F447811

General Info

Members Datasets Scaffolds Average Seq Length
456 300 911 325

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10016189|Ga0307508_100161893
Length 348
Sequence MPRKTLALSALEGVGWGVMEYTQLGRTGLKVSRLVLGTMNFGPQTDESDSHAIMDAALDAGVNFFDTANVYGWGENKGRTESIIGSWFAKGGDRRDKVVLATKVYGNMAADGDAWPNHDKLSAVNIRRAVDASLKRLGTDYIDVYQFHHVDRATPFEEIWQAIDVLVQQGKILYAGSSNFPGYKIAQANEIAARRGGTIGLVSEQCLYNLAERRAEMEVVPAAQEYGLGVIPWSPLHGGVLGGVIKKEVQGGRRASGRGADWLADPAQRAQIQAYEDLLEKHGLEPGEAALAWLLTRPGVTGPIVGPRTAEQLESALRAVELELSDELLTGLDEIFPGPGPSPEAFAW

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
18 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
19 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
20 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
21 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
34 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
40 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
41 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
42 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
45 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
46 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
47 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
48 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
49 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
50 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
51 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
63 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
64 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
67 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
71 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
74 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
75 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
78 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
94 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
95 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
100 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
118 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
119 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
154 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
200 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
201 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
202 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
203 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
204 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
205 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
206 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
207 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
208 2643221548 Streptomyces sp. Root55 Isolate Unclassified
209 2643221578 Streptomyces sp. Root63 Isolate Unclassified
210 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
211 2643221647 Streptomyces sp. Root369 Isolate Unclassified
212 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
213 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
214 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
215 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
216 2643221714 Streptomyces sp. Root264 Isolate Unclassified
217 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
218 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
219 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
220 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
221 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
222 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
223 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
224 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
225 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
226 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
227 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
228 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
229 2808606448 Streptomyces sp. 193411 Isolate Unclassified
230 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
231 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
232 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
233 2818991459 Paenibacillus sp. 597 Isolate Unclassified
234 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
235 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
236 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
237 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
238 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
239 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
240 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
241 2862574272 Streptomyces sp. AcE210 Isolate Nodule
242 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
243 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
244 2867369537 Streptomyces sp. Z26 Isolate Unclassified
245 2867428634 Streptomyces sp. RP5T Isolate Unclassified
246 2867475112 Streptomyces sp. TM32 Isolate Unclassified
247 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
248 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
249 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
250 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
251 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
252 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
253 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
254 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
255 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
256 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
257 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
258 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
259 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
260 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
261 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
262 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
263 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
264 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
265 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
266 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
267 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
268 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
269 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
270 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
271 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
272 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
273 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
274 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
275 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
276 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
277 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
278 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
279 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
280 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
281 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
282 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
283 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
284 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
285 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
286 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
287 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
288 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
289 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
290 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
291 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
292 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
293 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
294 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
295 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
296 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
297 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
298 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
299 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
300 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 75.88
Metatranscriptomes 0.88
Isolates 23.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 1.1
Rhizoplane 0.66
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10016189 3300031616 Bacteria 6790
2 JGI24737J22298_10013908 3300001990 Bacteria 2617
3 JGI24735J21928_10028055 3300002067 Bacteria 1683
4 rootH1_10008139 3300003316 Bacteria 26986
5 rootH1_10008139 3300003323 Bacteria 8261
6 rootL2_10047560 3300003322 Bacteria 3085
7 rootH1_10031423 3300003323 Bacteria 5636
8 Ga0070685_10176508 3300005466 Bacteria 1372
9 Ga0068853_100082657 3300005539 Bacteria 2813
10 Ga0081455_10015273 3300005937 Bacteria 7466
11 Ga0075368_10060737 3300006042 Bacteria 1513
12 Ga0075363_100117813 3300006048 Bacteria 1481
13 Ga0075363_100168707 3300006048 Bacteria 1242
14 Ga0075367_10160442 3300006178 Bacteria 1398
15 Ga0105251_10092718 3300009011 Bacteria 1386
16 Ga0157369_10536990 3300013105 Bacteria 1209
17 Ga0157372_10076096 3300013307 Bacteria 3789
18 Ga0157375_10704403 3300013308 Bacteria 1163
19 Ga0182008_10001431 3300014497 Bacteria 16003
20 Ga0182007_10001295 3300015262 Bacteria 13522
21 Ga0182005_1011545 3300015265 Bacteria 2515
22 Ga0183367_1005 3300015688 Bacteria 652063
23 Ga0206350_10752726 3300020080 Bacteria 1196
24 Ga0213876_10001010 3300021384 Bacteria 18247
25 Ga0209758_1007944 3300025297 Bacteria 7034
26 Ga0207426_1003767 3300025302 Bacteria 7895
27 Ga0207426_1003804 3300025302 Bacteria 7825
28 Ga0207426_1006264 3300025302 Bacteria 5206
29 Ga0207426_1009424 3300025302 Bacteria 3863
30 Ga0207426_1025908 3300025302 Bacteria 1970
31 Ga0207647_10017918 3300025904 Bacteria 4804
32 Ga0207709_10117022 3300025935 Bacteria 1793
33 Ga0207691_10181264 3300025940 Bacteria 1840
34 Ga0207639_10232828 3300026041 Bacteria 1598
35 Ga0209371_1006139 3300027312 Bacteria 4543
36 Ga0268266_10042264 3300028379 Bacteria 3893
37 Ga0307517_10013608 3300028786 Bacteria 11026
38 Ga0307515_10000732 3300028794 Bacteria 75720
39 Ga0307515_10143124 3300028794 Bacteria 2551
40 Ga0307515_10280221 3300028794 Bacteria 1375
41 Ga0268256_1005582 3300030500 Bacteria 4900
42 Ga0307511_10002182 3300030521 Bacteria 20560
43 Ga0307511_10066687 3300030521 Bacteria 2680
44 Ga0307512_10079769 3300030522 Bacteria 2361
45 Ga0307513_10081170 3300031456 Bacteria 3342
46 Ga0307513_10114684 3300031456 Bacteria 2679
47 Ga0307509_10012534 3300031507 Bacteria 10135
48 Ga0307509_10086445 3300031507 Bacteria 3224
49 Ga0307408_100096344 3300031548 Bacteria 2245
50 Ga0307508_10031864 3300031616 Bacteria 4763
51 Ga0307508_10168367 3300031616 Bacteria 1794
52 Ga0307514_10006972 3300031649 Bacteria 9774
53 Ga0307514_10024498 3300031649 Bacteria 4886
54 Ga0316579_10001858 3300031691 Bacteria 7821
55 Ga0316576_10010937 3300031727 Bacteria 5918
56 Ga0316576_10018680 3300031727 Bacteria 4738
57 Ga0316576_10376997 3300031727 Bacteria 1053
58 Ga0316578_10048746 3300031728 Bacteria 2474
59 Ga0307516_10001819 3300031730 Bacteria 29316
60 Ga0307516_10041351 3300031730 Bacteria 4582
61 Ga0316577_10006187 3300031733 Bacteria 6313
62 Ga0316577_10069258 3300031733 Bacteria 1971
63 Ga0307518_10060157 3300031838 Bacteria 2759
64 Ga0307416_100116191 3300032002 Bacteria 2371
65 Ga0316585_10000328 3300032137 Bacteria 10717
66 Ga0316580_10000645 3300032139 Bacteria 8231
67 Ga0307507_10009904 3300033179 Bacteria 12536
68 Ga0307510_10035566 3300033180 Bacteria 5560
69 Ga0307510_10147290 3300033180 Bacteria 1983
70 Ga0316592_1005972 3300033524 Bacteria 2332
71 Ga0316588_1018347 3300033528 Bacteria 1567
72 Ga0316596_1003988 3300033541 Bacteria 3273
73 Ga0316574_0005621 3300035398 Bacteria 6703
74 Ga0316574_0021100 3300035398 Bacteria 3863
75 Ga0316582_0037646 3300036647 Bacteria 3000
76 Ga0316582_0087697 3300036647 Bacteria 2043
77 Ga0316582_0394370 3300036647 Bacteria 953
78 Ga0316584_0004949 3300036712 Bacteria 8867
79 Ga0316584_0007771 3300036712 Bacteria 7352
80 Ga0316584_0011705 3300036712 Bacteria 6173
81 Ga0316584_0306495 3300036712 Bacteria 1149
82 Ga0395900_0072637 3300037418 Bacteria 3537
83 Ga0395898_0001516 3300037466 Bacteria 32005
84 Ga0395898_0016808 3300037466 Bacteria 7474
85 Ga0316581_0001619 3300037588 Bacteria 5140
86 Ga0436364_0769661 3300037853 Bacteria 6683
87 Ga0395901_0498856 3300038443 Bacteria 1239
88 Ga0436365_1421393 3300039437 Bacteria 22598
89 Ga0439436_0026029 3300041404 Bacteria 1716
90 Ga0439436_0039896 3300041404 Bacteria 1347
91 Ga0451837_0141974 3300041494 Bacteria 6529
92 Ga0451853_0768333 3300041512 Bacteria 3710
93 Ga0451853_2769894 3300041512 Bacteria 2640
94 Ga0451853_2975965 3300041512 Bacteria 1311
95 Ga0439433_0004280 3300041999 Bacteria 3070
96 Ga0439442_036774 3300042002 Bacteria 1025
97 Ga0439448_0001937 3300042005 Bacteria 5517
98 Ga0439449_0000318 3300042007 Bacteria 17458
99 Ga0439449_0055128 3300042007 Bacteria 1468
100 Ga0439450_033194 3300042008 Bacteria 1169
101 Ga0439455_0001491 3300042012 Bacteria 3929
102 Ga0439457_004056 3300042014 Bacteria 3881
103 Ga0439457_015020 3300042014 Bacteria 1730
104 Ga0450894_001855 3300042131 Bacteria 2932
105 Ga0450896_007160 3300042133 Bacteria 1536
106 Ga0450898_003795 3300042134 Bacteria 2193
107 Ga0450903_000101 3300042138 Bacteria 18122
108 Ga0450903_004046 3300042138 Bacteria 2515
109 Ga0439458_0000094 3300042157 Bacteria 17181
110 Ga0466969_0007336 3300044656 Bacteria 5860
111 Ga0466969_0012377 3300044656 Bacteria 4500
112 Ga0466969_0026954 3300044656 Bacteria 2945
113 Ga0466969_0035182 3300044656 Bacteria 2534
114 Ga0466972_0003062 3300044658 Bacteria 8290
115 Ga0466972_0018752 3300044658 Bacteria 3458
116 Ga0466972_0027028 3300044658 Bacteria 2841
117 Ga0466965_0006981 3300044683 Bacteria 5166
118 Ga0466966_0000897 3300044684 Bacteria 19011
119 Ga0466966_0003071 3300044684 Bacteria 11009
120 Ga0466966_0051231 3300044684 Bacteria 2624
121 Ga0466961_0000635 3300044693 Bacteria 22003
122 Ga0466961_0003778 3300044693 Bacteria 9471
123 Ga0466961_0015390 3300044693 Bacteria 4912
124 Ga0466963_0002565 3300044694 Bacteria 10190
125 Ga0466963_0002781 3300044694 Bacteria 9864
126 Ga0466964_0007221 3300044706 Bacteria 4152
127 Ga0466971_0000309 3300044719 Bacteria 18830
128 Ga0466968_0018963 3300044735 Bacteria 2764
129 Ga0466970_0000353 3300044765 Bacteria 22298
130 Ga0466970_0037659 3300044765 Bacteria 2564
131 Ga0466957_0002206 3300044842 Bacteria 10441
132 Ga0466960_0081003 3300044901 Bacteria 1636
133 Ga0466959_0001018 3300045049 Bacteria 16687
134 Ga0466959_0011585 3300045049 Bacteria 6337
135 Ga0466959_0099233 3300045049 Bacteria 2085
136 Ga0466958_0000587 3300045836 Bacteria 15466
137 Ga0466967_0000445 3300045976 Bacteria 19801
138 Ga0466967_0004895 3300045976 Bacteria 9150
139 Ga0466967_0008309 3300045976 Bacteria 7590
140 Ga0495617_005920 3300046452 Bacteria 4316
141 Ga0495627_021190 3300046453 Bacteria 2158
142 Ga0495592_0011928 3300046454 Bacteria 6588
143 Ga0495592_0016130 3300046454 Bacteria 5667
144 Ga0495592_0149529 3300046454 Bacteria 1616
145 Ga0495592_0167379 3300046454 Bacteria 1508
146 Ga0495603_0001591 3300046455 Bacteria 13313
147 Ga0495603_0005682 3300046455 Bacteria 7452
148 Ga0495603_0009602 3300046455 Bacteria 5849
149 Ga0495603_0020708 3300046455 Bacteria 3983
150 Ga0495603_0065626 3300046455 Bacteria 2139
151 Ga0495590_0016979 3300046457 Bacteria 2626
152 Ga0495629_0014153 3300046459 Bacteria 5746
153 Ga0495629_0016844 3300046459 Bacteria 5245
154 Ga0495629_0021681 3300046459 Bacteria 4583
155 Ga0495629_0179836 3300046459 Bacteria 1466
156 Ga0495638_0131164 3300046460 Bacteria 1471
157 Ga0495651_0193044 3300046462 Bacteria 1431
158 Ga0495651_0203330 3300046462 Bacteria 1384
159 Ga0495582_0008683 3300046473 Bacteria 5603
160 Ga0495605_0009582 3300046474 Bacteria 5438
161 Ga0495662_0000827 3300046476 Bacteria 15049
162 Ga0495662_0019651 3300046476 Bacteria 3268
163 Ga0495585_0009469 3300046492 Bacteria 5841
164 Ga0495585_0070772 3300046492 Bacteria 1902
165 Ga0495585_0076697 3300046492 Bacteria 1815
166 Ga0495594_0015339 3300046499 Bacteria 4024
167 Ga0495594_0087557 3300046499 Bacteria 1743
168 Ga0495596_0035986 3300046500 Bacteria 1962
169 Ga0495607_0046369 3300046501 Bacteria 2553
170 Ga0495583_0063698 3300046506 Bacteria 1638
171 Ga0495606_0002906 3300046507 Bacteria 18927
172 Ga0495608_0042623 3300046511 Bacteria 3035
173 Ga0495618_0162084 3300046514 Bacteria 1425
174 Ga0495620_0024660 3300046515 Bacteria 2856
175 Ga0495628_0006113 3300046516 Bacteria 10532
176 Ga0495628_0195199 3300046516 Bacteria 1527
177 Ga0495630_0024261 3300046517 Bacteria 4485
178 Ga0495631_0015330 3300046518 Bacteria 3674
179 Ga0495631_0122600 3300046518 Bacteria 1118
180 Ga0495632_0035161 3300046519 Bacteria 2559
181 Ga0495637_0041041 3300046520 Bacteria 1988
182 Ga0495643_0006695 3300046522 Bacteria 7545
183 Ga0495648_0046781 3300046524 Bacteria 2679
184 Ga0495666_0006356 3300046526 Bacteria 5948
185 Ga0495642_0152840 3300046528 Bacteria 999
186 Ga0495652_0077375 3300046529 Bacteria 2758
187 Ga0495652_0086823 3300046529 Bacteria 2567
188 Ga0495640_0026305 3300046533 Bacteria 4206
189 Ga0495640_0242198 3300046533 Bacteria 1132
190 Ga0495586_0110315 3300046535 Bacteria 1531
191 Ga0495587_0002801 3300046536 Bacteria 11656
192 Ga0495609_0057896 3300046538 Bacteria 1714
193 Ga0495597_0010896 3300046542 Bacteria 4423
194 Ga0495597_0088201 3300046542 Bacteria 1319
195 Ga0495645_0046128 3300046543 Bacteria 3177
196 Ga0495645_0075974 3300046543 Bacteria 2418
197 Ga0495622_0002664 3300046557 Bacteria 8574
198 Ga0495622_0047127 3300046557 Bacteria 2003
199 Ga0495622_0072226 3300046557 Bacteria 1592
200 Ga0495633_0012139 3300046558 Bacteria 4598
201 Ga0495667_0111770 3300046559 Bacteria 1765
202 Ga0495667_0146640 3300046559 Bacteria 1520
203 Ga0495667_0166132 3300046559 Bacteria 1419
204 Ga0495634_0018659 3300046642 Bacteria 4934
205 Ga0495634_0022355 3300046642 Bacteria 4457
206 Ga0495634_0055086 3300046642 Bacteria 2660
207 Ga0495634_0087415 3300046642 Bacteria 2028
208 Ga0495611_0011103 3300046648 Bacteria 3815
209 Ga0495611_0059061 3300046648 Bacteria 1740
210 Ga0495625_0016692 3300046660 Bacteria 5767
211 Ga0495625_0075715 3300046660 Bacteria 2354
212 Ga0495635_0011000 3300046663 Bacteria 6341
213 Ga0495635_0030949 3300046663 Bacteria 3717
214 Ga0495661_0050466 3300046665 Bacteria 2519
215 Ga0495588_0005587 3300046674 Bacteria 5604
216 Ga0495588_0028404 3300046674 Bacteria 2799
217 Ga0495657_0003471 3300046675 Bacteria 12856
218 Ga0495657_0012196 3300046675 Bacteria 6393
219 Ga0495657_0047347 3300046675 Bacteria 2907
220 Ga0495657_0185590 3300046675 Bacteria 1273
221 Ga0495646_0000959 3300046680 Bacteria 16477
222 Ga0495646_0086859 3300046680 Bacteria 1813
223 Ga0495658_0140732 3300046683 Bacteria 1475
224 Ga0495613_0002480 3300046689 Bacteria 13923
225 Ga0495613_0012252 3300046689 Bacteria 6372
226 Ga0495613_0016907 3300046689 Bacteria 5431
227 Ga0495613_0019995 3300046689 Bacteria 4989
228 Ga0495613_0028237 3300046689 Bacteria 4173
229 Ga0495613_0112213 3300046689 Bacteria 1963
230 Ga0495624_0029142 3300046690 Bacteria 3603
231 Ga0495671_0005743 3300046692 Bacteria 7234
232 Ga0495649_0014192 3300046694 Bacteria 4574
233 Ga0495589_0012057 3300046794 Bacteria 4482
234 Ga0495589_0017092 3300046794 Bacteria 3726
235 Ga0495600_0045134 3300046809 Bacteria 2875
236 Ga0495660_0009262 3300046810 Bacteria 5749
237 Ga0495660_0028923 3300046810 Bacteria 3129
238 Ga0495581_0025327 3300047315 Bacteria 3440
239 Ga0495581_0056356 3300047315 Bacteria 2268
240 Ga0495581_0151550 3300047315 Bacteria 1354
241 Ga0495604_0001282 3300047317 Bacteria 20560
242 Ga0495604_0035708 3300047317 Bacteria 3923
243 Ga0495674_0545769 3300047319 Bacteria 923
244 Ga0495676_0008799 3300047321 Bacteria 9230
245 Ga0495676_0010360 3300047321 Bacteria 8455
246 Ga0495676_0033803 3300047321 Bacteria 4298
247 Ga0495680_0001580 3300047322 Bacteria 24370
248 Ga0495683_0007526 3300047323 Bacteria 5876
249 Ga0495683_0020895 3300047323 Bacteria 3375
250 Ga0495687_007785 3300047443 Bacteria 6237
251 Ga0495687_009101 3300047443 Bacteria 5592
252 Ga0495687_019084 3300047443 Bacteria 3374
253 Ga0495675_0002889 3300047444 Bacteria 10314
254 Ga0495675_0029111 3300047444 Bacteria 3521
255 Ga0495677_0030043 3300047445 Bacteria 1977
256 Ga0495685_013177 3300047447 Bacteria 2805
257 Ga0495685_019881 3300047447 Bacteria 2308
258 Ga0495685_059359 3300047447 Bacteria 1290
259 Ga0495681_0000578 3300047470 Bacteria 27956
260 Ga0495686_0029243 3300047472 Bacteria 3585
261 Ga0495593_0003831 3300047673 Bacteria 8981
262 Ga0495593_0033515 3300047673 Bacteria 2796
263 Ga0495593_0073845 3300047673 Bacteria 1768
264 Ga0495602_0013451 3300048088 Bacteria 8364
265 Ga0495614_0004616 3300048089 Bacteria 6204
266 Ga0495614_0007362 3300048089 Bacteria 4901
267 Ga0495626_0005855 3300048091 Bacteria 7088
268 Ga0496108_0160217 3300048911 Bacteria 1944
269 Ga0496109_0160196 3300048912 Bacteria 2108
270 Ga0496116_0031238 3300048919 Bacteria 3817
271 Ga0496117_0005862 3300048920 Bacteria 12705
272 Ga0496117_0019023 3300048920 Bacteria 5659
273 Ga0496119_0001016 3300048922 Bacteria 35897
274 Ga0496120_0000059 3300048923 Bacteria 176517
275 Ga0496120_0006052 3300048923 Bacteria 9401
276 Ga0496121_0102012 3300048924 Bacteria 2211
277 Ga0496121_0245323 3300048924 Bacteria 1245
278 Ga0496122_0017145 3300048925 Bacteria 6792
279 Ga0496122_0034121 3300048925 Bacteria 4171
280 Ga0496124_0000372 3300048927 Bacteria 81692
281 Ga0496124_0133291 3300048927 Bacteria 1971
282 Ga0496125_0001844 3300048928 Bacteria 29235
283 Ga0496126_0002833 3300048929 Bacteria 22699
284 Ga0496126_0005001 3300048929 Bacteria 15440
285 Ga0495678_031955 3300049459 Bacteria 2188
286 Ga0501031_0021010 3300049568 Bacteria 4257
287 Ga0501032_0065157 3300049569 Bacteria 2437
288 Ga0501033_0004145 3300049570 Bacteria 11676
289 Ga0501033_0100297 3300049570 Bacteria 2113
290 Ga0501034_0001790 3300049571 Bacteria 27440
291 Ga0501034_0018137 3300049571 Bacteria 7220
292 Ga0501034_0036764 3300049571 Bacteria 4959
293 Ga0501034_0153787 3300049571 Bacteria 2275
294 Ga0501036_0000473 3300049572 Bacteria 28723
295 Ga0501036_0003536 3300049572 Bacteria 12501
296 Ga0501036_0080875 3300049572 Bacteria 2746
297 Ga0501036_0086447 3300049572 Bacteria 2650
298 Ga0501037_0064402 3300049573 Bacteria 2671
299 Ga0501037_0254669 3300049573 Bacteria 1228
300 Ga0501038_0002476 3300049574 Bacteria 17178
301 Ga0501038_0024713 3300049574 Bacteria 5356
302 Ga0501038_0055640 3300049574 Bacteria 3398
303 Ga0501038_0090116 3300049574 Bacteria 2571
304 Ga0501038_0302502 3300049574 Bacteria 1255
305 Ga0501039_0034853 3300049575 Bacteria 3884
306 Ga0501039_0115621 3300049575 Bacteria 2100
307 Ga0501042_0006399 3300049578 Bacteria 7637
308 Ga0501043_0001789 3300049579 Bacteria 18478
309 Ga0501043_0002024 3300049579 Bacteria 17309
310 Ga0501043_0050895 3300049579 Bacteria 3256
311 Ga0501043_0100036 3300049579 Bacteria 2279
312 Ga0501046_0021873 3300049580 Bacteria 5271
313 Ga0501046_0055620 3300049580 Bacteria 3108
314 Ga0501047_0014415 3300049581 Bacteria 7516
315 Ga0501047_0022069 3300049581 Bacteria 6114
316 Ga0501047_0037069 3300049581 Bacteria 4714
317 Ga0501047_0052184 3300049581 Bacteria 3952
318 Ga0501047_0066173 3300049581 Bacteria 3483
319 Ga0501047_0150980 3300049581 Bacteria 2199
320 Ga0501048_0005158 3300049582 Bacteria 9954
321 Ga0501070_0000381 3300049586 Bacteria 40532
322 Ga0501072_0053435 3300049588 Bacteria 3181
323 Ga0501073_0140927 3300049589 Bacteria 1671
324 Ga0501074_0001091 3300049590 Bacteria 17715
325 Ga0501074_0002346 3300049590 Bacteria 13176
326 Ga0501074_0210583 3300049590 Bacteria 1385
327 Ga0501080_0014845 3300049742 Bacteria 7173
328 Ga0501080_0051643 3300049742 Bacteria 3826
329 Ga0501282_009992 3300049778 Bacteria 1017
330 Ga0501035_0003936 3300049822 Bacteria 14163
331 Ga0501035_0014720 3300049822 Bacteria 7220
332 Ga0501035_0041946 3300049822 Bacteria 4129
333 Ga0501035_0076954 3300049822 Bacteria 2949
334 Ga0501035_0084173 3300049822 Bacteria 2805
335 Ga0501035_0136771 3300049822 Bacteria 2133
336 Ga0501044_0000276 3300049823 Bacteria 65263
337 Ga0501044_0012757 3300049823 Bacteria 9100
338 Ga0501044_0027622 3300049823 Bacteria 5994
339 Ga0501044_0032143 3300049823 Bacteria 5516
340 Ga0501044_0039160 3300049823 Bacteria 4945
341 Ga0501044_0042577 3300049823 Bacteria 4722
342 Ga0501044_0223414 3300049823 Bacteria 1833
343 Ga0501044_0249700 3300049823 Bacteria 1715
344 Ga0501044_0381134 3300049823 Bacteria 1325
345 Ga0501044_0509785 3300049823 Bacteria 1103
346 Ga0501045_0055801 3300049824 Bacteria 2889
347 nmdc:mga07m45_220208_c1 3300050496 Bacteria 1104
348 Ga0500553_123773 3300053101 Bacteria 1059
349 Ga0500634_0132479 3300053161 Bacteria 1195
350 Ga0466962_0001069 3300061719 Bacteria 12596
351 2547408141 2547132111 Bacteria 8013147
352 2558908364 2558860112 Bacteria 9931328
353 2585299166 2582581312 Bacteria 7308206
354 2585308821 2582581313 Bacteria 10042643
355 2585313515 2582581314 Bacteria 11452267
356 2616695046 2616644814 Bacteria 11555299
357 2643764965 2643221548 Bacteria 8053412
358 2643902556 2643221578 Bacteria 9213798
359 2643942205 2643221587 Bacteria 7586415
360 2644262308 2643221647 Bacteria 10741251
361 2644404935 2643221673 Bacteria 9196637
362 2644429288 2643221677 Bacteria 7584031
363 2644437181 2643221678 Bacteria 9540101
364 2644461195 2643221682 Bacteria 6743283
365 2644628921 2643221714 Bacteria 9015452
366 2723603701 2721755693 Bacteria 6126117
367 2730139696 2728369359 Bacteria 5621728
368 2753808017 2751185905 Bacteria 6142767
369 2784588597 2784132148 Bacteria 8627943
370 2785343269 2784746763 Bacteria 9783172
371 2785369526 2784746768 Bacteria 10036182
372 2786670636 2786546132 Bacteria 10419719
373 2793979710 2791355406 Bacteria 11364898
374 2802435797 2802428803 Bacteria 5806948
375 2804847016 2802429296 Bacteria 7227771
376 2808842079 2808606359 Bacteria 9866990
377 2808920604 2808606375 Bacteria 9466072
378 2809232210 2808606448 Bacteria 8656184
379 2809234524 2808606448 Bacteria 8656184
380 2811849078 2808606982 Bacteria 7791042
381 2812358058 2811994879 Bacteria 9313447
382 2812480499 2811994917 Bacteria 7761064
383 2819671629 2818991459 Bacteria 8736032
384 2819695417 2818991463 Bacteria 7948711
385 2852636627 2852635781 Bacteria 8251373
386 2852639525 2852635781 Bacteria 8251373
387 2862179454 2862178590 Bacteria 8583590
388 2862179455 2862178590 Bacteria 8583590
389 2862285687 2862281513 Bacteria 9621493
390 2862290646 2862290372 Bacteria 7471434
391 2862384503 2862382967 Bacteria 10317375
392 2862390143 2862382967 Bacteria 10317375
393 2862511785 2862507626 Bacteria 9425308
394 2862579235 2862574272 Bacteria 10567477
395 2862707330 2862705112 Bacteria 6563286
396 2863404576 2863404153 Bacteria 9672205
397 2867371915 2867369537 Bacteria 6501581
398 2867435309 2867428634 Bacteria 9590268
399 2867480601 2867475112 Bacteria 6909112
400 2875395716 2875391855 Bacteria 7600475
401 2877681086 2877676314 Bacteria 9512378
402 2889279634 2889276214 Bacteria 5979355
403 2904596960 2904595352 Bacteria 6124848
404 2904756749 2904755435 Bacteria 7986759
405 2912719929 2912715099 Bacteria 9460473
406 2912724328 2912723979 Bacteria 8557534
407 2912760810 2912757875 Bacteria 7940295
408 2919431381 2919425241 Bacteria 8055701
409 2919469493 2919468124 Bacteria 9133025
410 2946048926 2946045630 Bacteria 8527308
411 2946067783 2946064051 Bacteria 8957905
412 2946075937 2946072368 Bacteria 8999607
413 2947229204 2947224130 Bacteria 9938529
414 2954007377 2954002825 Bacteria 9173742
415 2954386205 2954380949 Bacteria 10050426
416 2954676958 2954673503 Bacteria 9685905
417 2954687200 2954682443 Bacteria 9862841
418 2954705291 2954701450 Bacteria 10834262
419 2954716220 2954711539 Bacteria 10867210
420 2954726162 2954721474 Bacteria 10456478
421 2954735648 2954731030 Bacteria 10243860
422 2954745088 2954740390 Bacteria 10229294
423 2954754503 2954749733 Bacteria 10366972
424 2954764059 2954759201 Bacteria 9358192
425 2966601656 2966598605 Bacteria 7676064
426 2980182721 2980182181 Bacteria 9454109
427 2990047006 2990044586 Bacteria 6603797
428 2990065869 2990059506 Bacteria 9321252
429 2995467421 2995463766 Bacteria 8577691
430 2997457811 2997451912 Bacteria 8492419
431 2997600392 2997600082 Bacteria 9896405
432 3006325030 3006321560 Bacteria 8247479
433 3006325919 3006321560 Bacteria 8247479
434 3006398372 3006393351 Bacteria 6615579
435 3006428732 3006425503 Bacteria 6491253
436 3006490385 3006486233 Bacteria 8157040
437 3006500782 3006493962 Bacteria 8825450
438 648169992 648028048 Bacteria 5394884
439 8008485487 8008485437 Bacteria 7198341
440 8008559130 8008558824 Bacteria 10610750
441 8008567272 8008558824 Bacteria 10610750
442 8008578869 8008574985 Bacteria 7815457
443 8023630144 8023623736 Bacteria 8593882
444 8023630152 8023623736 Bacteria 8593882
445 8025417729 8025413630 Bacteria 7014048
446 8025480343 8025478263 Bacteria 8209203
447 8025529961 8025524527 Bacteria 7197316
448 8025538011 8025530807 Bacteria 8495698
449 8047898087 8047893842 Bacteria 11723082
450 8048136809 8048127548 Bacteria 11053136
451 8048360806 8048356638 Bacteria 11044339
452 8048375050 8048369669 Bacteria 11666822
453 8048383156 8048379754 Bacteria 11877923
454 8048412724 8048406513 Bacteria 8936924
455 8056669605 8056667051 Bacteria 6953971
456 8056833604 8056829672 Bacteria 9045328
457 Ga0307508_10016189
458 JGI24737J22298_10013908
459 JGI24735J21928_10028055
460 rootH1_10008139
461 rootL2_10047560
462 rootH1_10031423
463 Ga0070685_10176508
464 Ga0068853_100082657
465 Ga0081455_10015273
466 Ga0075368_10060737
467 Ga0075363_100117813
468 Ga0075363_100168707
469 Ga0075367_10160442
470 Ga0105251_10092718
471 Ga0157369_10536990
472 Ga0157372_10076096
473 Ga0157375_10704403
474 Ga0182008_10001431
475 Ga0182007_10001295
476 Ga0182005_1011545
477 Ga0183367_1005
478 Ga0206350_10752726
479 Ga0213876_10001010
480 Ga0209758_1007944
481 Ga0207426_1003767
482 Ga0207426_1003804
483 Ga0207426_1006264
484 Ga0207426_1009424
485 Ga0207426_1025908
486 Ga0207647_10017918
487 Ga0207709_10117022
488 Ga0207691_10181264
489 Ga0207639_10232828
490 Ga0209371_1006139
491 Ga0268266_10042264
492 Ga0307517_10013608
493 Ga0307515_10000732
494 Ga0307515_10143124
495 Ga0307515_10280221
496 Ga0268256_1005582
497 Ga0307511_10002182
498 Ga0307511_10066687
499 Ga0307512_10079769
500 Ga0307513_10081170
501 Ga0307513_10114684
502 Ga0307509_10012534
503 Ga0307509_10086445
504 Ga0307408_100096344
505 Ga0307508_10031864
506 Ga0307508_10168367
507 Ga0307514_10006972
508 Ga0307514_10024498
509 Ga0316579_10001858
510 Ga0316576_10010937
511 Ga0316576_10018680
512 Ga0316576_10376997
513 Ga0316578_10048746
514 Ga0307516_10001819
515 Ga0307516_10041351
516 Ga0316577_10006187
517 Ga0316577_10069258
518 Ga0307518_10060157
519 Ga0307416_100116191
520 Ga0316585_10000328
521 Ga0316580_10000645
522 Ga0307507_10009904
523 Ga0307510_10035566
524 Ga0307510_10147290
525 Ga0316592_1005972
526 Ga0316588_1018347
527 Ga0316596_1003988
528 Ga0316574_0005621
529 Ga0316574_0021100
530 Ga0316582_0037646
531 Ga0316582_0087697
532 Ga0316582_0394370
533 Ga0316584_0004949
534 Ga0316584_0007771
535 Ga0316584_0011705
536 Ga0316584_0306495
537 Ga0395900_0072637
538 Ga0395898_0001516
539 Ga0395898_0016808
540 Ga0316581_0001619
541 Ga0436364_0769661
542 Ga0395901_0498856
543 Ga0436365_1421393
544 Ga0439436_0026029
545 Ga0439436_0039896
546 Ga0451837_0141974
547 Ga0451853_0768333
548 Ga0451853_2769894
549 Ga0451853_2975965
550 Ga0439433_0004280
551 Ga0439442_036774
552 Ga0439448_0001937
553 Ga0439449_0000318
554 Ga0439449_0055128
555 Ga0439450_033194
556 Ga0439455_0001491
557 Ga0439457_004056
558 Ga0439457_015020
559 Ga0450894_001855
560 Ga0450896_007160
561 Ga0450898_003795
562 Ga0450903_000101
563 Ga0450903_004046
564 Ga0439458_0000094
565 Ga0466969_0007336
566 Ga0466969_0012377
567 Ga0466969_0026954
568 Ga0466969_0035182
569 Ga0466972_0003062
570 Ga0466972_0018752
571 Ga0466972_0027028
572 Ga0466965_0006981
573 Ga0466966_0000897
574 Ga0466966_0003071
575 Ga0466966_0051231
576 Ga0466961_0000635
577 Ga0466961_0003778
578 Ga0466961_0015390
579 Ga0466963_0002565
580 Ga0466963_0002781
581 Ga0466964_0007221
582 Ga0466971_0000309
583 Ga0466968_0018963
584 Ga0466970_0000353
585 Ga0466970_0037659
586 Ga0466957_0002206
587 Ga0466960_0081003
588 Ga0466959_0001018
589 Ga0466959_0011585
590 Ga0466959_0099233
591 Ga0466958_0000587
592 Ga0466967_0000445
593 Ga0466967_0004895
594 Ga0466967_0008309
595 Ga0495617_005920
596 Ga0495627_021190
597 Ga0495592_0011928
598 Ga0495592_0016130
599 Ga0495592_0149529
600 Ga0495592_0167379
601 Ga0495603_0001591
602 Ga0495603_0005682
603 Ga0495603_0009602
604 Ga0495603_0020708
605 Ga0495603_0065626
606 Ga0495590_0016979
607 Ga0495629_0014153
608 Ga0495629_0016844
609 Ga0495629_0021681
610 Ga0495629_0179836
611 Ga0495638_0131164
612 Ga0495651_0193044
613 Ga0495651_0203330
614 Ga0495582_0008683
615 Ga0495605_0009582
616 Ga0495662_0000827
617 Ga0495662_0019651
618 Ga0495585_0009469
619 Ga0495585_0070772
620 Ga0495585_0076697
621 Ga0495594_0015339
622 Ga0495594_0087557
623 Ga0495596_0035986
624 Ga0495607_0046369
625 Ga0495583_0063698
626 Ga0495606_0002906
627 Ga0495608_0042623
628 Ga0495618_0162084
629 Ga0495620_0024660
630 Ga0495628_0006113
631 Ga0495628_0195199
632 Ga0495630_0024261
633 Ga0495631_0015330
634 Ga0495631_0122600
635 Ga0495632_0035161
636 Ga0495637_0041041
637 Ga0495643_0006695
638 Ga0495648_0046781
639 Ga0495666_0006356
640 Ga0495642_0152840
641 Ga0495652_0077375
642 Ga0495652_0086823
643 Ga0495640_0026305
644 Ga0495640_0242198
645 Ga0495586_0110315
646 Ga0495587_0002801
647 Ga0495609_0057896
648 Ga0495597_0010896
649 Ga0495597_0088201
650 Ga0495645_0046128
651 Ga0495645_0075974
652 Ga0495622_0002664
653 Ga0495622_0047127
654 Ga0495622_0072226
655 Ga0495633_0012139
656 Ga0495667_0111770
657 Ga0495667_0146640
658 Ga0495667_0166132
659 Ga0495634_0018659
660 Ga0495634_0022355
661 Ga0495634_0055086
662 Ga0495634_0087415
663 Ga0495611_0011103
664 Ga0495611_0059061
665 Ga0495625_0016692
666 Ga0495625_0075715
667 Ga0495635_0011000
668 Ga0495635_0030949
669 Ga0495661_0050466
670 Ga0495588_0005587
671 Ga0495588_0028404
672 Ga0495657_0003471
673 Ga0495657_0012196
674 Ga0495657_0047347
675 Ga0495657_0185590
676 Ga0495646_0000959
677 Ga0495646_0086859
678 Ga0495658_0140732
679 Ga0495613_0002480
680 Ga0495613_0012252
681 Ga0495613_0016907
682 Ga0495613_0019995
683 Ga0495613_0028237
684 Ga0495613_0112213
685 Ga0495624_0029142
686 Ga0495671_0005743
687 Ga0495649_0014192
688 Ga0495589_0012057
689 Ga0495589_0017092
690 Ga0495600_0045134
691 Ga0495660_0009262
692 Ga0495660_0028923
693 Ga0495581_0025327
694 Ga0495581_0056356
695 Ga0495581_0151550
696 Ga0495604_0001282
697 Ga0495604_0035708
698 Ga0495674_0545769
699 Ga0495676_0008799
700 Ga0495676_0010360
701 Ga0495676_0033803
702 Ga0495680_0001580
703 Ga0495683_0007526
704 Ga0495683_0020895
705 Ga0495687_007785
706 Ga0495687_009101
707 Ga0495687_019084
708 Ga0495675_0002889
709 Ga0495675_0029111
710 Ga0495677_0030043
711 Ga0495685_013177
712 Ga0495685_019881
713 Ga0495685_059359
714 Ga0495681_0000578
715 Ga0495686_0029243
716 Ga0495593_0003831
717 Ga0495593_0033515
718 Ga0495593_0073845
719 Ga0495602_0013451
720 Ga0495614_0004616
721 Ga0495614_0007362
722 Ga0495626_0005855
723 Ga0496108_0160217
724 Ga0496109_0160196
725 Ga0496116_0031238
726 Ga0496117_0005862
727 Ga0496117_0019023
728 Ga0496119_0001016
729 Ga0496120_0000059
730 Ga0496120_0006052
731 Ga0496121_0102012
732 Ga0496121_0245323
733 Ga0496122_0017145
734 Ga0496122_0034121
735 Ga0496124_0000372
736 Ga0496124_0133291
737 Ga0496125_0001844
738 Ga0496126_0002833
739 Ga0496126_0005001
740 Ga0495678_031955
741 Ga0501031_0021010
742 Ga0501032_0065157
743 Ga0501033_0004145
744 Ga0501033_0100297
745 Ga0501034_0001790
746 Ga0501034_0018137
747 Ga0501034_0036764
748 Ga0501034_0153787
749 Ga0501036_0000473
750 Ga0501036_0003536
751 Ga0501036_0080875
752 Ga0501036_0086447
753 Ga0501037_0064402
754 Ga0501037_0254669
755 Ga0501038_0002476
756 Ga0501038_0024713
757 Ga0501038_0055640
758 Ga0501038_0090116
759 Ga0501038_0302502
760 Ga0501039_0034853
761 Ga0501039_0115621
762 Ga0501042_0006399
763 Ga0501043_0001789
764 Ga0501043_0002024
765 Ga0501043_0050895
766 Ga0501043_0100036
767 Ga0501046_0021873
768 Ga0501046_0055620
769 Ga0501047_0014415
770 Ga0501047_0022069
771 Ga0501047_0037069
772 Ga0501047_0052184
773 Ga0501047_0066173
774 Ga0501047_0150980
775 Ga0501048_0005158
776 Ga0501070_0000381
777 Ga0501072_0053435
778 Ga0501073_0140927
779 Ga0501074_0001091
780 Ga0501074_0002346
781 Ga0501074_0210583
782 Ga0501080_0014845
783 Ga0501080_0051643
784 Ga0501282_009992
785 Ga0501035_0003936
786 Ga0501035_0014720
787 Ga0501035_0041946
788 Ga0501035_0076954
789 Ga0501035_0084173
790 Ga0501035_0136771
791 Ga0501044_0000276
792 Ga0501044_0012757
793 Ga0501044_0027622
794 Ga0501044_0032143
795 Ga0501044_0039160
796 Ga0501044_0042577
797 Ga0501044_0223414
798 Ga0501044_0249700
799 Ga0501044_0381134
800 Ga0501044_0509785
801 Ga0501045_0055801
802 nmdc:mga07m45_220208_c1
803 Ga0500553_123773
804 Ga0500634_0132479
805 Ga0466962_0001069
806 2547408141
807 2558908364
808 2585299166
809 2585308821
810 2585313515
811 2616695046
812 2643764965
813 2643902556
814 2643942205
815 2644262308
816 2644404935
817 2644429288
818 2644437181
819 2644461195
820 2644628921
821 2723603701
822 2730139696
823 2753808017
824 2784588597
825 2785343269
826 2785369526
827 2786670636
828 2793979710
829 2802435797
830 2804847016
831 2808842079
832 2808920604
833 2809232210
834 2809234524
835 2811849078
836 2812358058
837 2812480499
838 2819671629
839 2819695417
840 2852636627
841 2852639525
842 2862179454
843 2862179455
844 2862285687
845 2862290646
846 2862384503
847 2862390143
848 2862511785
849 2862579235
850 2862707330
851 2863404576
852 2867371915
853 2867435309
854 2867480601
855 2875395716
856 2877681086
857 2889279634
858 2904596960
859 2904756749
860 2912719929
861 2912724328
862 2912760810
863 2919431381
864 2919469493
865 2946048926
866 2946067783
867 2946075937
868 2947229204
869 2954007377
870 2954386205
871 2954676958
872 2954687200
873 2954705291
874 2954716220
875 2954726162
876 2954735648
877 2954745088
878 2954754503
879 2954764059
880 2966601656
881 2980182721
882 2990047006
883 2990065869
884 2995467421
885 2997457811
886 2997600392
887 3006325030
888 3006325919
889 3006398372
890 3006428732
891 3006490385
892 3006500782
893 648169992
894 8008485487
895 8008559130
896 8008567272
897 8008578869
898 8023630144
899 8023630152
900 8025417729
901 8025480343
902 8025529961
903 8025538011
904 8047898087
905 8048136809
906 8048360806
907 8048375050
908 8048383156
909 8048412724
910 8056669605
911 8056833604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

33

336

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7utf-assembly2.cif.gz_D structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9471 1 322
7utf-assembly1.cif.gz_C structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9366 1 322
7utf-assembly2.cif.gz_B structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9248 1 327
7utf-assembly1.cif.gz_A structure-function characterization of an aldo-keto reductase involved in detoxification of the mycotoxin, deoxynivalenol 0.9201 1 327
4xk2-assembly2.cif.gz_B crystal structure of aldo-keto reductase from polaromonas sp. js666 0.918 1 325
ID Description Score Start End Superfamily
af_I1KSL2_10_358_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9028 10 321 3.20.20.100
3n6qB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9003 6 320 3.20.20.100
af_Q8VZ23_56_411_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8936 1 319 3.20.20.100
4xk2A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8935 1 325 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8926 1 225 3.20.20.100
ID Description Score Start End GO Terms
AF-L7FG53-F1-model_v4 Oxidoreductase, aldo/keto reductase family protein 0.9796 1 316 GO:0005829
GO:0016491
AF-A0A7C2WW84-F1-model_v4 Aldo/keto reductase 0.9684 1 220 GO:0005829
AF-A0A1F8NBY0-F1-model_v4 Oxidoreductase 0.9678 1 220 GO:0005829
AF-A0A7C2WW84-F1-model_v4 Aldo/keto reductase 0.964 1 220 GO:0005829
AF-A0A7Y0CYA5-F1-model_v4 Aldo/keto reductase 0.9636 1 184 GO:0005829
GO:0016491

Map