F447828

General Info

Members Datasets Scaffolds Average Seq Length
456 273 912 260

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0056528|Ga0395901_0056528_2000_2890
Length 296
Sequence MVETVAVVKYLDIKIVRARETAMATTTWDPDQYARFSDHRSRPFGDLLARVGAVEPRLVVDLGCGNGPLTLTLADRWPGARVVGVDSSPEMLDAARSLDRDGRVEWVEADLSAWDLASLGAAPDVVVSNATLQWVPGHRDLLRAWAAALAPGGWLAMQVPGNLDAPSHRLMREVAAAHPAADRLRPALERLAVDEPAGYVELFAAAGLEVDAWETTYQHVLDPEGVQASPVLEWVRGTGLRPVLEALPDAGERDAFLGEYDARLRAAYPRTQVGVVFPFRRVFCVGHSARPAASGG

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
144 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
189 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
234 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
235 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
236 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
237 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
238 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
239 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
244 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
245 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
246 2643221679 Angustibacter sp. Root456 Isolate Unclassified
247 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
248 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
249 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
250 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
251 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
252 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
253 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
254 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
255 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
256 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
257 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
258 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
259 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
260 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
261 2922554459 Rhodococcus sp. 66b Isolate Unclassified
262 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
263 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
264 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
265 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
266 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
267 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
268 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
269 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
270 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
271 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
272 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
273 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.98
Metatranscriptomes 0.22
Isolates 6.8

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 4.61
Nodule 0
Rhizoplane 9.43
Rhizosphere 73.9
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0056528 3300038443 Bacteria 4082
2 JGI24737J22298_10019709 3300001990 Bacteria 2157
3 Ga0055540_1000207 3300003792 Bacteria 56613
4 Ga0055540_1002158 3300003792 Bacteria 10719
5 Ga0055540_1003148 3300003792 Bacteria 8157
6 Ga0070658_10002720 3300005327 Bacteria 14705
7 Ga0070658_10027913 3300005327 Bacteria 4530
8 Ga0070683_100148065 3300005329 Bacteria 2225
9 Ga0070670_100071912 3300005331 Bacteria 2970
10 Ga0068869_100014160 3300005334 Bacteria 5324
11 Ga0068869_100267596 3300005334 Bacteria 1370
12 Ga0070682_100063689 3300005337 Bacteria 2339
13 Ga0068868_100007811 3300005338 Bacteria 7637
14 Ga0070660_100000966 3300005339 Bacteria 19231
15 Ga0070660_100092898 3300005339 Bacteria 2382
16 Ga0070661_100065932 3300005344 Bacteria 2660
17 Ga0070661_100144765 3300005344 Bacteria 1793
18 Ga0070692_10002871 3300005345 Bacteria 6829
19 Ga0070668_100000533 3300005347 Bacteria 25353
20 Ga0070669_100014626 3300005353 Bacteria 5586
21 Ga0070675_100000695 3300005354 Bacteria 23382
22 Ga0070673_100784004 3300005364 Bacteria 879
23 Ga0070659_100024703 3300005366 Bacteria 4608
24 Ga0070659_100027420 3300005366 Bacteria 4389
25 Ga0070667_100000153 3300005367 Bacteria 85806
26 Ga0070667_100000549 3300005367 Bacteria 37300
27 Ga0070714_100298224 3300005435 Bacteria 1502
28 Ga0070705_100018593 3300005440 Bacteria 3645
29 Ga0070700_100002617 3300005441 Bacteria 9202
30 Ga0070663_100011847 3300005455 Bacteria 5495
31 Ga0070663_100209099 3300005455 Bacteria 1527
32 Ga0070678_100031202 3300005456 Bacteria 3673
33 Ga0070662_100023651 3300005457 Bacteria 4223
34 Ga0070685_10119479 3300005466 Bacteria 1635
35 Ga0070706_100642434 3300005467 Bacteria 985
36 Ga0070698_100619181 3300005471 Bacteria 1023
37 Ga0070679_100094724 3300005530 Bacteria 2973
38 Ga0070684_100017973 3300005535 Bacteria 5813
39 Ga0070684_100031729 3300005535 Bacteria 4500
40 Ga0070684_100107751 3300005535 Bacteria 2496
41 Ga0070684_100576854 3300005535 Bacteria 1045
42 Ga0070672_100233939 3300005543 Bacteria 1544
43 Ga0070696_100108345 3300005546 Bacteria 1998
44 Ga0070665_100053600 3300005548 Bacteria 4044
45 Ga0070665_100732038 3300005548 Bacteria 1002
46 Ga0068855_100361237 3300005563 Bacteria 1598
47 Ga0068855_100639192 3300005563 Bacteria 1144
48 Ga0070664_100000898 3300005564 Bacteria 23161
49 Ga0070664_100145379 3300005564 Bacteria 2090
50 Ga0068857_100004749 3300005577 Bacteria 11513
51 Ga0068854_100179695 3300005578 Bacteria 1652
52 Ga0070702_100231688 3300005615 Bacteria 1241
53 Ga0068852_100135504 3300005616 Bacteria 2273
54 Ga0068859_100002116 3300005617 Bacteria 20220
55 Ga0068859_100291425 3300005617 Bacteria 1725
56 Ga0068864_100254884 3300005618 Bacteria 1630
57 Ga0068864_100308592 3300005618 Bacteria 1483
58 Ga0068870_10072909 3300005840 Bacteria 1877
59 Ga0068863_100006579 3300005841 Bacteria 11405
60 Ga0068863_100279189 3300005841 Bacteria 1618
61 Ga0068863_100596347 3300005841 Bacteria 1093
62 Ga0068858_100063810 3300005842 Bacteria 3408
63 Ga0068858_100188171 3300005842 Bacteria 1950
64 Ga0068860_100000207 3300005843 Bacteria 93648
65 Ga0068862_100000030 3300005844 Bacteria 182487
66 Ga0068862_100065952 3300005844 Bacteria 3119
67 Ga0081455_10317792 3300005937 Bacteria 1111
68 Ga0081540_1000491 3300005983 Bacteria 38884
69 Ga0081539_10074716 3300005985 Bacteria 1804
70 Ga0075365_10106849 3300006038 Bacteria 1921
71 Ga0075365_10185249 3300006038 Bacteria 1456
72 Ga0075432_10001023 3300006058 Bacteria 8884
73 Ga0070716_100189991 3300006173 Bacteria 1356
74 Ga0075370_10048207 3300006353 Bacteria 2413
75 Ga0075428_100018739 3300006844 Bacteria 7652
76 Ga0075431_100029756 3300006847 Bacteria 5623
77 Ga0075433_10025673 3300006852 Bacteria 4982
78 Ga0075434_100014303 3300006871 Bacteria 7583
79 Ga0068865_100229614 3300006881 Bacteria 1455
80 Ga0097620_100002116 3300006931 Bacteria 20220
81 Ga0097620_100291428 3300006931 Bacteria 1725
82 Ga0075435_100021521 3300007076 Bacteria 4961
83 Ga0105240_10167668 3300009093 Bacteria 2603
84 Ga0111539_10001345 3300009094 Bacteria 32746
85 Ga0111539_10025140 3300009094 Bacteria 7300
86 Ga0111539_10594390 3300009094 Bacteria 1289
87 Ga0105245_10417790 3300009098 Bacteria 1344
88 Ga0105247_10000008 3300009101 Bacteria 391450
89 Ga0114129_10005713 3300009147 Bacteria 17623
90 Ga0105243_10022452 3300009148 Bacteria 4796
91 Ga0105243_10106606 3300009148 Bacteria 2336
92 Ga0105248_10000217 3300009177 Bacteria 66541
93 Ga0105248_10129492 3300009177 Bacteria 2847
94 Ga0105237_10022408 3300009545 Bacteria 6482
95 Ga0105237_10045786 3300009545 Bacteria 4401
96 Ga0105237_10774223 3300009545 Bacteria 966
97 Ga0105238_10056816 3300009551 Bacteria 3926
98 Ga0105249_10000036 3300009553 Bacteria 198578
99 Ga0105249_10012408 3300009553 Bacteria 7511
100 Ga0105249_10264171 3300009553 Bacteria 1712
101 Ga0105239_10003372 3300010375 Bacteria 19606
102 Ga0105239_10103254 3300010375 Bacteria 3155
103 Ga0105239_10150742 3300010375 Bacteria 2595
104 Ga0105239_10646773 3300010375 Bacteria 1207
105 Ga0105246_10000538 3300011119 Bacteria 20757
106 Ga0105246_10111338 3300011119 Bacteria 2012
107 Ga0105246_10495038 3300011119 Bacteria 1037
108 Ga0157371_10026185 3300013102 Bacteria 4241
109 Ga0157370_10022078 3300013104 Bacteria 6338
110 Ga0157369_10029652 3300013105 Bacteria 6043
111 Ga0157369_10045255 3300013105 Bacteria 4788
112 Ga0157369_10146018 3300013105 Bacteria 2501
113 Ga0157374_10434211 3300013296 Bacteria 1313
114 Ga0157374_10629757 3300013296 Bacteria 1084
115 Ga0163162_10582806 3300013306 Bacteria 1245
116 Ga0163162_11289709 3300013306 Bacteria 830
117 Ga0157375_10013458 3300013308 Bacteria 7282
118 Ga0157375_10517562 3300013308 Bacteria 1357
119 Ga0157375_10606882 3300013308 Bacteria 1253
120 Ga0157375_10917135 3300013308 Bacteria 1019
121 Ga0157379_10313233 3300014968 Bacteria 1432
122 Ga0163161_10109076 3300017792 Bacteria 2067
123 Ga0206353_11439717 3300020082 Bacteria 1657
124 Ga0209673_1018242 3300025273 Bacteria 2560
125 Ga0209758_1006156 3300025297 Bacteria 8789
126 Ga0209051_1000158 3300025303 Bacteria 127723
127 Ga0209051_1000949 3300025303 Bacteria 28423
128 Ga0209051_1001572 3300025303 Bacteria 18855
129 Ga0209051_1019380 3300025303 Bacteria 2970
130 Ga0207710_10000006 3300025900 Bacteria 538831
131 Ga0207680_10062441 3300025903 Bacteria 2276
132 Ga0207647_10037155 3300025904 Bacteria 3090
133 Ga0207684_10697299 3300025910 Bacteria 863
134 Ga0207671_10007683 3300025914 Bacteria 9309
135 Ga0207671_10204121 3300025914 Unclassified 1544
136 Ga0207660_10246595 3300025917 Bacteria 1409
137 Ga0207657_10015956 3300025919 Bacteria 7256
138 Ga0207657_10028028 3300025919 Bacteria 5147
139 Ga0207652_10061427 3300025921 Bacteria 3244
140 Ga0207681_10010699 3300025923 Bacteria 5629
141 Ga0207694_10168150 3300025924 Bacteria 1774
142 Ga0207694_10469977 3300025924 Bacteria 1051
143 Ga0207659_10000570 3300025926 Bacteria 22187
144 Ga0207687_10112463 3300025927 Bacteria 2024
145 Ga0207700_10327229 3300025928 Bacteria 1329
146 Ga0207690_10018162 3300025932 Bacteria 4310
147 Ga0207690_10120622 3300025932 Bacteria 1904
148 Ga0207690_10429978 3300025932 Bacteria 1058
149 Ga0207706_10001843 3300025933 Bacteria 20788
150 Ga0207686_10263895 3300025934 Bacteria 1264
151 Ga0207709_10014859 3300025935 Bacteria 4307
152 Ga0207704_10200261 3300025938 Bacteria 1461
153 Ga0207665_10416164 3300025939 Bacteria 1026
154 Ga0207711_10000184 3300025941 Bacteria 66619
155 Ga0207711_10317171 3300025941 Bacteria 1440
156 Ga0207689_10014102 3300025942 Bacteria 6802
157 Ga0207661_10026784 3300025944 Bacteria 4397
158 Ga0207661_10028222 3300025944 Bacteria 4296
159 Ga0207679_10038239 3300025945 Bacteria 3417
160 Ga0207679_10476177 3300025945 Bacteria 1111
161 Ga0207667_10102738 3300025949 Bacteria 2948
162 Ga0207667_10609518 3300025949 Bacteria 1100
163 Ga0207712_10000036 3300025961 Bacteria 198586
164 Ga0207712_10045622 3300025961 Bacteria 3036
165 Ga0207668_10183452 3300025972 Bacteria 1653
166 Ga0207640_10158401 3300025981 Bacteria 1672
167 Ga0207658_10000102 3300025986 Bacteria 94706
168 Ga0207658_10000621 3300025986 Bacteria 31352
169 Ga0207677_10062440 3300026023 Bacteria 2584
170 Ga0207703_10090395 3300026035 Bacteria 2573
171 Ga0207703_10145728 3300026035 Bacteria 2059
172 Ga0207703_10448452 3300026035 Bacteria 1205
173 Ga0207678_10001053 3300026067 Bacteria 25256
174 Ga0207678_10009758 3300026067 Bacteria 8441
175 Ga0207678_10149135 3300026067 Bacteria 1997
176 Ga0207702_10145480 3300026078 Bacteria 2150
177 Ga0207641_10001722 3300026088 Bacteria 21138
178 Ga0207641_10131364 3300026088 Bacteria 2249
179 Ga0207641_10485428 3300026088 Bacteria 1198
180 Ga0207676_10365750 3300026095 Bacteria 1338
181 Ga0207674_10058818 3300026116 Bacteria 3892
182 Ga0207428_10014289 3300027907 Bacteria 6910
183 Ga0207428_10044667 3300027907 Bacteria 3573
184 Ga0268266_10034441 3300028379 Bacteria 4307
185 Ga0268265_10000038 3300028380 Bacteria 198640
186 Ga0268265_10062662 3300028380 Bacteria 2858
187 Ga0268264_10000263 3300028381 Bacteria 93754
188 Ga0307511_10000188 3300030521 Bacteria 61440
189 Ga0265340_10002356 3300031247 Bacteria 10762
190 Ga0265327_10000912 3300031251 Bacteria 43333
191 Ga0265327_10029190 3300031251 Bacteria 3141
192 Ga0307513_10292483 3300031456 Bacteria 1400
193 Ga0307408_100003459 3300031548 Bacteria 10793
194 Ga0307408_100023293 3300031548 Bacteria 4216
195 Ga0307408_100065267 3300031548 Bacteria 2669
196 Ga0307408_100157193 3300031548 Bacteria 1802
197 Ga0307405_10007169 3300031731 Bacteria 5548
198 Ga0307410_10000845 3300031852 Bacteria 13030
199 Ga0307406_10184660 3300031901 Bacteria 1521
200 Ga0307407_10010876 3300031903 Bacteria 4310
201 Ga0307409_100003613 3300031995 Bacteria 8452
202 Ga0307409_100009807 3300031995 Bacteria 5906
203 Ga0307409_100090413 3300031995 Bacteria 2506
204 Ga0307409_100177904 3300031995 Bacteria 1880
205 Ga0307409_100211927 3300031995 Bacteria 1742
206 Ga0307409_100427859 3300031995 Bacteria 1272
207 Ga0307416_100232298 3300032002 Bacteria 1779
208 Ga0307416_100670716 3300032002 Bacteria 1123
209 Ga0307411_10071281 3300032005 Bacteria 2355
210 Ga0307415_100000037 3300032126 Bacteria 57345
211 Ga0307415_100001112 3300032126 Bacteria 12554
212 Ga0307415_100055301 3300032126 Bacteria 2715
213 Ga0307415_100102750 3300032126 Bacteria 2101
214 Ga0307415_100364768 3300032126 Bacteria 1221
215 Ga0395899_0004296 3300037312 Bacteria 11132
216 Ga0395899_0014960 3300037312 Bacteria 5919
217 Ga0395900_0018667 3300037418 Bacteria 7072
218 Ga0395900_0030142 3300037418 Bacteria 5569
219 Ga0395900_0267522 3300037418 Bacteria 1705
220 Ga0395898_0006350 3300037466 Bacteria 12627
221 Ga0395898_0007085 3300037466 Bacteria 11912
222 Ga0395898_0027004 3300037466 Bacteria 5767
223 Ga0395898_0128409 3300037466 Bacteria 2428
224 Ga0395905_0050403 3300037471 Bacteria 3900
225 Ga0395905_0467688 3300037471 Bacteria 1160
226 Ga0395901_0002928 3300038443 Bacteria 17235
227 Ga0395901_0174236 3300038443 Bacteria 2256
228 Ga0395901_0445321 3300038443 Bacteria 1325
229 Ga0395901_0732326 3300038443 Bacteria 983
230 Ga0451791_1541071 3300041451 Bacteria 925
231 Ga0451843_0514125 3300041509 Bacteria 2953
232 Ga0451853_0812353 3300041512 Bacteria 2867
233 Ga0451853_1847819 3300041512 Bacteria 923
234 Ga0439442_000142 3300042002 Bacteria 17897
235 Ga0439459_0075668 3300042438 Bacteria 786
236 Ga0466969_0154280 3300044656 Bacteria 1057
237 Ga0466972_0003029 3300044658 Bacteria 8329
238 Ga0466972_0180200 3300044658 Bacteria 991
239 Ga0466966_0007000 3300044684 Bacteria 7468
240 Ga0466966_0076010 3300044684 Bacteria 2098
241 Ga0466961_0003880 3300044693 Bacteria 9343
242 Ga0466961_0004271 3300044693 Bacteria 8942
243 Ga0466961_0027641 3300044693 Bacteria 3649
244 Ga0466961_0086269 3300044693 Bacteria 1984
245 Ga0466961_0387035 3300044693 Bacteria 849
246 Ga0466963_0083204 3300044694 Bacteria 2170
247 Ga0466963_0184082 3300044694 Bacteria 1459
248 Ga0466964_0069526 3300044706 Bacteria 1485
249 Ga0466970_0089134 3300044765 Bacteria 1673
250 Ga0466970_0112711 3300044765 Bacteria 1486
251 Ga0466970_0277455 3300044765 Bacteria 942
252 Ga0466957_0045784 3300044842 Bacteria 2654
253 Ga0466957_0161947 3300044842 Bacteria 1453
254 Ga0466960_0053365 3300044901 Bacteria 1959
255 Ga0466960_0099574 3300044901 Bacteria 1495
256 Ga0466959_0011188 3300045049 Bacteria 6436
257 Ga0466959_0097414 3300045049 Bacteria 2108
258 Ga0466958_0379012 3300045836 Bacteria 912
259 Ga0466967_0001036 3300045976 Bacteria 15249
260 Ga0466967_0107076 3300045976 Bacteria 2564
261 Ga0466967_0116351 3300045976 Bacteria 2463
262 Ga0466967_0253257 3300045976 Bacteria 1683
263 Ga0466967_0293852 3300045976 Bacteria 1561
264 Ga0495638_0029982 3300046460 Bacteria 3505
265 Ga0495580_0047275 3300046472 Bacteria 3051
266 Ga0495580_0179763 3300046472 Bacteria 1461
267 Ga0495585_0068600 3300046492 Bacteria 1937
268 Ga0495583_0047385 3300046506 Bacteria 1977
269 Ga0495608_0141622 3300046511 Bacteria 1535
270 Ga0495648_0002953 3300046524 Bacteria 15260
271 Ga0495665_0075651 3300046531 Bacteria 1772
272 Ga0495640_0294566 3300046533 Bacteria 1009
273 Ga0495611_0132161 3300046648 Bacteria 1164
274 Ga0495625_0068537 3300046660 Bacteria 2494
275 Ga0495671_0095470 3300046692 Bacteria 1455
276 Ga0495680_0336852 3300047322 Bacteria 1053
277 Ga0495683_0000678 3300047323 Bacteria 25136
278 Ga0495673_0000588 3300047469 Bacteria 36483
279 Ga0495686_0048624 3300047472 Bacteria 2673
280 Ga0495626_0016027 3300048091 Bacteria 3819
281 Ga0496100_0000026 3300048903 Bacteria 115873
282 Ga0496100_0006202 3300048903 Bacteria 6502
283 Ga0496100_0032654 3300048903 Bacteria 3249
284 Ga0496100_0142326 3300048903 Bacteria 1701
285 Ga0496101_0000015 3300048904 Bacteria 252368
286 Ga0496101_0000176 3300048904 Bacteria 51135
287 Ga0496102_0000175 3300048905 Bacteria 87026
288 Ga0496102_0000309 3300048905 Bacteria 62179
289 Ga0496102_0001094 3300048905 Bacteria 25087
290 Ga0496102_0071533 3300048905 Bacteria 3185
291 Ga0496102_0074203 3300048905 Bacteria 3127
292 Ga0496102_0209914 3300048905 Bacteria 1836
293 Ga0496103_0002301 3300048906 Bacteria 12071
294 Ga0496103_0010463 3300048906 Bacteria 5490
295 Ga0496104_0000793 3300048907 Bacteria 27078
296 Ga0496104_0165127 3300048907 Bacteria 2123
297 Ga0496104_0546043 3300048907 Bacteria 1070
298 Ga0496105_0006293 3300048908 Bacteria 9116
299 Ga0496105_0080644 3300048908 Bacteria 2688
300 Ga0496105_0098252 3300048908 Bacteria 2418
301 Ga0496106_0011920 3300048909 Bacteria 6418
302 Ga0496106_0169204 3300048909 Bacteria 1731
303 Ga0496107_0000475 3300048910 Bacteria 22068
304 Ga0496107_0002974 3300048910 Bacteria 11224
305 Ga0496107_0022315 3300048910 Bacteria 4474
306 Ga0496107_0420974 3300048910 Bacteria 993
307 Ga0496108_0065428 3300048911 Bacteria 3065
308 Ga0496108_0185045 3300048911 Bacteria 1804
309 Ga0496109_0000022 3300048912 Bacteria 188901
310 Ga0496110_0140588 3300048913 Bacteria 2182
311 Ga0496110_0201216 3300048913 Bacteria 1810
312 Ga0496112_0397823 3300048915 Bacteria 1317
313 Ga0496113_0065156 3300048916 Bacteria 2757
314 Ga0496113_0177393 3300048916 Bacteria 1688
315 Ga0496113_0283588 3300048916 Bacteria 1325
316 Ga0496114_0000829 3300048917 Bacteria 23199
317 Ga0496114_0009086 3300048917 Bacteria 7881
318 Ga0496114_0013152 3300048917 Bacteria 6634
319 Ga0496114_0054044 3300048917 Bacteria 3348
320 Ga0496114_0298084 3300048917 Bacteria 1423
321 Ga0496115_0039401 3300048918 Bacteria 3752
322 Ga0496115_0505454 3300048918 Bacteria 971
323 Ga0496116_0110205 3300048919 Bacteria 1620
324 Ga0496117_0001641 3300048920 Bacteria 31427
325 Ga0496117_0002139 3300048920 Bacteria 25822
326 Ga0496117_0026633 3300048920 Bacteria 4521
327 Ga0496118_0000201 3300048921 Bacteria 104874
328 Ga0496118_0003172 3300048921 Bacteria 20999
329 Ga0496118_0010393 3300048921 Bacteria 9225
330 Ga0496119_0016037 3300048922 Bacteria 5725
331 Ga0496119_0041669 3300048922 Bacteria 2921
332 Ga0496119_0045826 3300048922 Bacteria 2737
333 Ga0496120_0011699 3300048923 Bacteria 6019
334 Ga0496120_0019856 3300048923 Bacteria 4285
335 Ga0496120_0083890 3300048923 Bacteria 1719
336 Ga0496121_0000004 3300048924 Bacteria 1139011
337 Ga0496121_0014156 3300048924 Bacteria 8495
338 Ga0496122_0000257 3300048925 Bacteria 120176
339 Ga0496123_0003863 3300048926 Bacteria 16298
340 Ga0496123_0046246 3300048926 Bacteria 2953
341 Ga0496123_0057189 3300048926 Bacteria 2541
342 Ga0496124_0000012 3300048927 Bacteria 512581
343 Ga0496124_0000194 3300048927 Bacteria 120672
344 Ga0496124_0009392 3300048927 Bacteria 10077
345 Ga0496124_0077683 3300048927 Bacteria 2737
346 Ga0496125_0000003 3300048928 Bacteria 1189767
347 Ga0496125_0007978 3300048928 Bacteria 11181
348 Ga0496125_0014897 3300048928 Bacteria 7551
349 Ga0496126_0000001 3300048929 Bacteria 1139011
350 Ga0496126_0000931 3300048929 Bacteria 50490
351 Ga0496126_0007614 3300048929 Bacteria 11826
352 Ga0496126_0015864 3300048929 Bacteria 7565
353 Ga0496126_0194383 3300048929 Bacteria 1716
354 Ga0501031_0001784 3300049568 Bacteria 13503
355 Ga0501032_0005767 3300049569 Bacteria 9159
356 Ga0501032_0140594 3300049569 Bacteria 1590
357 Ga0501032_0190934 3300049569 Bacteria 1339
358 Ga0501033_0043073 3300049570 Bacteria 3363
359 Ga0501033_0054838 3300049570 Bacteria 2948
360 Ga0501034_0005748 3300049571 Bacteria 13488
361 Ga0501036_0001147 3300049572 Bacteria 20183
362 Ga0501036_0015095 3300049572 Bacteria 6447
363 Ga0501036_0169351 3300049572 Bacteria 1840
364 Ga0501037_0001914 3300049573 Bacteria 15110
365 Ga0501037_0008411 3300049573 Bacteria 7570
366 Ga0501038_0002048 3300049574 Bacteria 18650
367 Ga0501038_0029617 3300049574 Bacteria 4848
368 Ga0501038_0112386 3300049574 Bacteria 2255
369 Ga0501039_0003859 3300049575 Bacteria 11255
370 Ga0501039_0074782 3300049575 Bacteria 2633
371 Ga0501040_0044801 3300049576 Bacteria 3016
372 Ga0501040_0332822 3300049576 Bacteria 1087
373 Ga0501041_0001798 3300049577 Bacteria 12014
374 Ga0501042_0196335 3300049578 Bacteria 1455
375 Ga0501043_0004747 3300049579 Bacteria 11022
376 Ga0501043_0239621 3300049579 Bacteria 1399
377 Ga0501046_0005793 3300049580 Bacteria 11028
378 Ga0501046_0250555 3300049580 Bacteria 1303
379 Ga0501046_0573336 3300049580 Bacteria 803
380 Ga0501047_0061079 3300049581 Bacteria 3636
381 Ga0501048_0003193 3300049582 Bacteria 12488
382 Ga0501067_0057998 3300049583 Bacteria 2144
383 Ga0501070_0002972 3300049586 Bacteria 14769
384 Ga0501070_0140656 3300049586 Bacteria 1993
385 Ga0501071_0001497 3300049587 Bacteria 13588
386 Ga0501071_0273982 3300049587 Bacteria 1276
387 Ga0501072_0004826 3300049588 Bacteria 10267
388 Ga0501072_0049083 3300049588 Bacteria 3323
389 Ga0501075_0254125 3300049591 Bacteria 1339
390 Ga0501076_0002216 3300049592 Bacteria 13311
391 Ga0501079_0012048 3300049741 Bacteria 6598
392 Ga0501081_0030498 3300049743 Bacteria 3650
393 Ga0501083_0072491 3300049744 Bacteria 2290
394 Ga0501035_0014805 3300049822 Bacteria 7199
395 Ga0501044_0002933 3300049823 Bacteria 19404
396 Ga0501044_0010315 3300049823 Bacteria 10147
397 Ga0501044_0046972 3300049823 Bacteria 4468
398 Ga0501044_0226111 3300049823 Bacteria 1821
399 Ga0501044_0370397 3300049823 Bacteria 1349
400 Ga0501045_0004655 3300049824 Bacteria 9472
401 Ga0501045_0076890 3300049824 Bacteria 2460
402 Ga0501045_0528963 3300049824 Bacteria 875
403 Ga0501045_0829429 3300049824 Bacteria 680
404 nmdc:mga03n38_11578_c1 3300050490 Bacteria 3292
405 nmdc:mga05p37_20478_c1 3300050507 Bacteria 8002
406 nmdc:mga06r32_104002_c1 3300050510 Bacteria 2788
407 nmdc:mga08y16_349677_c1 3300050511 Bacteria 1518
408 nmdc:mga08y16_64865_c1 3300050511 Bacteria 3813
409 nmdc:mga08y16_65859_c1 3300050511 Bacteria 3782
410 nmdc:mga0n895_73397_c1 3300050512 Bacteria 3397
411 nmdc:mga0rr50_26674_c1 3300050513 Bacteria 4035
412 nmdc:mga0a205_18733_c1 3300050515 Bacteria 6516
413 nmdc:mga0sz30_8526_c2 3300050516 Bacteria 2073
414 Ga0500610_0032784 3300053079 Bacteria 2647
415 Ga0500635_0000097 3300053080 Bacteria 52649
416 Ga0500635_0009243 3300053080 Bacteria 2731
417 Ga0500641_0046189 3300053096 Bacteria 1776
418 Ga0500562_037844 3300053108 Bacteria 1281
419 Ga0500652_007956 3300053131 Bacteria 3507
420 Ga0500600_0076642 3300053149 Bacteria 1819
421 Ga0501082_0004705 3300060353 Bacteria 11905
422 Ga0501082_0277175 3300060353 Bacteria 1460
423 Ga0466962_0007567 3300061719 Bacteria 5211
424 Ga0466962_0183936 3300061719 Bacteria 1019
425 Ga0530510_0020256 3300061734 Bacteria 4729
426 2566994399 2565956761 Bacteria 6601618
427 2643852548 2643221567 Bacteria 4163945
428 2644137072 2643221624 Bacteria 4384879
429 2644446825 2643221679 Bacteria 3839507
430 2644490514 2643221687 Bacteria 6500351
431 2676486719 2675903059 Bacteria 8644972
432 2738667934 2738541264 Bacteria 5935393
433 2738892982 2738541308 Bacteria 7020677
434 2739147004 2738541356 Bacteria 5935017
435 2753300716 2751185788 Bacteria 4541048
436 2808875585 2808606365 Bacteria 4301966
437 2808879376 2808606366 Bacteria 4415912
438 2810363707 2808606700 Bacteria 3482157
439 2902794120 2902792274 Bacteria 7270173
440 2902839655 2902837492 Bacteria 6697721
441 2904537525 2904535858 Bacteria 6308016
442 2919044060 2919042368 Bacteria 3905917
443 2919447987 2919446982 Bacteria 3994487
444 2922558843 2922554459 Bacteria 6683962
445 2928107064 2928104781 Bacteria 3877447
446 2929212909 2929212328 Bacteria 7708288
447 2939589187 2939582691 Bacteria 7088898
448 2945943157 2945941187 Bacteria 4682474
449 2946004378 2946003308 Bacteria 3857229
450 2946062842 2946059875 Bacteria 4386623
451 2974317353 2974315732 Bacteria 4602776
452 2984525560 2984523437 Bacteria 4508481
453 2984552793 2984551494 Bacteria 3877562
454 3001892216 3001889506 Bacteria 2975194
455 8004022789 8004021418 Bacteria 4313954
456 8004029466 8004025490 Bacteria 4327753
457 Ga0395901_0056528
458 JGI24737J22298_10019709
459 Ga0055540_1000207
460 Ga0055540_1002158
461 Ga0055540_1003148
462 Ga0070658_10002720
463 Ga0070658_10027913
464 Ga0070683_100148065
465 Ga0070670_100071912
466 Ga0068869_100014160
467 Ga0068869_100267596
468 Ga0070682_100063689
469 Ga0068868_100007811
470 Ga0070660_100000966
471 Ga0070660_100092898
472 Ga0070661_100065932
473 Ga0070661_100144765
474 Ga0070692_10002871
475 Ga0070668_100000533
476 Ga0070669_100014626
477 Ga0070675_100000695
478 Ga0070673_100784004
479 Ga0070659_100024703
480 Ga0070659_100027420
481 Ga0070667_100000153
482 Ga0070667_100000549
483 Ga0070714_100298224
484 Ga0070705_100018593
485 Ga0070700_100002617
486 Ga0070663_100011847
487 Ga0070663_100209099
488 Ga0070678_100031202
489 Ga0070662_100023651
490 Ga0070685_10119479
491 Ga0070706_100642434
492 Ga0070698_100619181
493 Ga0070679_100094724
494 Ga0070684_100017973
495 Ga0070684_100031729
496 Ga0070684_100107751
497 Ga0070684_100576854
498 Ga0070672_100233939
499 Ga0070696_100108345
500 Ga0070665_100053600
501 Ga0070665_100732038
502 Ga0068855_100361237
503 Ga0068855_100639192
504 Ga0070664_100000898
505 Ga0070664_100145379
506 Ga0068857_100004749
507 Ga0068854_100179695
508 Ga0070702_100231688
509 Ga0068852_100135504
510 Ga0068859_100002116
511 Ga0068859_100291425
512 Ga0068864_100254884
513 Ga0068864_100308592
514 Ga0068870_10072909
515 Ga0068863_100006579
516 Ga0068863_100279189
517 Ga0068863_100596347
518 Ga0068858_100063810
519 Ga0068858_100188171
520 Ga0068860_100000207
521 Ga0068862_100000030
522 Ga0068862_100065952
523 Ga0081455_10317792
524 Ga0081540_1000491
525 Ga0081539_10074716
526 Ga0075365_10106849
527 Ga0075365_10185249
528 Ga0075432_10001023
529 Ga0070716_100189991
530 Ga0075370_10048207
531 Ga0075428_100018739
532 Ga0075431_100029756
533 Ga0075433_10025673
534 Ga0075434_100014303
535 Ga0068865_100229614
536 Ga0097620_100002116
537 Ga0097620_100291428
538 Ga0075435_100021521
539 Ga0105240_10167668
540 Ga0111539_10001345
541 Ga0111539_10025140
542 Ga0111539_10594390
543 Ga0105245_10417790
544 Ga0105247_10000008
545 Ga0114129_10005713
546 Ga0105243_10022452
547 Ga0105243_10106606
548 Ga0105248_10000217
549 Ga0105248_10129492
550 Ga0105237_10022408
551 Ga0105237_10045786
552 Ga0105237_10774223
553 Ga0105238_10056816
554 Ga0105249_10000036
555 Ga0105249_10012408
556 Ga0105249_10264171
557 Ga0105239_10003372
558 Ga0105239_10103254
559 Ga0105239_10150742
560 Ga0105239_10646773
561 Ga0105246_10000538
562 Ga0105246_10111338
563 Ga0105246_10495038
564 Ga0157371_10026185
565 Ga0157370_10022078
566 Ga0157369_10029652
567 Ga0157369_10045255
568 Ga0157369_10146018
569 Ga0157374_10434211
570 Ga0157374_10629757
571 Ga0163162_10582806
572 Ga0163162_11289709
573 Ga0157375_10013458
574 Ga0157375_10517562
575 Ga0157375_10606882
576 Ga0157375_10917135
577 Ga0157379_10313233
578 Ga0163161_10109076
579 Ga0206353_11439717
580 Ga0209673_1018242
581 Ga0209758_1006156
582 Ga0209051_1000158
583 Ga0209051_1000949
584 Ga0209051_1001572
585 Ga0209051_1019380
586 Ga0207710_10000006
587 Ga0207680_10062441
588 Ga0207647_10037155
589 Ga0207684_10697299
590 Ga0207671_10007683
591 Ga0207671_10204121
592 Ga0207660_10246595
593 Ga0207657_10015956
594 Ga0207657_10028028
595 Ga0207652_10061427
596 Ga0207681_10010699
597 Ga0207694_10168150
598 Ga0207694_10469977
599 Ga0207659_10000570
600 Ga0207687_10112463
601 Ga0207700_10327229
602 Ga0207690_10018162
603 Ga0207690_10120622
604 Ga0207690_10429978
605 Ga0207706_10001843
606 Ga0207686_10263895
607 Ga0207709_10014859
608 Ga0207704_10200261
609 Ga0207665_10416164
610 Ga0207711_10000184
611 Ga0207711_10317171
612 Ga0207689_10014102
613 Ga0207661_10026784
614 Ga0207661_10028222
615 Ga0207679_10038239
616 Ga0207679_10476177
617 Ga0207667_10102738
618 Ga0207667_10609518
619 Ga0207712_10000036
620 Ga0207712_10045622
621 Ga0207668_10183452
622 Ga0207640_10158401
623 Ga0207658_10000102
624 Ga0207658_10000621
625 Ga0207677_10062440
626 Ga0207703_10090395
627 Ga0207703_10145728
628 Ga0207703_10448452
629 Ga0207678_10001053
630 Ga0207678_10009758
631 Ga0207678_10149135
632 Ga0207702_10145480
633 Ga0207641_10001722
634 Ga0207641_10131364
635 Ga0207641_10485428
636 Ga0207676_10365750
637 Ga0207674_10058818
638 Ga0207428_10014289
639 Ga0207428_10044667
640 Ga0268266_10034441
641 Ga0268265_10000038
642 Ga0268265_10062662
643 Ga0268264_10000263
644 Ga0307511_10000188
645 Ga0265340_10002356
646 Ga0265327_10000912
647 Ga0265327_10029190
648 Ga0307513_10292483
649 Ga0307408_100003459
650 Ga0307408_100023293
651 Ga0307408_100065267
652 Ga0307408_100157193
653 Ga0307405_10007169
654 Ga0307410_10000845
655 Ga0307406_10184660
656 Ga0307407_10010876
657 Ga0307409_100003613
658 Ga0307409_100009807
659 Ga0307409_100090413
660 Ga0307409_100177904
661 Ga0307409_100211927
662 Ga0307409_100427859
663 Ga0307416_100232298
664 Ga0307416_100670716
665 Ga0307411_10071281
666 Ga0307415_100000037
667 Ga0307415_100001112
668 Ga0307415_100055301
669 Ga0307415_100102750
670 Ga0307415_100364768
671 Ga0395899_0004296
672 Ga0395899_0014960
673 Ga0395900_0018667
674 Ga0395900_0030142
675 Ga0395900_0267522
676 Ga0395898_0006350
677 Ga0395898_0007085
678 Ga0395898_0027004
679 Ga0395898_0128409
680 Ga0395905_0050403
681 Ga0395905_0467688
682 Ga0395901_0002928
683 Ga0395901_0174236
684 Ga0395901_0445321
685 Ga0395901_0732326
686 Ga0451791_1541071
687 Ga0451843_0514125
688 Ga0451853_0812353
689 Ga0451853_1847819
690 Ga0439442_000142
691 Ga0439459_0075668
692 Ga0466969_0154280
693 Ga0466972_0003029
694 Ga0466972_0180200
695 Ga0466966_0007000
696 Ga0466966_0076010
697 Ga0466961_0003880
698 Ga0466961_0004271
699 Ga0466961_0027641
700 Ga0466961_0086269
701 Ga0466961_0387035
702 Ga0466963_0083204
703 Ga0466963_0184082
704 Ga0466964_0069526
705 Ga0466970_0089134
706 Ga0466970_0112711
707 Ga0466970_0277455
708 Ga0466957_0045784
709 Ga0466957_0161947
710 Ga0466960_0053365
711 Ga0466960_0099574
712 Ga0466959_0011188
713 Ga0466959_0097414
714 Ga0466958_0379012
715 Ga0466967_0001036
716 Ga0466967_0107076
717 Ga0466967_0116351
718 Ga0466967_0253257
719 Ga0466967_0293852
720 Ga0495638_0029982
721 Ga0495580_0047275
722 Ga0495580_0179763
723 Ga0495585_0068600
724 Ga0495583_0047385
725 Ga0495608_0141622
726 Ga0495648_0002953
727 Ga0495665_0075651
728 Ga0495640_0294566
729 Ga0495611_0132161
730 Ga0495625_0068537
731 Ga0495671_0095470
732 Ga0495680_0336852
733 Ga0495683_0000678
734 Ga0495673_0000588
735 Ga0495686_0048624
736 Ga0495626_0016027
737 Ga0496100_0000026
738 Ga0496100_0006202
739 Ga0496100_0032654
740 Ga0496100_0142326
741 Ga0496101_0000015
742 Ga0496101_0000176
743 Ga0496102_0000175
744 Ga0496102_0000309
745 Ga0496102_0001094
746 Ga0496102_0071533
747 Ga0496102_0074203
748 Ga0496102_0209914
749 Ga0496103_0002301
750 Ga0496103_0010463
751 Ga0496104_0000793
752 Ga0496104_0165127
753 Ga0496104_0546043
754 Ga0496105_0006293
755 Ga0496105_0080644
756 Ga0496105_0098252
757 Ga0496106_0011920
758 Ga0496106_0169204
759 Ga0496107_0000475
760 Ga0496107_0002974
761 Ga0496107_0022315
762 Ga0496107_0420974
763 Ga0496108_0065428
764 Ga0496108_0185045
765 Ga0496109_0000022
766 Ga0496110_0140588
767 Ga0496110_0201216
768 Ga0496112_0397823
769 Ga0496113_0065156
770 Ga0496113_0177393
771 Ga0496113_0283588
772 Ga0496114_0000829
773 Ga0496114_0009086
774 Ga0496114_0013152
775 Ga0496114_0054044
776 Ga0496114_0298084
777 Ga0496115_0039401
778 Ga0496115_0505454
779 Ga0496116_0110205
780 Ga0496117_0001641
781 Ga0496117_0002139
782 Ga0496117_0026633
783 Ga0496118_0000201
784 Ga0496118_0003172
785 Ga0496118_0010393
786 Ga0496119_0016037
787 Ga0496119_0041669
788 Ga0496119_0045826
789 Ga0496120_0011699
790 Ga0496120_0019856
791 Ga0496120_0083890
792 Ga0496121_0000004
793 Ga0496121_0014156
794 Ga0496122_0000257
795 Ga0496123_0003863
796 Ga0496123_0046246
797 Ga0496123_0057189
798 Ga0496124_0000012
799 Ga0496124_0000194
800 Ga0496124_0009392
801 Ga0496124_0077683
802 Ga0496125_0000003
803 Ga0496125_0007978
804 Ga0496125_0014897
805 Ga0496126_0000001
806 Ga0496126_0000931
807 Ga0496126_0007614
808 Ga0496126_0015864
809 Ga0496126_0194383
810 Ga0501031_0001784
811 Ga0501032_0005767
812 Ga0501032_0140594
813 Ga0501032_0190934
814 Ga0501033_0043073
815 Ga0501033_0054838
816 Ga0501034_0005748
817 Ga0501036_0001147
818 Ga0501036_0015095
819 Ga0501036_0169351
820 Ga0501037_0001914
821 Ga0501037_0008411
822 Ga0501038_0002048
823 Ga0501038_0029617
824 Ga0501038_0112386
825 Ga0501039_0003859
826 Ga0501039_0074782
827 Ga0501040_0044801
828 Ga0501040_0332822
829 Ga0501041_0001798
830 Ga0501042_0196335
831 Ga0501043_0004747
832 Ga0501043_0239621
833 Ga0501046_0005793
834 Ga0501046_0250555
835 Ga0501046_0573336
836 Ga0501047_0061079
837 Ga0501048_0003193
838 Ga0501067_0057998
839 Ga0501070_0002972
840 Ga0501070_0140656
841 Ga0501071_0001497
842 Ga0501071_0273982
843 Ga0501072_0004826
844 Ga0501072_0049083
845 Ga0501075_0254125
846 Ga0501076_0002216
847 Ga0501079_0012048
848 Ga0501081_0030498
849 Ga0501083_0072491
850 Ga0501035_0014805
851 Ga0501044_0002933
852 Ga0501044_0010315
853 Ga0501044_0046972
854 Ga0501044_0226111
855 Ga0501044_0370397
856 Ga0501045_0004655
857 Ga0501045_0076890
858 Ga0501045_0528963
859 Ga0501045_0829429
860 nmdc:mga03n38_11578_c1
861 nmdc:mga05p37_20478_c1
862 nmdc:mga06r32_104002_c1
863 nmdc:mga08y16_349677_c1
864 nmdc:mga08y16_64865_c1
865 nmdc:mga08y16_65859_c1
866 nmdc:mga0n895_73397_c1
867 nmdc:mga0rr50_26674_c1
868 nmdc:mga0a205_18733_c1
869 nmdc:mga0sz30_8526_c2
870 Ga0500610_0032784
871 Ga0500635_0000097
872 Ga0500635_0009243
873 Ga0500641_0046189
874 Ga0500562_037844
875 Ga0500652_007956
876 Ga0500600_0076642
877 Ga0501082_0004705
878 Ga0501082_0277175
879 Ga0466962_0007567
880 Ga0466962_0183936
881 Ga0530510_0020256
882 2566994399
883 2643852548
884 2644137072
885 2644446825
886 2644490514
887 2676486719
888 2738667934
889 2738892982
890 2739147004
891 2753300716
892 2808875585
893 2808879376
894 2810363707
895 2902794120
896 2902839655
897 2904537525
898 2919044060
899 2919447987
900 2922558843
901 2928107064
902 2929212909
903 2939589187
904 2945943157
905 2946004378
906 2946062842
907 2974317353
908 2984525560
909 2984552793
910 3001892216
911 8004022789
912 8004029466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

60

155

0.97

PF08241

Methyltransf_11

Methyltransferase domain

60

157

0.93

PF13649

Methyltransf_25

Methyltransferase domain

59

153

0.88

PF13847

Methyltransf_31

Methyltransferase domain

57

207

0.86

PF13489

Methyltransf_23

Methyltransferase domain

36

212

0.83

PF05175

MTS

Methyltransferase small domain

38

179

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9139 17 258
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.8821 17 258
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.8761 17 258
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.8693 17 258
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8253 24 257
ID Description Score Start End Superfamily
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8692 35 129 3.40.50.150
3dtnB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8548 13 134 3.40.50.150
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.849 17 258 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8449 24 133 3.40.50.150
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8393 17 258 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2B8AU68-F1-model_v4 Trans-aconitate methyltransferase 0.9478 49 259 GO:0003700
GO:0030798
GO:0032259
AF-A0A2N3VX65-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9441 4 258 GO:0005737
GO:0009058
GO:0030798
GO:0032259
AF-A0A2G2A269-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9418 7 258 GO:0030798
GO:0032259
AF-A0A7X6H233-F1-model_v4 deleted 0.9376 7 204
AF-A0A1F2XF93-F1-model_v4 Methyltransferase domain-containing protein 0.9375 6 257 GO:0030798
GO:0032259

Map