F447801

General Info

Members Datasets Scaffolds Average Seq Length
456 208 912 189

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_11263496|Ga0207639_112634961
Length 175
Sequence MNIPYTIEERPDTGLTNGKLGIWLFLASEVMLFGALFSTYIILRVGAPEWPSVTMVMAWASLKLNDFGKHRMYLALTVALSVFFLINKYFEYAAHWAHGELPDKSTFLAIYFTLTGLHGLHILGGIVVMLYFLGPGAGLYKKSPEQFTNRIEYTGLYWHFVDLVWIFLFPVLYLL

Samples

Sample ID Description Type Environment
1 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.61
Rhizosphere 95.39
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207639_11263496 3300026041 Bacteria 693
2 Ga0065712_10068138 3300005290 Bacteria 14057
3 Ga0065712_10238358 3300005290 Bacteria 991
4 Ga0065715_10127942 3300005293 Bacteria 2076
5 Ga0065715_10349488 3300005293 Bacteria 953
6 Ga0065715_10481925 3300005293 Bacteria 794
7 Ga0065707_10018539 3300005295 Bacteria 2200
8 Ga0065707_10197348 3300005295 Bacteria 1328
9 Ga0065707_10202499 3300005295 Bacteria 1304
10 Ga0065707_10218237 3300005295 Bacteria 1236
11 Ga0065707_10253268 3300005295 Bacteria 1118
12 Ga0065707_10355005 3300005295 Bacteria 912
13 Ga0065707_10358328 3300005295 Bacteria 908
14 Ga0070676_10058633 3300005328 Bacteria 2282
15 Ga0070690_100163110 3300005330 Bacteria 1529
16 Ga0070690_100187289 3300005330 Bacteria 1433
17 Ga0070670_100047786 3300005331 Bacteria 3683
18 Ga0070666_10167721 3300005335 Bacteria 1537
19 Ga0070666_10216993 3300005335 Bacteria 1348
20 Ga0070666_10327178 3300005335 Bacteria 1094
21 Ga0068868_100548013 3300005338 Bacteria 1019
22 Ga0070691_10001728 3300005341 Bacteria 9485
23 Ga0070687_100033473 3300005343 Bacteria 2538
24 Ga0070661_100180735 3300005344 Bacteria 1605
25 Ga0070668_100086888 3300005347 Bacteria 2460
26 Ga0070668_100098733 3300005347 Bacteria 2311
27 Ga0070668_100983280 3300005347 Bacteria 758
28 Ga0070669_100053128 3300005353 Bacteria 2965
29 Ga0070669_100273405 3300005353 Bacteria 1352
30 Ga0070669_100305012 3300005353 Bacteria 1282
31 Ga0070675_100001537 3300005354 Bacteria 17074
32 Ga0070675_100150617 3300005354 Bacteria 1994
33 Ga0070674_100226570 3300005356 Bacteria 1457
34 Ga0070674_100740955 3300005356 Bacteria 844
35 Ga0070673_100071637 3300005364 Bacteria 2785
36 Ga0070673_100155466 3300005364 Bacteria 1941
37 Ga0070688_100197736 3300005365 Bacteria 1405
38 Ga0070667_100374434 3300005367 Bacteria 1292
39 Ga0070714_100016015 3300005435 Bacteria 6044
40 Ga0070713_100071573 3300005436 Bacteria 2930
41 Ga0070705_100016790 3300005440 Bacteria 3810
42 Ga0070705_100160351 3300005440 Bacteria 1503
43 Ga0070700_100010175 3300005441 Bacteria 5185
44 Ga0070700_100075101 3300005441 Bacteria 2167
45 Ga0070694_100002597 3300005444 Bacteria 10676
46 Ga0070694_100010066 3300005444 Bacteria 5815
47 Ga0070694_101158020 3300005444 Unclassified 647
48 Ga0070708_100064269 3300005445 Bacteria 3287
49 Ga0070708_100192176 3300005445 Bacteria 1909
50 Ga0070663_100739635 3300005455 Bacteria 839
51 Ga0070678_100062516 3300005456 Bacteria 2750
52 Ga0070678_100542369 3300005456 Bacteria 1031
53 Ga0070662_100854840 3300005457 Bacteria 775
54 Ga0070681_10123352 3300005458 Bacteria 2523
55 Ga0068867_100232644 3300005459 Bacteria 1490
56 Ga0068867_100361262 3300005459 Bacteria 1215
57 Ga0070685_10080661 3300005466 Bacteria 1950
58 Ga0070706_100274232 3300005467 Bacteria 1574
59 Ga0070698_100026990 3300005471 Bacteria 5972
60 Ga0070698_100810984 3300005471 Bacteria 880
61 Ga0070699_100102408 3300005518 Bacteria 2510
62 Ga0070699_100437654 3300005518 Bacteria 1185
63 Ga0070679_100015797 3300005530 Bacteria 7262
64 Ga0070679_100037637 3300005530 Bacteria 4807
65 Ga0070697_100030202 3300005536 Bacteria 4352
66 Ga0070697_100118603 3300005536 Bacteria 2211
67 Ga0070697_100296401 3300005536 Bacteria 1390
68 Ga0070672_100117000 3300005543 Bacteria 2178
69 Ga0070686_100002486 3300005544 Bacteria 10150
70 Ga0070695_100003699 3300005545 Bacteria 8913
71 Ga0070695_100013076 3300005545 Bacteria 4986
72 Ga0070695_100180733 3300005545 Bacteria 1494
73 Ga0070695_100552726 3300005545 Bacteria 898
74 Ga0070696_100059950 3300005546 Bacteria 2660
75 Ga0070693_100145854 3300005547 Bacteria 1495
76 Ga0070693_100302282 3300005547 Bacteria 1079
77 Ga0070665_100024772 3300005548 Bacteria 6045
78 Ga0070704_100010915 3300005549 Bacteria 5540
79 Ga0070704_100020400 3300005549 Bacteria 4272
80 Ga0070704_100421699 3300005549 Bacteria 1143
81 Ga0070704_100452722 3300005549 Bacteria 1105
82 Ga0068855_100331808 3300005563 Bacteria 1679
83 Ga0068854_100021646 3300005578 Bacteria 4365
84 Ga0070702_100001638 3300005615 Bacteria 9276
85 Ga0070702_100422269 3300005615 Bacteria 960
86 Ga0068852_100496899 3300005616 Bacteria 1214
87 Ga0068859_100116866 3300005617 Bacteria 2732
88 Ga0068859_100157505 3300005617 Bacteria 2349
89 Ga0068859_100341050 3300005617 Bacteria 1593
90 Ga0068859_100442464 3300005617 Bacteria 1396
91 Ga0068864_100076036 3300005618 Bacteria 2933
92 Ga0068866_10090411 3300005718 Bacteria 1666
93 Ga0068861_100930837 3300005719 Bacteria 825
94 Ga0068861_101185374 3300005719 Bacteria 738
95 Ga0068870_10088927 3300005840 Bacteria 1723
96 Ga0068863_100317690 3300005841 Bacteria 1512
97 Ga0068863_100518591 3300005841 Bacteria 1175
98 Ga0068858_100040173 3300005842 Bacteria 4337
99 Ga0068858_100426469 3300005842 Bacteria 1276
100 Ga0068858_100755110 3300005842 Bacteria 948
101 Ga0068860_100413546 3300005843 Bacteria 1336
102 Ga0068860_100557139 3300005843 Bacteria 1149
103 Ga0068862_100143380 3300005844 Bacteria 2121
104 Ga0081455_10307835 3300005937 Bacteria 1134
105 Ga0081539_10109090 3300005985 Bacteria 1397
106 Ga0070715_10133751 3300006163 Bacteria 1196
107 Ga0097621_100005116 3300006237 Bacteria 9213
108 Ga0097621_100156739 3300006237 Bacteria 1955
109 Ga0097621_101112596 3300006237 Bacteria 742
110 Ga0068871_100000337 3300006358 Bacteria 32470
111 Ga0068871_100043722 3300006358 Bacteria 3599
112 Ga0068871_100064303 3300006358 Bacteria 3004
113 Ga0068871_100310232 3300006358 Bacteria 1387
114 Ga0068871_100439195 3300006358 Bacteria 1168
115 Ga0075428_100116199 3300006844 Bacteria 2914
116 Ga0075428_100339739 3300006844 Bacteria 1613
117 Ga0075428_100965276 3300006844 Bacteria 903
118 Ga0075431_100247931 3300006847 Bacteria 1810
119 Ga0075433_10004207 3300006852 Bacteria 11171
120 Ga0075433_10067266 3300006852 Bacteria 3145
121 Ga0075433_10110067 3300006852 Bacteria 2444
122 Ga0075433_10130741 3300006852 Bacteria 2230
123 Ga0075433_10261212 3300006852 Unclassified 1535
124 Ga0075433_10335229 3300006852 Unclassified 1337
125 Ga0075433_10617715 3300006852 Bacteria 951
126 Ga0075434_100004066 3300006871 Bacteria 13112
127 Ga0075434_100021223 3300006871 Bacteria 6312
128 Ga0075434_100060975 3300006871 Bacteria 3752
129 Ga0075434_100092379 3300006871 Bacteria 3029
130 Ga0075434_100131782 3300006871 Bacteria 2519
131 Ga0075434_100136236 3300006871 Bacteria 2474
132 Ga0075434_100261210 3300006871 Bacteria 1750
133 Ga0075434_100291108 3300006871 Bacteria 1653
134 Ga0075429_100129856 3300006880 Bacteria 2204
135 Ga0075429_100240843 3300006880 Bacteria 1585
136 Ga0075436_100010393 3300006914 Bacteria 6379
137 Ga0075436_100010413 3300006914 Bacteria 6374
138 Ga0075436_100046055 3300006914 Bacteria 3008
139 Ga0075436_100104940 3300006914 Bacteria 1970
140 Ga0075436_100110552 3300006914 Bacteria 1918
141 Ga0075436_100189233 3300006914 Bacteria 1456
142 Ga0097620_100116871 3300006931 Bacteria 2732
143 Ga0097620_100157512 3300006931 Bacteria 2349
144 Ga0097620_100341035 3300006931 Bacteria 1593
145 Ga0097620_100442529 3300006931 Bacteria 1396
146 Ga0075435_100001499 3300007076 Bacteria 14991
147 Ga0075435_100011704 3300007076 Bacteria 6469
148 Ga0075435_100020280 3300007076 Bacteria 5090
149 Ga0075435_100022377 3300007076 Bacteria 4877
150 Ga0075435_100052494 3300007076 Bacteria 3286
151 Ga0075435_100053991 3300007076 Bacteria 3242
152 Ga0075435_100190312 3300007076 Bacteria 1737
153 Ga0075435_100199361 3300007076 Bacteria 1696
154 Ga0075435_100729463 3300007076 Bacteria 862
155 Ga0075435_100809915 3300007076 Bacteria 816
156 Ga0099794_10105575 3300007265 Bacteria 1409
157 Ga0099795_10090211 3300007788 Bacteria 1187
158 Ga0105240_10501759 3300009093 Bacteria 1349
159 Ga0105240_10648353 3300009093 Bacteria 1158
160 Ga0111539_10005974 3300009094 Bacteria 15726
161 Ga0111539_10013059 3300009094 Bacteria 10392
162 Ga0111539_10026076 3300009094 Bacteria 7155
163 Ga0111539_10235779 3300009094 Bacteria 2130
164 Ga0111539_10600332 3300009094 Bacteria 1282
165 Ga0111539_11464950 3300009094 Bacteria 792
166 Ga0105245_10008265 3300009098 Bacteria 9099
167 Ga0105245_10059584 3300009098 Bacteria 3438
168 Ga0105245_10608680 3300009098 Bacteria 1120
169 Ga0105245_11026038 3300009098 Bacteria 870
170 Ga0105247_10017382 3300009101 Bacteria 4319
171 Ga0105247_10072546 3300009101 Bacteria 2155
172 Ga0105247_10340909 3300009101 Bacteria 1051
173 Ga0114129_10001435 3300009147 Bacteria 32173
174 Ga0114129_10021065 3300009147 Bacteria 9258
175 Ga0114129_10022782 3300009147 Bacteria 8880
176 Ga0114129_10042408 3300009147 Bacteria 6408
177 Ga0114129_10045015 3300009147 Bacteria 6206
178 Ga0114129_10111924 3300009147 Bacteria 3766
179 Ga0114129_10113164 3300009147 Bacteria 3742
180 Ga0114129_10114829 3300009147 Bacteria 3712
181 Ga0114129_10133655 3300009147 Bacteria 3406
182 Ga0114129_10323649 3300009147 Bacteria 2049
183 Ga0114129_10501753 3300009147 Bacteria 1585
184 Ga0114129_10735970 3300009147 Bacteria 1264
185 Ga0105243_10009374 3300009148 Bacteria 7459
186 Ga0105243_10447806 3300009148 Bacteria 1211
187 Ga0105243_10504362 3300009148 Bacteria 1147
188 Ga0105243_10515006 3300009148 Bacteria 1136
189 Ga0105243_10660852 3300009148 Bacteria 1014
190 Ga0105243_10733078 3300009148 Bacteria 967
191 Ga0105241_10037687 3300009174 Bacteria 3642
192 Ga0105241_11316765 3300009174 Bacteria 689
193 Ga0105242_10848085 3300009176 Bacteria 909
194 Ga0105242_11176019 3300009176 Bacteria 785
195 Ga0105248_10024770 3300009177 Bacteria 6674
196 Ga0105248_10085283 3300009177 Bacteria 3554
197 Ga0105248_10089169 3300009177 Bacteria 3472
198 Ga0105248_10134937 3300009177 Bacteria 2784
199 Ga0105248_10855010 3300009177 Bacteria 1027
200 Ga0105248_10866317 3300009177 Bacteria 1020
201 Ga0105238_10392931 3300009551 Bacteria 1379
202 Ga0105249_10281932 3300009553 Bacteria 1660
203 Ga0157374_10260802 3300013296 Bacteria 1707
204 Ga0157378_10012898 3300013297 Bacteria 7317
205 Ga0157378_11719164 3300013297 Bacteria 675
206 Ga0157375_10524508 3300013308 Bacteria 1347
207 Ga0157375_10795803 3300013308 Bacteria 1094
208 Ga0163163_10029543 3300014325 Bacteria 5274
209 Ga0163163_11114005 3300014325 Bacteria 852
210 Ga0157380_10046940 3300014326 Bacteria 3394
211 Ga0157380_10114317 3300014326 Bacteria 2274
212 Ga0157380_10167118 3300014326 Bacteria 1918
213 Ga0157380_10467095 3300014326 Bacteria 1216
214 Ga0157380_10663393 3300014326 Bacteria 1042
215 Ga0157377_10348821 3300014745 Bacteria 992
216 Ga0157379_10043440 3300014968 Bacteria 4012
217 Ga0157379_10046157 3300014968 Bacteria 3888
218 Ga0157379_10299413 3300014968 Bacteria 1466
219 Ga0157379_10700037 3300014968 Bacteria 951
220 Ga0157376_10033860 3300014969 Bacteria 4118
221 Ga0157376_10104160 3300014969 Bacteria 2486
222 Ga0157376_10164451 3300014969 Bacteria 2015
223 Ga0157376_10166563 3300014969 Bacteria 2003
224 Ga0157376_10255235 3300014969 Bacteria 1640
225 Ga0157376_10879764 3300014969 Bacteria 913
226 Ga0163161_10338465 3300017792 Bacteria 1193
227 Ga0207682_10069088 3300025893 Bacteria 1493
228 Ga0207642_10231599 3300025899 Bacteria 1038
229 Ga0207710_10036292 3300025900 Bacteria 2172
230 Ga0207710_10124866 3300025900 Bacteria 1232
231 Ga0207680_10304915 3300025903 Bacteria 1111
232 Ga0207680_10391309 3300025903 Bacteria 981
233 Ga0207699_10195621 3300025906 Bacteria 1367
234 Ga0207699_10528987 3300025906 Bacteria 853
235 Ga0207645_10002542 3300025907 Bacteria 14280
236 Ga0207643_10206901 3300025908 Bacteria 1197
237 Ga0207643_10313121 3300025908 Bacteria 979
238 Ga0207654_10012257 3300025911 Bacteria 4389
239 Ga0207695_10389347 3300025913 Bacteria 1279
240 Ga0207695_10565257 3300025913 Bacteria 1019
241 Ga0207695_10661560 3300025913 Bacteria 925
242 Ga0207663_10181456 3300025916 Bacteria 1504
243 Ga0207663_10714100 3300025916 Bacteria 794
244 Ga0207662_10003313 3300025918 Bacteria 8263
245 Ga0207662_10427631 3300025918 Bacteria 902
246 Ga0207652_10041513 3300025921 Bacteria 3911
247 Ga0207652_10215250 3300025921 Bacteria 1730
248 Ga0207646_10328103 3300025922 Bacteria 1383
249 Ga0207681_10009213 3300025923 Bacteria 6033
250 Ga0207694_10205150 3300025924 Bacteria 1605
251 Ga0207650_10027153 3300025925 Bacteria 4094
252 Ga0207650_10397682 3300025925 Bacteria 1140
253 Ga0207659_10001294 3300025926 Bacteria 14955
254 Ga0207687_10005201 3300025927 Bacteria 8632
255 Ga0207687_10315362 3300025927 Bacteria 1264
256 Ga0207700_10015627 3300025928 Bacteria 5015
257 Ga0207664_10026169 3300025929 Bacteria 4406
258 Ga0207644_10856927 3300025931 Bacteria 761
259 Ga0207690_10540001 3300025932 Bacteria 947
260 Ga0207706_10130847 3300025933 Bacteria 2207
261 Ga0207706_10965241 3300025933 Bacteria 717
262 Ga0207686_10067071 3300025934 Bacteria 2294
263 Ga0207709_10087319 3300025935 Bacteria 2027
264 Ga0207709_10807372 3300025935 Bacteria 758
265 Ga0207709_11032921 3300025935 Bacteria 673
266 Ga0207670_10848985 3300025936 Bacteria 763
267 Ga0207691_10218420 3300025940 Bacteria 1654
268 Ga0207711_10040651 3300025941 Bacteria 3956
269 Ga0207711_10327526 3300025941 Bacteria 1416
270 Ga0207711_10343687 3300025941 Bacteria 1381
271 Ga0207711_10347297 3300025941 Bacteria 1374
272 Ga0207689_10178380 3300025942 Bacteria 1752
273 Ga0207689_10190367 3300025942 Bacteria 1693
274 Ga0207661_10830127 3300025944 Bacteria 851
275 Ga0207679_10219615 3300025945 Bacteria 1599
276 Ga0207667_10559530 3300025949 Bacteria 1156
277 Ga0207651_10045410 3300025960 Bacteria 2947
278 Ga0207651_10205573 3300025960 Bacteria 1581
279 Ga0207651_10718361 3300025960 Bacteria 881
280 Ga0207712_10168098 3300025961 Bacteria 1711
281 Ga0207712_10267499 3300025961 Bacteria 1389
282 Ga0207668_10176247 3300025972 Bacteria 1682
283 Ga0207668_10381742 3300025972 Bacteria 1186
284 Ga0207640_10015460 3300025981 Bacteria 4418
285 Ga0207658_10659131 3300025986 Bacteria 944
286 Ga0207677_10108020 3300026023 Bacteria 2065
287 Ga0207677_10134912 3300026023 Bacteria 1880
288 Ga0207677_10141395 3300026023 Bacteria 1843
289 Ga0207703_10002242 3300026035 Bacteria 16903
290 Ga0207703_10088300 3300026035 Bacteria 2602
291 Ga0207703_10236312 3300026035 Bacteria 1641
292 Ga0207639_10219335 3300026041 Bacteria 1642
293 Ga0207708_10016993 3300026075 Bacteria 5477
294 Ga0207708_10067854 3300026075 Bacteria 2729
295 Ga0207641_10150847 3300026088 Bacteria 2105
296 Ga0207641_10458969 3300026088 Bacteria 1232
297 Ga0207648_10014508 3300026089 Bacteria 7276
298 Ga0207648_10018889 3300026089 Bacteria 6227
299 Ga0207648_10214864 3300026089 Bacteria 1708
300 Ga0207648_11079430 3300026089 Bacteria 753
301 Ga0207675_100015362 3300026118 Bacteria 7141
302 Ga0207675_100070825 3300026118 Bacteria 3259
303 Ga0207675_100316772 3300026118 Bacteria 1522
304 Ga0207675_101078933 3300026118 Bacteria 822
305 Ga0207675_101129427 3300026118 Bacteria 804
306 Ga0207675_101291684 3300026118 Bacteria 750
307 Ga0207683_10067435 3300026121 Bacteria 3157
308 Ga0207683_10108486 3300026121 Bacteria 2484
309 Ga0207698_10687876 3300026142 Bacteria 1017
310 Ga0207428_10018632 3300027907 Bacteria 5926
311 Ga0207428_10020412 3300027907 Bacteria 5630
312 Ga0207428_10064026 3300027907 Bacteria 2904
313 Ga0268266_10057208 3300028379 Bacteria 3355
314 Ga0268264_10273484 3300028381 Bacteria 1579
315 Ga0268264_10702424 3300028381 Bacteria 1004
316 Ga0265332_10058879 3300031238 Bacteria 1644
317 Ga0265328_10127741 3300031239 Bacteria 950
318 Ga0265320_10076098 3300031240 Bacteria 1573
319 Ga0265314_10038728 3300031711 Bacteria 3442
320 Ga0307416_100352947 3300032002 Bacteria 1489
321 Ga0373936_0020647 3300035113 Bacteria 2560
322 Ga0373945_0013482 3300035116 Bacteria 2729
323 Ga0373945_0104709 3300035116 Bacteria 1111
324 Ga0373956_0005850 3300035119 Bacteria 4920
325 Ga0373956_0455920 3300035119 Bacteria 610
326 Ga0373957_0157043 3300035120 Bacteria 936
327 Ga0373943_0045540 3300035170 Bacteria 2138
328 Ga0373942_0004245 3300035207 Bacteria 3337
329 Ga0373924_0010839 3300035410 Bacteria 3373
330 Ga0373935_0122192 3300035692 Bacteria 1741
331 Ga0373927_0030205 3300035695 Bacteria 3536
332 Ga0373947_0045052 3300035725 Bacteria 2639
333 Ga0373937_0193210 3300036401 Bacteria 1913
334 Ga0373925_0050984 3300037068 Bacteria 3088
335 Ga0373925_0684883 3300037068 Bacteria 845
336 Ga0395901_0257773 3300038443 Bacteria 1816
337 Ga0451576_0594104 3300045051 Bacteria 1163
338 Ga0451576_0915940 3300045051 Bacteria 920
339 Ga0466967_0571471 3300045976 Bacteria 1114
340 Ga0495651_0246670 3300046462 Bacteria 1222
341 Ga0495580_0166124 3300046472 Bacteria 1527
342 Ga0495582_0447184 3300046473 Bacteria 746
343 Ga0495608_0078353 3300046511 Bacteria 2150
344 Ga0495618_0018865 3300046514 Bacteria 4238
345 Ga0495630_0048370 3300046517 Bacteria 3182
346 Ga0495652_0095036 3300046529 Bacteria 2430
347 Ga0495652_0214228 3300046529 Bacteria 1452
348 Ga0495586_0280804 3300046535 Bacteria 953
349 Ga0495621_0070067 3300046539 Bacteria 1290
350 Ga0495645_0010834 3300046543 Bacteria 6405
351 Ga0495667_0042050 3300046559 Bacteria 3030
352 Ga0495656_0384316 3300046615 Bacteria 732
353 Ga0495634_0399006 3300046642 Bacteria 817
354 Ga0495635_0623604 3300046663 Bacteria 703
355 Ga0495659_0023176 3300046664 Bacteria 2108
356 Ga0495657_0052151 3300046675 Bacteria 2744
357 Ga0495599_0137889 3300046678 Bacteria 1514
358 Ga0495647_0048055 3300046681 Bacteria 1649
359 Ga0495658_0669017 3300046683 Unclassified 665
360 Ga0495669_0007907 3300046684 Bacteria 4465
361 Ga0495669_0157397 3300046684 Bacteria 1077
362 Ga0495613_0000927 3300046689 Bacteria 22499
363 Ga0495604_0144947 3300047317 Bacteria 1693
364 Ga0495604_0226647 3300047317 Bacteria 1284
365 Ga0495674_0005735 3300047319 Bacteria 11901
366 Ga0495684_0000048 3300047471 Bacteria 89243
367 Ga0496100_0074296 3300048903 Bacteria 2277
368 Ga0496101_0000685 3300048904 Bacteria 20428
369 Ga0496101_0554222 3300048904 Bacteria 909
370 Ga0496101_0750528 3300048904 Bacteria 770
371 Ga0496102_0963200 3300048905 Bacteria 774
372 Ga0496103_0523490 3300048906 Bacteria 758
373 Ga0496104_0425663 3300048907 Bacteria 1239
374 Ga0496106_0066523 3300048909 Bacteria 2745
375 Ga0496106_0395966 3300048909 Bacteria 1110
376 Ga0496107_0229358 3300048910 Bacteria 1382
377 Ga0496107_0309762 3300048910 Bacteria 1175
378 Ga0496109_0056363 3300048912 Bacteria 3587
379 Ga0496109_0103797 3300048912 Bacteria 2639
380 Ga0496109_0738703 3300048912 Bacteria 922
381 Ga0496109_1006231 3300048912 Bacteria 771
382 Ga0496110_0151334 3300048913 Bacteria 2101
383 Ga0496112_0327414 3300048915 Bacteria 1476
384 Ga0496112_0624195 3300048915 Bacteria 1009
385 Ga0496114_0127885 3300048917 Bacteria 2192
386 Ga0496114_1024244 3300048917 Bacteria 709
387 Ga0496115_0368111 3300048918 Bacteria 1170
388 Ga0501073_0245065 3300049589 Bacteria 1237
389 Ga0501075_0480165 3300049591 Bacteria 948
390 Ga0501079_0105874 3300049741 Bacteria 2183
391 nmdc:mga05p37_105535_c1 3300050507 Bacteria 3466
392 nmdc:mga05p37_11606_c1 3300050507 Bacteria 10499
393 nmdc:mga05p37_16703_c1 3300050507 Bacteria 8845
394 nmdc:mga05p37_22241_c1 3300050507 Bacteria 7687
395 nmdc:mga05p37_247875_c1 3300050507 Bacteria 2138
396 nmdc:mga05p37_29063_c1 3300050507 Bacteria 6746
397 nmdc:mga05p37_31186_c1 3300050507 Bacteria 6511
398 nmdc:mga05p37_331516_c1 3300050507 Bacteria 1797
399 nmdc:mga05p37_355127_c1 3300050507 Bacteria 1725
400 nmdc:mga05p37_46505_c1 3300050507 Bacteria 5336
401 nmdc:mga05p37_78239_c1 3300050507 Bacteria 4072
402 nmdc:mga05p37_9103_c1 3300050507 Bacteria 11737
403 nmdc:mga09592_145268_c1 3300050508 Bacteria 2045
404 nmdc:mga09592_283915_c1 3300050508 Bacteria 1435
405 nmdc:mga09592_493806_c1 3300050508 Bacteria 1054
406 nmdc:mga09592_75613_c1 3300050508 Bacteria 2863
407 nmdc:mga06r32_208009_c1 3300050510 Bacteria 1945
408 nmdc:mga08y16_1071_c1 3300050511 Bacteria 26933
409 nmdc:mga08y16_1343325_c1 3300050511 Bacteria 680
410 nmdc:mga08y16_164463_c1 3300050511 Bacteria 2305
411 nmdc:mga08y16_282672_c1 3300050511 Bacteria 1711
412 nmdc:mga08y16_324085_c1 3300050511 Bacteria 1586
413 nmdc:mga08y16_52037_c1 3300050511 Bacteria 4285
414 nmdc:mga08y16_6656_c1 3300050511 Bacteria 12122
415 nmdc:mga08y16_7157_c1 3300050511 Bacteria 11711
416 nmdc:mga08y16_814938_c1 3300050511 Bacteria 925
417 nmdc:mga0n895_101608_c1 3300050512 Bacteria 2885
418 nmdc:mga0n895_108320_c1 3300050512 Bacteria 2793
419 nmdc:mga0n895_1149484_c1 3300050512 Bacteria 752
420 nmdc:mga0n895_1370028_c1 3300050512 Bacteria 676
421 nmdc:mga0n895_16763_c1 3300050512 Bacteria 6733
422 nmdc:mga0n895_186332_c1 3300050512 Bacteria 2106
423 nmdc:mga0n895_195187_c1 3300050512 Bacteria 2055
424 nmdc:mga0n895_21226_c1 3300050512 Bacteria 6068
425 nmdc:mga0n895_224257_c1 3300050512 Bacteria 1908
426 nmdc:mga0n895_742066_c1 3300050512 Bacteria 975
427 nmdc:mga0n895_859_c1 3300050512 Bacteria 21838
428 nmdc:mga0rr50_109_c1 3300050513 Bacteria 46163
429 nmdc:mga0rr50_131597_c1 3300050513 Bacteria 2004
430 nmdc:mga0rr50_22625_c1 3300050513 Bacteria 4318
431 nmdc:mga0rr50_273682_c1 3300050513 Bacteria 1408
432 nmdc:mga0rr50_411669_c1 3300050513 Bacteria 1143
433 nmdc:mga0rr50_44843_c1 3300050513 Bacteria 3246
434 nmdc:mga0rr50_736655_c1 3300050513 Bacteria 841
435 nmdc:mga0rr50_803937_c1 3300050513 Bacteria 802
436 nmdc:mga08x19_102996_c1 3300050514 Bacteria 1896
437 nmdc:mga08x19_17643_c1 3300050514 Bacteria 4371
438 nmdc:mga08x19_24050_c1 3300050514 Bacteria 3783
439 nmdc:mga08x19_296219_c1 3300050514 Bacteria 1123
440 nmdc:mga08x19_65294_c1 3300050514 Bacteria 2363
441 nmdc:mga08x19_945422_c1 3300050514 Bacteria 612
442 nmdc:mga08x19_9879_c1 3300050514 Bacteria 5721
443 nmdc:mga0a205_1077219_c1 3300050515 Bacteria 651
444 nmdc:mga0a205_122842_c1 3300050515 Bacteria 2496
445 nmdc:mga0a205_162208_c1 3300050515 Bacteria 2131
446 nmdc:mga0a205_220261_c1 3300050515 Unclassified 1783
447 nmdc:mga0a205_355884_c1 3300050515 Bacteria 1331
448 nmdc:mga0a205_44544_c1 3300050515 Bacteria 4278
449 nmdc:mga0a205_59591_c1 3300050515 Bacteria 3687
450 nmdc:mga0a205_66090_c1 3300050515 Bacteria 3494
451 Ga0495601_0046119 3300053077 Bacteria 2743
452 Ga0495601_0079414 3300053077 Bacteria 2104
453 Ga0495619_0001582 3300053085 Bacteria 14969
454 Ga0495619_0028066 3300053085 Bacteria 3629
455 Ga0495619_0130958 3300053085 Bacteria 1724
456 Ga0495619_0263236 3300053085 Bacteria 1195
457 Ga0207639_11263496
458 Ga0065712_10068138
459 Ga0065712_10238358
460 Ga0065715_10127942
461 Ga0065715_10349488
462 Ga0065715_10481925
463 Ga0065707_10018539
464 Ga0065707_10197348
465 Ga0065707_10202499
466 Ga0065707_10218237
467 Ga0065707_10253268
468 Ga0065707_10355005
469 Ga0065707_10358328
470 Ga0070676_10058633
471 Ga0070690_100163110
472 Ga0070690_100187289
473 Ga0070670_100047786
474 Ga0070666_10167721
475 Ga0070666_10216993
476 Ga0070666_10327178
477 Ga0068868_100548013
478 Ga0070691_10001728
479 Ga0070687_100033473
480 Ga0070661_100180735
481 Ga0070668_100086888
482 Ga0070668_100098733
483 Ga0070668_100983280
484 Ga0070669_100053128
485 Ga0070669_100273405
486 Ga0070669_100305012
487 Ga0070675_100001537
488 Ga0070675_100150617
489 Ga0070674_100226570
490 Ga0070674_100740955
491 Ga0070673_100071637
492 Ga0070673_100155466
493 Ga0070688_100197736
494 Ga0070667_100374434
495 Ga0070714_100016015
496 Ga0070713_100071573
497 Ga0070705_100016790
498 Ga0070705_100160351
499 Ga0070700_100010175
500 Ga0070700_100075101
501 Ga0070694_100002597
502 Ga0070694_100010066
503 Ga0070694_101158020
504 Ga0070708_100064269
505 Ga0070708_100192176
506 Ga0070663_100739635
507 Ga0070678_100062516
508 Ga0070678_100542369
509 Ga0070662_100854840
510 Ga0070681_10123352
511 Ga0068867_100232644
512 Ga0068867_100361262
513 Ga0070685_10080661
514 Ga0070706_100274232
515 Ga0070698_100026990
516 Ga0070698_100810984
517 Ga0070699_100102408
518 Ga0070699_100437654
519 Ga0070679_100015797
520 Ga0070679_100037637
521 Ga0070697_100030202
522 Ga0070697_100118603
523 Ga0070697_100296401
524 Ga0070672_100117000
525 Ga0070686_100002486
526 Ga0070695_100003699
527 Ga0070695_100013076
528 Ga0070695_100180733
529 Ga0070695_100552726
530 Ga0070696_100059950
531 Ga0070693_100145854
532 Ga0070693_100302282
533 Ga0070665_100024772
534 Ga0070704_100010915
535 Ga0070704_100020400
536 Ga0070704_100421699
537 Ga0070704_100452722
538 Ga0068855_100331808
539 Ga0068854_100021646
540 Ga0070702_100001638
541 Ga0070702_100422269
542 Ga0068852_100496899
543 Ga0068859_100116866
544 Ga0068859_100157505
545 Ga0068859_100341050
546 Ga0068859_100442464
547 Ga0068864_100076036
548 Ga0068866_10090411
549 Ga0068861_100930837
550 Ga0068861_101185374
551 Ga0068870_10088927
552 Ga0068863_100317690
553 Ga0068863_100518591
554 Ga0068858_100040173
555 Ga0068858_100426469
556 Ga0068858_100755110
557 Ga0068860_100413546
558 Ga0068860_100557139
559 Ga0068862_100143380
560 Ga0081455_10307835
561 Ga0081539_10109090
562 Ga0070715_10133751
563 Ga0097621_100005116
564 Ga0097621_100156739
565 Ga0097621_101112596
566 Ga0068871_100000337
567 Ga0068871_100043722
568 Ga0068871_100064303
569 Ga0068871_100310232
570 Ga0068871_100439195
571 Ga0075428_100116199
572 Ga0075428_100339739
573 Ga0075428_100965276
574 Ga0075431_100247931
575 Ga0075433_10004207
576 Ga0075433_10067266
577 Ga0075433_10110067
578 Ga0075433_10130741
579 Ga0075433_10261212
580 Ga0075433_10335229
581 Ga0075433_10617715
582 Ga0075434_100004066
583 Ga0075434_100021223
584 Ga0075434_100060975
585 Ga0075434_100092379
586 Ga0075434_100131782
587 Ga0075434_100136236
588 Ga0075434_100261210
589 Ga0075434_100291108
590 Ga0075429_100129856
591 Ga0075429_100240843
592 Ga0075436_100010393
593 Ga0075436_100010413
594 Ga0075436_100046055
595 Ga0075436_100104940
596 Ga0075436_100110552
597 Ga0075436_100189233
598 Ga0097620_100116871
599 Ga0097620_100157512
600 Ga0097620_100341035
601 Ga0097620_100442529
602 Ga0075435_100001499
603 Ga0075435_100011704
604 Ga0075435_100020280
605 Ga0075435_100022377
606 Ga0075435_100052494
607 Ga0075435_100053991
608 Ga0075435_100190312
609 Ga0075435_100199361
610 Ga0075435_100729463
611 Ga0075435_100809915
612 Ga0099794_10105575
613 Ga0099795_10090211
614 Ga0105240_10501759
615 Ga0105240_10648353
616 Ga0111539_10005974
617 Ga0111539_10013059
618 Ga0111539_10026076
619 Ga0111539_10235779
620 Ga0111539_10600332
621 Ga0111539_11464950
622 Ga0105245_10008265
623 Ga0105245_10059584
624 Ga0105245_10608680
625 Ga0105245_11026038
626 Ga0105247_10017382
627 Ga0105247_10072546
628 Ga0105247_10340909
629 Ga0114129_10001435
630 Ga0114129_10021065
631 Ga0114129_10022782
632 Ga0114129_10042408
633 Ga0114129_10045015
634 Ga0114129_10111924
635 Ga0114129_10113164
636 Ga0114129_10114829
637 Ga0114129_10133655
638 Ga0114129_10323649
639 Ga0114129_10501753
640 Ga0114129_10735970
641 Ga0105243_10009374
642 Ga0105243_10447806
643 Ga0105243_10504362
644 Ga0105243_10515006
645 Ga0105243_10660852
646 Ga0105243_10733078
647 Ga0105241_10037687
648 Ga0105241_11316765
649 Ga0105242_10848085
650 Ga0105242_11176019
651 Ga0105248_10024770
652 Ga0105248_10085283
653 Ga0105248_10089169
654 Ga0105248_10134937
655 Ga0105248_10855010
656 Ga0105248_10866317
657 Ga0105238_10392931
658 Ga0105249_10281932
659 Ga0157374_10260802
660 Ga0157378_10012898
661 Ga0157378_11719164
662 Ga0157375_10524508
663 Ga0157375_10795803
664 Ga0163163_10029543
665 Ga0163163_11114005
666 Ga0157380_10046940
667 Ga0157380_10114317
668 Ga0157380_10167118
669 Ga0157380_10467095
670 Ga0157380_10663393
671 Ga0157377_10348821
672 Ga0157379_10043440
673 Ga0157379_10046157
674 Ga0157379_10299413
675 Ga0157379_10700037
676 Ga0157376_10033860
677 Ga0157376_10104160
678 Ga0157376_10164451
679 Ga0157376_10166563
680 Ga0157376_10255235
681 Ga0157376_10879764
682 Ga0163161_10338465
683 Ga0207682_10069088
684 Ga0207642_10231599
685 Ga0207710_10036292
686 Ga0207710_10124866
687 Ga0207680_10304915
688 Ga0207680_10391309
689 Ga0207699_10195621
690 Ga0207699_10528987
691 Ga0207645_10002542
692 Ga0207643_10206901
693 Ga0207643_10313121
694 Ga0207654_10012257
695 Ga0207695_10389347
696 Ga0207695_10565257
697 Ga0207695_10661560
698 Ga0207663_10181456
699 Ga0207663_10714100
700 Ga0207662_10003313
701 Ga0207662_10427631
702 Ga0207652_10041513
703 Ga0207652_10215250
704 Ga0207646_10328103
705 Ga0207681_10009213
706 Ga0207694_10205150
707 Ga0207650_10027153
708 Ga0207650_10397682
709 Ga0207659_10001294
710 Ga0207687_10005201
711 Ga0207687_10315362
712 Ga0207700_10015627
713 Ga0207664_10026169
714 Ga0207644_10856927
715 Ga0207690_10540001
716 Ga0207706_10130847
717 Ga0207706_10965241
718 Ga0207686_10067071
719 Ga0207709_10087319
720 Ga0207709_10807372
721 Ga0207709_11032921
722 Ga0207670_10848985
723 Ga0207691_10218420
724 Ga0207711_10040651
725 Ga0207711_10327526
726 Ga0207711_10343687
727 Ga0207711_10347297
728 Ga0207689_10178380
729 Ga0207689_10190367
730 Ga0207661_10830127
731 Ga0207679_10219615
732 Ga0207667_10559530
733 Ga0207651_10045410
734 Ga0207651_10205573
735 Ga0207651_10718361
736 Ga0207712_10168098
737 Ga0207712_10267499
738 Ga0207668_10176247
739 Ga0207668_10381742
740 Ga0207640_10015460
741 Ga0207658_10659131
742 Ga0207677_10108020
743 Ga0207677_10134912
744 Ga0207677_10141395
745 Ga0207703_10002242
746 Ga0207703_10088300
747 Ga0207703_10236312
748 Ga0207639_10219335
749 Ga0207708_10016993
750 Ga0207708_10067854
751 Ga0207641_10150847
752 Ga0207641_10458969
753 Ga0207648_10014508
754 Ga0207648_10018889
755 Ga0207648_10214864
756 Ga0207648_11079430
757 Ga0207675_100015362
758 Ga0207675_100070825
759 Ga0207675_100316772
760 Ga0207675_101078933
761 Ga0207675_101129427
762 Ga0207675_101291684
763 Ga0207683_10067435
764 Ga0207683_10108486
765 Ga0207698_10687876
766 Ga0207428_10018632
767 Ga0207428_10020412
768 Ga0207428_10064026
769 Ga0268266_10057208
770 Ga0268264_10273484
771 Ga0268264_10702424
772 Ga0265332_10058879
773 Ga0265328_10127741
774 Ga0265320_10076098
775 Ga0265314_10038728
776 Ga0307416_100352947
777 Ga0373936_0020647
778 Ga0373945_0013482
779 Ga0373945_0104709
780 Ga0373956_0005850
781 Ga0373956_0455920
782 Ga0373957_0157043
783 Ga0373943_0045540
784 Ga0373942_0004245
785 Ga0373924_0010839
786 Ga0373935_0122192
787 Ga0373927_0030205
788 Ga0373947_0045052
789 Ga0373937_0193210
790 Ga0373925_0050984
791 Ga0373925_0684883
792 Ga0395901_0257773
793 Ga0451576_0594104
794 Ga0451576_0915940
795 Ga0466967_0571471
796 Ga0495651_0246670
797 Ga0495580_0166124
798 Ga0495582_0447184
799 Ga0495608_0078353
800 Ga0495618_0018865
801 Ga0495630_0048370
802 Ga0495652_0095036
803 Ga0495652_0214228
804 Ga0495586_0280804
805 Ga0495621_0070067
806 Ga0495645_0010834
807 Ga0495667_0042050
808 Ga0495656_0384316
809 Ga0495634_0399006
810 Ga0495635_0623604
811 Ga0495659_0023176
812 Ga0495657_0052151
813 Ga0495599_0137889
814 Ga0495647_0048055
815 Ga0495658_0669017
816 Ga0495669_0007907
817 Ga0495669_0157397
818 Ga0495613_0000927
819 Ga0495604_0144947
820 Ga0495604_0226647
821 Ga0495674_0005735
822 Ga0495684_0000048
823 Ga0496100_0074296
824 Ga0496101_0000685
825 Ga0496101_0554222
826 Ga0496101_0750528
827 Ga0496102_0963200
828 Ga0496103_0523490
829 Ga0496104_0425663
830 Ga0496106_0066523
831 Ga0496106_0395966
832 Ga0496107_0229358
833 Ga0496107_0309762
834 Ga0496109_0056363
835 Ga0496109_0103797
836 Ga0496109_0738703
837 Ga0496109_1006231
838 Ga0496110_0151334
839 Ga0496112_0327414
840 Ga0496112_0624195
841 Ga0496114_0127885
842 Ga0496114_1024244
843 Ga0496115_0368111
844 Ga0501073_0245065
845 Ga0501075_0480165
846 Ga0501079_0105874
847 nmdc:mga05p37_105535_c1
848 nmdc:mga05p37_11606_c1
849 nmdc:mga05p37_16703_c1
850 nmdc:mga05p37_22241_c1
851 nmdc:mga05p37_247875_c1
852 nmdc:mga05p37_29063_c1
853 nmdc:mga05p37_31186_c1
854 nmdc:mga05p37_331516_c1
855 nmdc:mga05p37_355127_c1
856 nmdc:mga05p37_46505_c1
857 nmdc:mga05p37_78239_c1
858 nmdc:mga05p37_9103_c1
859 nmdc:mga09592_145268_c1
860 nmdc:mga09592_283915_c1
861 nmdc:mga09592_493806_c1
862 nmdc:mga09592_75613_c1
863 nmdc:mga06r32_208009_c1
864 nmdc:mga08y16_1071_c1
865 nmdc:mga08y16_1343325_c1
866 nmdc:mga08y16_164463_c1
867 nmdc:mga08y16_282672_c1
868 nmdc:mga08y16_324085_c1
869 nmdc:mga08y16_52037_c1
870 nmdc:mga08y16_6656_c1
871 nmdc:mga08y16_7157_c1
872 nmdc:mga08y16_814938_c1
873 nmdc:mga0n895_101608_c1
874 nmdc:mga0n895_108320_c1
875 nmdc:mga0n895_1149484_c1
876 nmdc:mga0n895_1370028_c1
877 nmdc:mga0n895_16763_c1
878 nmdc:mga0n895_186332_c1
879 nmdc:mga0n895_195187_c1
880 nmdc:mga0n895_21226_c1
881 nmdc:mga0n895_224257_c1
882 nmdc:mga0n895_742066_c1
883 nmdc:mga0n895_859_c1
884 nmdc:mga0rr50_109_c1
885 nmdc:mga0rr50_131597_c1
886 nmdc:mga0rr50_22625_c1
887 nmdc:mga0rr50_273682_c1
888 nmdc:mga0rr50_411669_c1
889 nmdc:mga0rr50_44843_c1
890 nmdc:mga0rr50_736655_c1
891 nmdc:mga0rr50_803937_c1
892 nmdc:mga08x19_102996_c1
893 nmdc:mga08x19_17643_c1
894 nmdc:mga08x19_24050_c1
895 nmdc:mga08x19_296219_c1
896 nmdc:mga08x19_65294_c1
897 nmdc:mga08x19_945422_c1
898 nmdc:mga08x19_9879_c1
899 nmdc:mga0a205_1077219_c1
900 nmdc:mga0a205_122842_c1
901 nmdc:mga0a205_162208_c1
902 nmdc:mga0a205_220261_c1
903 nmdc:mga0a205_355884_c1
904 nmdc:mga0a205_44544_c1
905 nmdc:mga0a205_59591_c1
906 nmdc:mga0a205_66090_c1
907 Ga0495601_0046119
908 Ga0495601_0079414
909 Ga0495619_0001582
910 Ga0495619_0028066
911 Ga0495619_0130958
912 Ga0495619_0263236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

51

175

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.7043 19 168
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.6748 19 169
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.6748 19 169
1occ-assembly1.cif.gz_C structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.6748 19 169
1occ-assembly1.cif.gz_P structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.6748 19 169
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6691 17 173 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.667 22 172 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6637 24 168 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6303 13 170 1.20.120.80
af_Q1G3V3_33_182_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6199 19 81 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A4S0PZ50-F1-model_v4 deleted 0.852 19 136
AF-A0A800IS62-F1-model_v4 Heme-copper oxidase subunit III 0.8425 50 173 GO:0004129
GO:0005886
GO:0019646
AF-X8DTB9-F1-model_v4 Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.824 48 168 GO:0004129
GO:0005886
GO:0019646
AF-A0A800IS62-F1-model_v4 Heme-copper oxidase subunit III 0.8 50 173 GO:0004129
GO:0005886
GO:0019646
AF-A0A3C1F483-F1-model_v4 Protein translocase subunit SecA (EC 7.4.2.8) 0.7996 62 173 GO:0004129
GO:0005524
GO:0005829
GO:0005886
GO:0006605
GO:0017038
GO:0022904
GO:0031522
GO:0043952
GO:0065002

Map