga0207707_10020773 3300025912 Bacteria 5735
199 Ga0207707_10167285 3300025912 Bacteria 1921
200 Ga0207695_10000028 3300025913 Bacteria 551835
201 Ga0207695_10003302 3300025913 Bacteria 22901
202 Ga0207695_10011952 3300025913 Bacteria 10452
203 Ga0207695_10033475 3300025913 Bacteria 5603
204 Ga0207695_10076103 3300025913 Bacteria 3413
205 Ga0207695_10091938 3300025913 Bacteria 3046
206 Ga0207695_10530103 3300025913 Bacteria 1059
207 Ga0207671_10000243 3300025914 Bacteria 81274
208 Ga0207671_10057872 3300025914 Bacteria 2873
209 Ga0207671_10078623 3300025914 Bacteria 2471
210 Ga0207671_10506477 3300025914 Bacteria 962
211 Ga0207693_10079745 3300025915 Bacteria 2562
212 Ga0207693_10284611 3300025915 Bacteria 1295
213 Ga0207663_10016429 3300025916 Bacteria 4104
214 Ga0207663_10357737 3300025916 Bacteria 1107
215 Ga0207660_10159582 3300025917 Bacteria 1739
216 Ga0207660_10577306 3300025917 Bacteria 915
217 Ga0207657_10019157 3300025919 Bacteria 6508
218 Ga0207649_10011790 3300025920 Bacteria 4833
219 Ga0207649_10240777 3300025920 Bacteria 1299
220 Ga0207652_10002992 3300025921 Bacteria 14111
221 Ga0207681_10134456 3300025923 Bacteria 1833
222 Ga0207681_10394307 3300025923 Bacteria 1117
223 Ga0207694_11159205 3300025924 Bacteria 654
224 Ga0207659_10520173 3300025926 Bacteria 1009
225 Ga0207687_10003939 3300025927 Bacteria 9939
226 Ga0207700_10050279 3300025928 Bacteria 3106
227 Ga0207700_10481079 3300025928 Bacteria 1097
228 Ga0207700_10718884 3300025928 Bacteria 892
229 Ga0207664_10400834 3300025929 Bacteria 1220
230 Ga0207664_11012556 3300025929 Unclassified 744
231 Ga0207644_10155044 3300025931 Bacteria 1775
232 Ga0207706_10008433 3300025933 Bacteria 9510
233 Ga0207686_10037939 3300025934 Bacteria 2911
234 Ga0207704_10567952 3300025938 Bacteria 924
235 Ga0207691_10022017 3300025940 Bacteria 6015
236 Ga0207691_10026524 3300025940 Bacteria 5436
237 Ga0207691_10038541 3300025940 Bacteria 4423
238 Ga0207711_10004680 3300025941 Bacteria 11625
239 Ga0207711_10007589 3300025941 Bacteria 9075
240 Ga0207711_10224999 3300025941 Bacteria 1717
241 Ga0207711_10417198 3300025941 Bacteria 1248
242 Ga0207711_10497813 3300025941 Bacteria 1136
243 Ga0207689_10013302 3300025942 Bacteria 7020
244 Ga0207689_10215489 3300025942 Bacteria 1587
245 Ga0207661_10036924 3300025944 Bacteria 3817
246 Ga0207661_10072204 3300025944 Bacteria 2823
247 Ga0207661_10125563 3300025944 Bacteria 2191
248 Ga0207661_10249598 3300025944 Bacteria 1577
249 Ga0207679_10078053 3300025945 Bacteria 2521
250 Ga0207667_10000188 3300025949 Bacteria 90598
251 Ga0207667_10002502 3300025949 Bacteria 22911
252 Ga0207667_10004376 3300025949 Bacteria 17293
253 Ga0207667_10006249 3300025949 Bacteria 14456
254 Ga0207667_10031889 3300025949 Bacteria 5683
255 Ga0207667_10072985 3300025949 Bacteria 3567
256 Ga0207667_10124947 3300025949 Bacteria 2650
257 Ga0207667_10603915 3300025949 Bacteria 1106
258 Ga0207667_10786178 3300025949 Bacteria 949
259 Ga0207667_10864466 3300025949 Bacteria 898
260 Ga0207712_10033115 3300025961 Bacteria 3492
261 Ga0207668_10026102 3300025972 Bacteria 3789
262 Ga0207640_10041496 3300025981 Bacteria 2927
263 Ga0207658_10128362 3300025986 Bacteria 2033
264 Ga0207658_10232770 3300025986 Bacteria 1556
265 Ga0207677_10078421 3300026023 Bacteria 2359
266 Ga0207703_10073963 3300026035 Bacteria 2820
267 Ga0207639_10000093 3300026041 Bacteria 74952
268 Ga0207639_10399251 3300026041 Bacteria 1238
269 Ga0207639_10436956 3300026041 Bacteria 1186
270 Ga0207639_10732801 3300026041 Bacteria 918
271 Ga0207678_10001482 3300026067 Bacteria 21533
272 Ga0207678_10046984 3300026067 Bacteria 3733
273 Ga0207702_10000821 3300026078 Bacteria 32768
274 Ga0207702_10020168 3300026078 Bacteria 5522
275 Ga0207702_10054357 3300026078 Bacteria 3393
276 Ga0207702_10252064 3300026078 Bacteria 1658
277 Ga0207702_10415098 3300026078 Bacteria 1300
278 Ga0207702_10449573 3300026078 Bacteria 1250
279 Ga0207641_10699033 3300026088 Bacteria 998
280 Ga0207641_11299936 3300026088 Bacteria 728
281 Ga0207648_10121434 3300026089 Bacteria 2297
282 Ga0207676_10982837 3300026095 Bacteria 831
283 Ga0207674_10486684 3300026116 Bacteria 1192
284 Ga0207674_11376347 3300026116 Bacteria 675
285 Ga0207675_100179235 3300026118 Bacteria 2028
286 Ga0207683_10022737 3300026121 Bacteria 5385
287 Ga0207683_10143569 3300026121 Bacteria 2152
288 Ga0207683_10565217 3300026121 Bacteria 1052
289 Ga0207698_10000021 3300026142 Bacteria 133280
290 Ga0207698_10001171 3300026142 Bacteria 15278
291 Ga0207698_10017632 3300026142 Bacteria 4851
292 Ga0207698_10028029 3300026142 Bacteria 4009
293 Ga0207698_10073024 3300026142 Bacteria 2730
294 Ga0207698_10235517 3300026142 Bacteria 1665
295 Ga0268266_10224343 3300028379 Bacteria 1729
296 Ga0268265_10033599 3300028380 Bacteria 3731
297 Ga0268265_10148444 3300028380 Bacteria 1974
298 Ga0265318_10028924 3300028577 Bacteria 2163
299 Ga0265336_10002655 3300028666 Bacteria 7259
300 Ga0265338_10002697 3300028800 Bacteria 26093
301 Ga0265338_10015290 3300028800 Bacteria 8446
302 Ga0265338_10019766 3300028800 Bacteria 7121
303 Ga0265338_10127363 3300028800 Bacteria 2018
304 Ga0265338_10213457 3300028800 Bacteria 1447
305 Ga0307511_10216432 3300030521 Bacteria 969
306 Ga0265765_1013834 3300030879 Bacteria 926
307 Ga0265760_10065057 3300031090 Bacteria 1112
308 Ga0265330_10000476 3300031235 Bacteria 26936
309 Ga0265330_10123936 3300031235 Bacteria 1101
310 Ga0265332_10010506 3300031238 Bacteria 4122
311 Ga0265328_10000164 3300031239 Bacteria 30575
312 Ga0265328_10005590 3300031239 Bacteria 5375
313 Ga0265328_10029596 3300031239 Bacteria 2044
314 Ga0265320_10017228 3300031240 Bacteria 4018
315 Ga0265325_10000253 3300031241 Bacteria 38196
316 Ga0265325_10010685 3300031241 Bacteria 5301
317 Ga0265329_10022117 3300031242 Bacteria 2130
318 Ga0265340_10030112 3300031247 Bacteria 2722
319 Ga0265339_10000046 3300031249 Bacteria 114399
320 Ga0265339_10004163 3300031249 Bacteria 9933
321 Ga0265339_10044803 3300031249 Bacteria 2438
322 Ga0265339_10054884 3300031249 Bacteria 2163
323 Ga0265339_10162409 3300031249 Bacteria 1123
324 Ga0265339_10215694 3300031249 Bacteria 941
325 Ga0265331_10031874 3300031250 Bacteria 2617
326 Ga0265331_10309803 3300031250 Bacteria 707
327 Ga0265316_10001776 3300031344 Bacteria 22748
328 Ga0265316_10004331 3300031344 Bacteria 14154
329 Ga0265316_10010271 3300031344 Bacteria 8542
330 Ga0265316_10077461 3300031344 Bacteria 2553
331 Ga0265316_10293700 3300031344 Bacteria 1185
332 Ga0265316_10392526 3300031344 Bacteria 1000
333 Ga0265316_10670953 3300031344 Bacteria 732
334 Ga0265316_10706388 3300031344 Bacteria 710
335 Ga0307513_10013933 3300031456 Bacteria 9853
336 Ga0307513_10015954 3300031456 Bacteria 9086
337 Ga0307513_10217420 3300031456 Bacteria 1736
338 Ga0265313_10000508 3300031595 Bacteria 40898
339 Ga0265313_10043661 3300031595 Bacteria 2193
340 Ga0265313_10068689 3300031595 Bacteria 1637
341 Ga0265313_10083399 3300031595 Bacteria 1447
342 Ga0265314_10029698 3300031711 Bacteria 4058
343 Ga0265314_10138312 3300031711 Bacteria 1509
344 Ga0265342_10004545 3300031712 Bacteria 10862
345 Ga0265342_10057081 3300031712 Bacteria 2312
346 Ga0265342_10134005 3300031712 Bacteria 1386
347 Ga0307405_10228011 3300031731 Bacteria 1371
348 Ga0307416_100185436 3300032002 Bacteria 1955
349 Ga0307416_100264727 3300032002 Bacteria 1683
350 Ga0307411_10573544 3300032005 Bacteria 966
351 Ga0307415_100048433 3300032126 Bacteria 2868
352 Ga0307415_101116891 3300032126 Bacteria 739
353 Ga0373940_0079760 3300035088 Bacteria 966
354 Ga0373940_0111633 3300035088 Bacteria 840
355 Ga0373931_0174094 3300035691 Bacteria 1270
356 Ga0373935_0687599 3300035692 Bacteria 752
357 Ga0373933_0133042 3300035724 Bacteria 1565
358 Ga0373947_0387978 3300035725 Bacteria 941
359 Ga0373937_0574702 3300036401 Bacteria 1070
360 Ga0395900_0822072 3300037418 Unclassified 856
361 Ga0436360_1109710 3300039438 Bacteria 923
362 Ga0436361_0233918 3300039447 Bacteria 1827
363 Ga0450898_044754 3300042134 Bacteria 845
364 Ga0450908_001127 3300042184 Bacteria 5197
365 Ga0466963_0001872 3300044694 Bacteria 11476
366 Ga0466958_0460412 3300045836 Bacteria 824
367 Ga0466967_0000364 3300045976 Bacteria 21039
368 Ga0495617_182872 3300046452 Bacteria 659
369 Ga0495603_0116018 3300046455 Bacteria 1561
370 Ga0495638_0122791 3300046460 Bacteria 1533
371 Ga0495638_0133231 3300046460 Bacteria 1458
372 Ga0495651_0049923 3300046462 Bacteria 3229
373 Ga0495582_0113294 3300046473 Bacteria 1524
374 Ga0495584_0145914 3300046491 Bacteria 1202
375 Ga0495585_0129558 3300046492 Bacteria 1329
376 Ga0495594_0000247 3300046499 Bacteria 26230
377 Ga0495583_0066002 3300046506 Bacteria 1602
378 Ga0495616_0013196 3300046513 Bacteria 4668
379 Ga0495632_0077060 3300046519 Bacteria 1594
380 Ga0495652_0101743 3300046529 Bacteria 2329
381 Ga0495665_0059949 3300046531 Bacteria 2009
382 Ga0495645_0059939 3300046543 Bacteria 2759
383 Ga0495622_0097143 3300046557 Bacteria 1351
384 Ga0495667_0165273 3300046559 Bacteria 1423
385 Ga0495625_0056983 3300046660 Bacteria 2780
386 Ga0495625_0157178 3300046660 Bacteria 1525
387 Ga0495625_0194286 3300046660 Bacteria 1343
388 Ga0495623_0171970 3300046679 Bacteria 1265
389 Ga0495646_0222856 3300046680 Bacteria 1019
390 Ga0495669_0104550 3300046684 Bacteria 1318
391 Ga0495669_0117875 3300046684 Bacteria 1243
392 Ga0495613_0030065 3300046689 Bacteria 4035
393 Ga0495649_0005071 3300046694 Bacteria 8459
394 Ga0495589_0096208 3300046794 Bacteria 1436
395 Ga0495581_0477224 3300047315 Bacteria 726
396 Ga0495604_0094910 3300047317 Bacteria 2204
397 Ga0495636_0060994 3300047318 Bacteria 1594
398 Ga0495672_0024795 3300047320 Bacteria 3856
399 Ga0495675_0290319 3300047444 Bacteria 973
400 Ga0495684_0536669 3300047471 Unclassified 799
401 Ga0495686_0184502 3300047472 Bacteria 1207
402 Ga0495593_0144603 3300047673 Bacteria 1204
403 Ga0495602_0217861 3300048088 Bacteria 1443
404 Ga0495614_0051051 3300048089 Bacteria 1772
405 Ga0496102_0346552 3300048905 Bacteria 1399
406 Ga0496102_0735666 3300048905 Bacteria 909
407 Ga0496103_0444560 3300048906 Unclassified 832
408 Ga0496104_1341587 3300048907 Bacteria 618
409 Ga0496105_0042700 3300048908 Bacteria 3739
410 Ga0496106_0101672 3300048909 Bacteria 2230
411 Ga0496108_0376789 3300048911 Bacteria 1239
412 Ga0496109_0148563 3300048912 Bacteria 2194
413 Ga0496110_0582637 3300048913 Bacteria 1016
414 Ga0496112_0080335 3300048915 Bacteria 3224
415 Ga0496112_0276303 3300048915 Bacteria 1627
416 Ga0496113_0962422 3300048916 Unclassified 673
417 Ga0496114_0159098 3300048917 Bacteria 1963
418 Ga0496114_0196460 3300048917 Bacteria 1766
419 Ga0496119_0259446 3300048922 Unclassified 873
420 Ga0496126_0000846 3300048929 Bacteria 54180
421 Ga0495682_0077468 3300049460 Bacteria 1196
422 Ga0501298_031836 3300049521 Bacteria 1039
423 Ga0501036_0190679 3300049572 Bacteria 1725
424 Ga0501036_0549434 3300049572 Bacteria 960
425 Ga0501039_0518241 3300049575 Bacteria 936
426 Ga0501042_0064633 3300049578 Bacteria 2615
427 Ga0501042_0209445 3300049578 Bacteria 1406
428 Ga0501068_0015366 3300049584 Bacteria 4394
429 Ga0501070_0157571 3300049586 Bacteria 1873
430 Ga0501071_0004453 3300049587 Bacteria 8890
431 Ga0501072_0091742 3300049588 Bacteria 2412
432 Ga0501072_0116711 3300049588 Bacteria 2126
433 Ga0501072_0185130 3300049588 Bacteria 1661
434 Ga0501073_0002144 3300049589 Bacteria 14758
435 Ga0501074_0067519 3300049590 Bacteria 2571
436 Ga0501075_0088236 3300049591 Bacteria 2351
437 Ga0501076_0187211 3300049592 Bacteria 1689
438 Ga0501077_0019759 3300049593 Bacteria 4261
439 Ga0501079_0010394 3300049741 Bacteria 7073
440 Ga0501079_0570102 3300049741 Bacteria 890
441 Ga0501080_0022187 3300049742 Bacteria 5880
442 Ga0501081_0005447 3300049743 Bacteria 8214
443 Ga0501081_0109201 3300049743 Bacteria 1962
444 Ga0501083_0043688 3300049744 Bacteria 3035
445 Ga0501035_0745421 3300049822 Bacteria 786
446 Ga0501044_0704727 3300049823 Bacteria 895
447 Ga0501045_0126118 3300049824 Bacteria 1902
448 Ga0501045_0236256 3300049824 Bacteria 1361
449 nmdc:mga08y16_237596_c1 3300050511 Bacteria 1884
450 nmdc:mga0n895_141182_c1 3300050512 Bacteria 2437
451 Ga0500611_106078 3300053727 Bacteria 733
452 Ga0501084_0002257 3300054114 Bacteria 15480
453 Ga0590071_035091 3300059421 Bacteria 1201
454 Ga0590071_055636 3300059421 Bacteria 962
455 Ga0501082_0258619 3300060353 Bacteria 1514
456 Ga0530510_0099029 3300061734 Bacteria 2132
457 Ga0495594_0433641
458 JGI25406J46586_10010118
459 rootH1_10212736
460 Ga0070658_10130217
461 Ga0070658_10149412
462 Ga0070683_100047622
463 Ga0070683_100097531
464 Ga0070683_100868446
465 Ga0070683_101359967
466 Ga0070690_101251406
467 Ga0070670_100527752
468 Ga0070677_10044655
469 Ga0070666_10129410
470 Ga0070680_100095420
471 Ga0068868_100051833
472 Ga0068868_101297721
473 Ga0070660_100337633
474 Ga0070661_100017352
475 Ga0070661_100019500
476 Ga0070661_100067695
477 Ga0070668_100003994
478 Ga0070669_100361619
479 Ga0070669_101403726
480 Ga0070675_100033922
481 Ga0070671_100096520
482 Ga0070674_100383590
483 Ga0070673_100447998
484 Ga0070667_100262698
485 Ga0070667_100272292
486 Ga0070709_10385727
487 Ga0070713_100040051
488 Ga0070713_100361755
489 Ga0070713_100391388
490 Ga0070713_100575444
491 Ga0070711_100174478
492 Ga0070663_100001789
493 Ga0070663_100068066
494 Ga0070662_100006967
495 Ga0070681_10005046
496 Ga0070681_10064917
497 Ga0070681_10088355
498 Ga0070681_10302267
499 Ga0068867_100141109
500 Ga0068867_100416806
501 Ga0070685_10256414
502 Ga0070679_100000226
503 Ga0070679_100094379
504 Ga0070679_100118553
505 Ga0070684_100018514
506 Ga0070684_100032105
507 Ga0070684_100132252
508 Ga0070684_101245545
509 Ga0070697_100175632
510 Ga0068853_100004368
511 Ga0068853_100119996
512 Ga0068853_100652949
513 Ga0070672_100010623
514 Ga0070672_100341784
515 Ga0070695_100045874
516 Ga0070696_100631282
517 Ga0070693_100163241
518 Ga0070665_100588641
519 Ga0070704_100179139
520 Ga0068855_100002133
521 Ga0068855_100027679
522 Ga0068855_100030239
523 Ga0068855_100086957
524 Ga0068855_100155483
525 Ga0070664_100278745
526 Ga0068857_100076403
527 Ga0068857_100458983
528 Ga0068854_100020044
529 Ga0068854_100063432
530 Ga0068854_100110859
531 Ga0068856_100002879
532 Ga0068856_100026428
533 Ga0068856_100099883
534 Ga0068856_100129459
535 Ga0068856_100398185
536 Ga0068856_100839798
537 Ga0070702_100330116
538 Ga0068852_100000027
539 Ga0068852_100000172
540 Ga0068852_100028757
541 Ga0068852_100552053
542 Ga0068859_101228437
543 Ga0068864_100502195
544 Ga0068864_101635381
545 Ga0068861_100403532
546 Ga0068851_10012204
547 Ga0068863_100263555
548 Ga0068863_100864502
549 Ga0068862_100613170
550 Ga0081455_10003872
551 Ga0081538_10000859
552 Ga0081539_10000028
553 Ga0070717_10094774
554 Ga0070717_10201508
555 Ga0070717_10359939
556 Ga0070717_10495920
557 Ga0070715_10249364
558 Ga0070716_100001468
559 Ga0070716_100576402
560 Ga0070712_100028682
561 Ga0070712_100136841
562 Ga0070712_100297954
563 Ga0068871_100069597
564 Ga0068871_100406484
565 Ga0075428_100536985
566 Ga0075431_101455449
567 Ga0075434_100187496
568 Ga0097620_101228452
569 Ga0075435_100964457
570 Ga0105240_10000222
571 Ga0105240_10039103
572 Ga0105240_10179895
573 Ga0105240_10219921
574 Ga0105240_10367357
575 Ga0105240_10425170
576 Ga0111539_10067860
577 Ga0111539_10535704
578 Ga0105245_10705608
579 Ga0105243_10490212
580 Ga0105241_10027342
581 Ga0105241_10086936
582 Ga0105241_10172904
583 Ga0105241_10180882
584 Ga0105241_10680815
585 Ga0105242_10100238
586 Ga0105248_10006318
587 Ga0105248_10030772
588 Ga0105248_10481584
589 Ga0105248_10520586
590 Ga0105248_10845285
591 Ga0105237_10188157
592 Ga0105237_10424700
593 Ga0105237_10572666
594 Ga0105238_10059722
595 Ga0105238_10232807
596 Ga0105238_10661678
597 Ga0105249_11206524
598 Ga0105239_10116552
599 Ga0105239_12227271
600 Ga0157373_10321809
601 Ga0157371_10082350
602 Ga0157371_10119777
603 Ga0157370_10000012
604 Ga0157370_10007377
605 Ga0157370_10070753
606 Ga0157370_10342732
607 Ga0157370_10503721
608 Ga0157370_10572398
609 Ga0157369_10000112
610 Ga0157369_10009468
611 Ga0157369_10028548
612 Ga0157369_10068155
613 Ga0157369_10166205
614 Ga0157369_10204763
615 Ga0157369_11556975
616 Ga0157374_10002868
617 Ga0157374_10005586
618 Ga0157374_10007255
619 Ga0157374_10617361
620 Ga0157378_10442671
621 Ga0157378_11551218
622 Ga0163162_10072088
623 Ga0163162_10094668
624 Ga0163162_10183046
625 Ga0157372_10000111
626 Ga0157372_10004034
627 Ga0157372_10028317
628 Ga0157372_10104205
629 Ga0157372_10152857
630 Ga0157375_10256006
631 Ga0163163_10466418
632 Ga0163163_11661760
633 Ga0157380_10036708
634 Ga0157380_10141390
635 Ga0157380_11212210
636 Ga0157377_10125441
637 Ga0157379_10275910
638 Ga0157379_10402000
639 Ga0157376_10068874
640 Ga0157376_10292540
641 Ga0224572_1001939
642 Ga0228598_1013336
643 Ga0228598_1015605
644 Ga0207680_10128341
645 Ga0207680_10174775
646 Ga0207699_10081611
647 Ga0207645_10737283
648 Ga0207705_10061901
649 Ga0207654_10000141
650 Ga0207654_10017810
651 Ga0207654_10018138
652 Ga0207654_10087266
653 Ga0207707_10014823
654 Ga0207707_10020773
655 Ga0207707_10167285
656 Ga0207695_10000028
657 Ga0207695_10003302
658 Ga0207695_10011952
659 Ga0207695_10033475
660 Ga0207695_10076103
661 Ga0207695_10091938
662 Ga0207695_10530103
663 Ga0207671_10000243
664 Ga0207671_10057872
665 Ga0207671_10078623
666 Ga0207671_10506477
667 Ga0207693_10079745
668 Ga0207693_10284611
669 Ga0207663_10016429
670 Ga0207663_10357737
671 Ga0207660_10159582
672 Ga0207660_10577306
673 Ga0207657_10019157
674 Ga0207649_10011790
675 Ga0207649_10240777
676 Ga0207652_10002992
677 Ga0207681_10134456
678 Ga0207681_10394307
679 Ga0207694_11159205
680 Ga0207659_10520173
681 Ga0207687_10003939
682 Ga0207700_10050279
683 Ga0207700_10481079
684 Ga0207700_10718884
685 Ga0207664_10400834
686 Ga0207664_11012556
687 Ga0207644_10155044
688 Ga0207706_10008433
689 Ga0207686_10037939
690 Ga0207704_10567952
691 Ga0207691_10022017
692 Ga0207691_10026524
693 Ga0207691_10038541
694 Ga0207711_10004680
695 Ga0207711_10007589
696 Ga0207711_10224999
697 Ga0207711_10417198
698 Ga0207711_10497813
699 Ga0207689_10013302
700 Ga0207689_10215489
701 Ga0207661_10036924
702 Ga0207661_10072204
703 Ga0207661_10125563
704 Ga0207661_10249598
705 Ga0207679_10078053
706 Ga0207667_10000188
707 Ga0207667_10002502
708 Ga0207667_10004376
709 Ga0207667_10006249
710 Ga0207667_10031889
711 Ga0207667_10072985
712 Ga0207667_10124947
713 Ga0207667_10603915
714 Ga0207667_10786178
715 Ga0207667_10864466
716 Ga0207712_10033115
717 Ga0207668_10026102
718 Ga0207640_10041496
719 Ga0207658_10128362
720 Ga0207658_10232770
721 Ga0207677_10078421
722 Ga0207703_10073963
723 Ga0207639_10000093
724 Ga0207639_10399251
725 Ga0207639_10436956
726 Ga0207639_10732801
727 Ga0207678_10001482
728 Ga0207678_10046984
729 Ga0207702_10000821
730 Ga0207702_10020168
731 Ga0207702_10054357
732 Ga0207702_10252064
733 Ga0207702_10415098
734 Ga0207702_10449573
735 Ga0207641_10699033
736 Ga0207641_11299936
737 Ga0207648_10121434
738 Ga0207676_10982837
739 Ga0207674_10486684
740 Ga0207674_11376347
741 Ga0207675_100179235
742 Ga0207683_10022737
743 Ga0207683_10143569
744 Ga0207683_10565217
745 Ga0207698_10000021
746 Ga0207698_10001171
747 Ga0207698_10017632
748 Ga0207698_10028029
749 Ga0207698_10073024
750 Ga0207698_10235517
751 Ga0268266_10224343
752 Ga0268265_10033599
753 Ga0268265_10148444
754 Ga0265318_10028924
755 Ga0265336_10002655
756 Ga0265338_10002697
757 Ga0265338_10015290
758 Ga0265338_10019766
759 Ga0265338_10127363
760 Ga0265338_10213457
761 Ga0307511_10216432
762 Ga0265765_1013834
763 Ga0265760_10065057
764 Ga0265330_10000476
765 Ga0265330_10123936
766 Ga0265332_10010506
767 Ga0265328_10000164
768 Ga0265328_10005590
769 Ga0265328_10029596
770 Ga0265320_10017228
771 Ga0265325_10000253
772 Ga0265325_10010685
773 Ga0265329_10022117
774 Ga0265340_10030112
775 Ga0265339_10000046
776 Ga0265339_10004163
777 Ga0265339_10044803
778 Ga0265339_10054884
779 Ga0265339_10162409
780 Ga0265339_10215694
781 Ga0265331_10031874
782 Ga0265331_10309803
783 Ga0265316_10001776
784 Ga0265316_10004331
785 Ga0265316_10010271
786 Ga0265316_10077461
787 Ga0265316_10293700
788 Ga0265316_10392526
789 Ga0265316_10670953
790 Ga0265316_10706388
791 Ga0307513_10013933
792 Ga0307513_10015954
793 Ga0307513_10217420
794 Ga0265313_10000508
795 Ga0265313_10043661
796 Ga0265313_10068689
797 Ga0265313_10083399
798 Ga0265314_10029698
799 Ga0265314_10138312
800 Ga0265342_10004545
801 Ga0265342_10057081
802 Ga0265342_10134005
803 Ga0307405_10228011
804 Ga0307416_100185436
805 Ga0307416_100264727
806 Ga0307411_10573544
807 Ga0307415_100048433
808 Ga0307415_101116891
809 Ga0373940_0079760
810 Ga0373940_0111633
811 Ga0373931_0174094
812 Ga0373935_0687599
813 Ga0373933_0133042
814 Ga0373947_0387978
815 Ga0373937_0574702
816 Ga0395900_0822072
817 Ga0436360_1109710
818 Ga0436361_0233918
819 Ga0450898_044754
820 Ga0450908_001127
821 Ga0466963_0001872
822 Ga0466958_0460412
823 Ga0466967_0000364
824 Ga0495617_182872
825 Ga0495603_0116018
826 Ga0495638_0122791
827 Ga0495638_0133231
828 Ga0495651_0049923
829 Ga0495582_0113294
830 Ga0495584_0145914
831 Ga0495585_0129558
832 Ga0495594_0000247
833 Ga0495583_0066002
834 Ga0495616_0013196
835 Ga0495632_0077060
836 Ga0495652_0101743
837 Ga0495665_0059949
838 Ga0495645_0059939
839 Ga0495622_0097143
840 Ga0495667_0165273
841 Ga0495625_0056983
842 Ga0495625_0157178
843 Ga0495625_0194286
844 Ga0495623_0171970
845 Ga0495646_0222856
846 Ga0495669_0104550
847 Ga0495669_0117875
848 Ga0495613_0030065
849 Ga0495649_0005071
850 Ga0495589_0096208
851 Ga0495581_0477224
852 Ga0495604_0094910
853 Ga0495636_0060994
854 Ga0495672_0024795
855 Ga0495675_0290319
856 Ga0495684_0536669
857 Ga0495686_0184502
858 Ga0495593_0144603
859 Ga0495602_0217861
860 Ga0495614_0051051
861 Ga0496102_0346552
862 Ga0496102_0735666
863 Ga0496103_0444560
864 Ga0496104_1341587
865 Ga0496105_0042700
866 Ga0496106_0101672
867 Ga0496108_0376789
868 Ga0496109_0148563
869 Ga0496110_0582637
870 Ga0496112_0080335
871 Ga0496112_0276303
872 Ga0496113_0962422
873 Ga0496114_0159098
874 Ga0496114_0196460
875 Ga0496119_0259446
876 Ga0496126_0000846
877 Ga0495682_0077468
878 Ga0501298_031836
879 Ga0501036_0190679
880 Ga0501036_0549434
881 Ga0501039_0518241
882 Ga0501042_0064633
883 Ga0501042_0209445
884 Ga0501068_0015366
885 Ga0501070_0157571
886 Ga0501071_0004453
887 Ga0501072_0091742
888 Ga0501072_0116711
889 Ga0501072_0185130
890 Ga0501073_0002144
891 Ga0501074_0067519
892 Ga0501075_0088236
893 Ga0501076_0187211
894 Ga0501077_0019759
895 Ga0501079_0010394
896 Ga0501079_0570102
897 Ga0501080_0022187
898 Ga0501081_0005447
899 Ga0501081_0109201
900 Ga0501083_0043688
901 Ga0501035_0745421
902 Ga0501044_0704727
903 Ga0501045_0126118
904 Ga0501045_0236256
905 nmdc:mga08y16_237596_c1
906 nmdc:mga0n895_141182_c1
907 Ga0500611_106078
908 Ga0501084_0002257
909 Ga0590071_035091
910 Ga0590071_055636
911 Ga0501082_0258619
912 Ga0530510_0099029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

14

148

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9573 5 144
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9433 5 144
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9355 5 143
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9193 5 144
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.9128 5 144
ID Description Score Start End Superfamily
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8908 6 142 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8743 8 144 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8707 7 142 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8641 7 143 3.40.50.2300
1y1lA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8612 8 144 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1X6ZFU8-F1-model_v4 Protein ArsC (EC 3.1.3.48) 0.9941 4 165 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A2V9GUH8-F1-model_v4 Protein-tyrosine-phosphatase 0.994 5 163 GO:0046685
AF-A0A529MMM0-F1-model_v4 Arsenate reductase ArsC 0.9935 22 141 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A4U0GJU3-F1-model_v4 Arsenate reductase ArsC 0.9931 4 164 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A3D3BC67-F1-model_v4 ArsR family transcriptional regulator 0.9931 19 164 GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map