F447799

General Info

Members Datasets Scaffolds Average Seq Length
456 199 456 155

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10042467|Ga0207691_100424674
Length 170
Sequence MIAQLVQGSADDLDAVMQVMTAAFPDRFGEAWTRSQCAGILPMTGVKLILAEDGDDKVVGFSLYRTITDDAELLLLAVDPDSQGKGIGRQLLSNFIEESRKQGASRIHLEVRDGNSAIEVYRAAGFDQVNRRRNYYRSRDGDSFDALTFVLSNEDWSTSILALYCRVHFK

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.39
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030108 3300001989 Bacteria 1883
2 JGI24739J22299_10039334 3300001989 Bacteria 1584
3 JGI24743J22301_10027434 3300001991 Bacteria 1111
4 JGI24744J21845_10000335 3300002077 Bacteria 7936
5 rootH1_10263190 3300003323 Bacteria 1478
6 rootH1_10304483 3300003323 Bacteria 1184
7 Ga0065712_10010008 3300005290 Bacteria 2167
8 Ga0065715_10036286 3300005293 Bacteria 1976
9 Ga0065715_10209356 3300005293 Bacteria 1321
10 Ga0070658_10005539 3300005327 Bacteria 10247
11 Ga0070658_10012328 3300005327 Bacteria 6864
12 Ga0070658_10075412 3300005327 Bacteria 2766
13 Ga0070658_10225022 3300005327 Bacteria 1587
14 Ga0070658_10623174 3300005327 Unclassified 935
15 Ga0070658_10645631 3300005327 Bacteria 918
16 Ga0070658_10716540 3300005327 Bacteria 869
17 Ga0070676_10019947 3300005328 Bacteria 3735
18 Ga0070676_10165891 3300005328 Bacteria 1425
19 Ga0070683_100078711 3300005329 Bacteria 3084
20 Ga0070683_100498591 3300005329 Bacteria 1163
21 Ga0070690_100019496 3300005330 Bacteria 4118
22 Ga0070690_100163700 3300005330 Bacteria 1526
23 Ga0070690_100314336 3300005330 Bacteria 1127
24 Ga0070670_100204288 3300005331 Bacteria 1717
25 Ga0070670_100221014 3300005331 Bacteria 1648
26 Ga0070670_100550306 3300005331 Bacteria 1029
27 Ga0070677_10119412 3300005333 Bacteria 1189
28 Ga0070666_10000415 3300005335 Bacteria 26514
29 Ga0070666_10003290 3300005335 Bacteria 9807
30 Ga0070666_10010540 3300005335 Bacteria 5782
31 Ga0070680_100165817 3300005336 Bacteria 1857
32 Ga0070680_100937036 3300005336 Bacteria 747
33 Ga0070682_100471475 3300005337 Bacteria 966
34 Ga0068868_100000422 3300005338 Bacteria 28550
35 Ga0068868_100001497 3300005338 Bacteria 16125
36 Ga0068868_100227378 3300005338 Bacteria 1564
37 Ga0068868_100505509 3300005338 Bacteria 1059
38 Ga0070660_100013767 3300005339 Bacteria 5818
39 Ga0070660_100022407 3300005339 Bacteria 4671
40 Ga0070660_100032905 3300005339 Bacteria 3905
41 Ga0070660_100034524 3300005339 Bacteria 3822
42 Ga0070660_100257456 3300005339 Bacteria 1424
43 Ga0070660_100418316 3300005339 Bacteria 1109
44 Ga0070687_100043045 3300005343 Bacteria 2292
45 Ga0070661_100009699 3300005344 Bacteria 6678
46 Ga0070661_100037907 3300005344 Bacteria 3508
47 Ga0070661_100093310 3300005344 Bacteria 2230
48 Ga0070661_100108799 3300005344 Bacteria 2068
49 Ga0070661_100167077 3300005344 Bacteria 1669
50 Ga0070661_100453362 3300005344 Bacteria 1021
51 Ga0070692_10033761 3300005345 Bacteria 2579
52 Ga0070668_100049354 3300005347 Bacteria 3238
53 Ga0070668_100677296 3300005347 Unclassified 908
54 Ga0070669_100046325 3300005353 Bacteria 3171
55 Ga0070669_100164242 3300005353 Bacteria 1727
56 Ga0070675_100023540 3300005354 Bacteria 4926
57 Ga0070675_100062506 3300005354 Bacteria 3076
58 Ga0070675_100069765 3300005354 Bacteria 2912
59 Ga0070671_100000793 3300005355 Bacteria 22759
60 Ga0070671_100006203 3300005355 Bacteria 9525
61 Ga0070671_100007657 3300005355 Bacteria 8634
62 Ga0070671_100366997 3300005355 Unclassified 1229
63 Ga0070674_100001248 3300005356 Bacteria 13383
64 Ga0070674_100004983 3300005356 Bacteria 7614
65 Ga0070674_100006134 3300005356 Bacteria 6988
66 Ga0070674_100079168 3300005356 Bacteria 2344
67 Ga0070673_100002090 3300005364 Bacteria 12058
68 Ga0070673_100003531 3300005364 Bacteria 9752
69 Ga0070673_100005150 3300005364 Bacteria 8339
70 Ga0070673_100050944 3300005364 Bacteria 3240
71 Ga0070673_100133280 3300005364 Bacteria 2088
72 Ga0070688_100255611 3300005365 Bacteria 1249
73 Ga0070659_100018789 3300005366 Bacteria 5218
74 Ga0070659_100023685 3300005366 Bacteria 4701
75 Ga0070659_100074043 3300005366 Bacteria 2712
76 Ga0070659_100094063 3300005366 Bacteria 2406
77 Ga0070659_100117176 3300005366 Bacteria 2154
78 Ga0070659_100372066 3300005366 Unclassified 1202
79 Ga0070659_100435746 3300005366 Bacteria 1110
80 Ga0070659_100558852 3300005366 Bacteria 980
81 Ga0070667_100000839 3300005367 Bacteria 28510
82 Ga0070709_10030762 3300005434 Bacteria 3224
83 Ga0070714_100027087 3300005435 Bacteria 4743
84 Ga0070714_100066060 3300005435 Bacteria 3117
85 Ga0070714_100067014 3300005435 Bacteria 3094
86 Ga0070713_100028174 3300005436 Bacteria 4433
87 Ga0070663_100037039 3300005455 Bacteria 3393
88 Ga0070663_100121445 3300005455 Bacteria 1974
89 Ga0070663_100223860 3300005455 Bacteria 1478
90 Ga0070663_100552773 3300005455 Unclassified 962
91 Ga0070678_100005013 3300005456 Bacteria 7591
92 Ga0070678_100011240 3300005456 Bacteria 5513
93 Ga0070678_100020268 3300005456 Bacteria 4359
94 Ga0070662_100002632 3300005457 Bacteria 11074
95 Ga0070662_100045199 3300005457 Bacteria 3158
96 Ga0070662_100068146 3300005457 Bacteria 2615
97 Ga0070662_100164318 3300005457 Bacteria 1738
98 Ga0070662_100329019 3300005457 Bacteria 1248
99 Ga0070681_10096572 3300005458 Bacteria 2903
100 Ga0070681_10179608 3300005458 Bacteria 2038
101 Ga0070681_10395603 3300005458 Bacteria 1293
102 Ga0068867_100006361 3300005459 Bacteria 8348
103 Ga0068867_100163194 3300005459 Bacteria 1758
104 Ga0070679_100679176 3300005530 Bacteria 972
105 Ga0070679_101122968 3300005530 Bacteria 731
106 Ga0070679_101180383 3300005530 Bacteria 710
107 Ga0068853_100079395 3300005539 Bacteria 2869
108 Ga0068853_100086205 3300005539 Bacteria 2753
109 Ga0070672_100006621 3300005543 Bacteria 7802
110 Ga0070672_100101673 3300005543 Bacteria 2332
111 Ga0070672_100166087 3300005543 Bacteria 1833
112 Ga0070672_100488304 3300005543 Bacteria 1064
113 Ga0070686_100028133 3300005544 Bacteria 3407
114 Ga0070695_100687283 3300005545 Bacteria 811
115 Ga0070696_100149697 3300005546 Bacteria 1712
116 Ga0070693_100001691 3300005547 Bacteria 10011
117 Ga0070665_100006465 3300005548 Bacteria 11928
118 Ga0070665_100016126 3300005548 Bacteria 7498
119 Ga0070665_100910727 3300005548 Unclassified 892
120 Ga0068855_100298497 3300005563 Bacteria 1784
121 Ga0068855_100715327 3300005563 Bacteria 1070
122 Ga0068855_100756852 3300005563 Bacteria 1035
123 Ga0068855_100873648 3300005563 Unclassified 951
124 Ga0070664_100007622 3300005564 Bacteria 8740
125 Ga0070664_100017531 3300005564 Bacteria 5882
126 Ga0070664_100031963 3300005564 Bacteria 4402
127 Ga0070664_100032733 3300005564 Bacteria 4349
128 Ga0070664_100126690 3300005564 Bacteria 2241
129 Ga0068857_100155923 3300005577 Bacteria 2070
130 Ga0068854_100019849 3300005578 Bacteria 4536
131 Ga0068854_100135698 3300005578 Bacteria 1883
132 Ga0068854_100154675 3300005578 Bacteria 1771
133 Ga0068854_100285959 3300005578 Bacteria 1329
134 Ga0068854_100361187 3300005578 Bacteria 1191
135 Ga0068856_100039322 3300005614 Bacteria 4644
136 Ga0068856_100189827 3300005614 Bacteria 2068
137 Ga0070702_100084843 3300005615 Bacteria 1906
138 Ga0070702_100520110 3300005615 Bacteria 877
139 Ga0068852_100004886 3300005616 Bacteria 9519
140 Ga0068852_100088726 3300005616 Bacteria 2762
141 Ga0068852_100308007 3300005616 Bacteria 1535
142 Ga0068852_100626937 3300005616 Unclassified 1081
143 Ga0068852_100737599 3300005616 Unclassified 997
144 Ga0068859_100017599 3300005617 Bacteria 7185
145 Ga0068864_100088193 3300005618 Bacteria 2732
146 Ga0068864_100814717 3300005618 Bacteria 918
147 Ga0068866_10018283 3300005718 Bacteria 3167
148 Ga0068861_100398719 3300005719 Unclassified 1220
149 Ga0068851_10006186 3300005834 Bacteria 5464
150 Ga0068851_10169758 3300005834 Unclassified 1203
151 Ga0068870_10015557 3300005840 Bacteria 3613
152 Ga0068870_10133983 3300005840 Bacteria 1442
153 Ga0068863_100709362 3300005841 Bacteria 1000
154 Ga0068858_100002249 3300005842 Bacteria 19508
155 Ga0068860_100092570 3300005843 Bacteria 2881
156 Ga0068860_100321821 3300005843 Bacteria 1518
157 Ga0068860_100504794 3300005843 Bacteria 1208
158 Ga0070717_10178803 3300006028 Bacteria 1848
159 Ga0070716_100431786 3300006173 Bacteria 955
160 Ga0070712_100055046 3300006175 Bacteria 2784
161 Ga0097621_100473082 3300006237 Bacteria 1132
162 Ga0075428_100067140 3300006844 Bacteria 3926
163 Ga0075429_100396133 3300006880 Bacteria 1209
164 Ga0068865_100006686 3300006881 Bacteria 7052
165 Ga0068865_100096480 3300006881 Bacteria 2156
166 Ga0068865_100370204 3300006881 Bacteria 1166
167 Ga0097620_100017600 3300006931 Bacteria 7185
168 Ga0105240_10070774 3300009093 Bacteria 4314
169 Ga0105240_10182065 3300009093 Bacteria 2479
170 Ga0105240_10527381 3300009093 Bacteria 1310
171 Ga0105245_10010546 3300009098 Bacteria 8041
172 Ga0105245_10127530 3300009098 Bacteria 2383
173 Ga0105245_10136962 3300009098 Bacteria 2302
174 Ga0105247_10063947 3300009101 Bacteria 2285
175 Ga0114129_10150002 3300009147 Bacteria 3191
176 Ga0105243_10023919 3300009148 Bacteria 4655
177 Ga0105243_10274823 3300009148 Bacteria 1515
178 Ga0105242_10009591 3300009176 Bacteria 7420
179 Ga0105248_10001057 3300009177 Bacteria 30519
180 Ga0105248_10038332 3300009177 Bacteria 5363
181 Ga0105248_10088941 3300009177 Bacteria 3476
182 Ga0105248_10438558 3300009177 Bacteria 1471
183 Ga0105238_10016671 3300009551 Bacteria 7443
184 Ga0105239_10191836 3300010375 Bacteria 2287
185 Ga0157373_10048666 3300013100 Bacteria 3022
186 Ga0157373_10055204 3300013100 Bacteria 2822
187 Ga0157373_10145672 3300013100 Bacteria 1666
188 Ga0157373_10163093 3300013100 Bacteria 1568
189 Ga0157373_10173697 3300013100 Bacteria 1516
190 Ga0157373_10376694 3300013100 Bacteria 1015
191 Ga0157371_10024770 3300013102 Bacteria 4379
192 Ga0157371_10034279 3300013102 Bacteria 3642
193 Ga0157371_10071430 3300013102 Bacteria 2457
194 Ga0157371_10195186 3300013102 Bacteria 1450
195 Ga0157371_10283381 3300013102 Bacteria 1197
196 Ga0157369_10065683 3300013105 Bacteria 3904
197 Ga0157369_10188149 3300013105 Bacteria 2170
198 Ga0157369_10475901 3300013105 Bacteria 1293
199 Ga0157369_10524984 3300013105 Unclassified 1225
200 Ga0157374_10005380 3300013296 Bacteria 10755
201 Ga0157374_10012445 3300013296 Bacteria 7402
202 Ga0157374_10022956 3300013296 Bacteria 5572
203 Ga0157374_10295539 3300013296 Bacteria 1602
204 Ga0157374_10322722 3300013296 Bacteria 1530
205 Ga0157374_10826642 3300013296 Bacteria 943
206 Ga0157378_10012580 3300013297 Bacteria 7408
207 Ga0157378_10031417 3300013297 Bacteria 4691
208 Ga0163162_10020561 3300013306 Bacteria 6485
209 Ga0163162_10055919 3300013306 Bacteria 3974
210 Ga0157372_10221082 3300013307 Bacteria 2195
211 Ga0157372_10309027 3300013307 Bacteria 1840
212 Ga0157372_10440168 3300013307 Bacteria 1519
213 Ga0157375_10009954 3300013308 Bacteria 8358
214 Ga0157375_10044591 3300013308 Bacteria 4310
215 Ga0157375_10201961 3300013308 Bacteria 2144
216 Ga0163163_10058270 3300014325 Bacteria 3819
217 Ga0157380_10266337 3300014326 Bacteria 1559
218 Ga0157377_10026060 3300014745 Bacteria 3125
219 Ga0157377_10032443 3300014745 Bacteria 2844
220 Ga0157379_10010521 3300014968 Bacteria 8064
221 Ga0157376_10035069 3300014969 Bacteria 4056
222 Ga0157376_10100365 3300014969 Bacteria 2527
223 Ga0157376_10679564 3300014969 Bacteria 1033
224 Ga0206356_11084597 3300020070 Bacteria 795
225 Ga0207697_10001678 3300025315 Bacteria 11951
226 Ga0207697_10038057 3300025315 Bacteria 1972
227 Ga0207697_10040718 3300025315 Bacteria 1907
228 Ga0207656_10399213 3300025321 Unclassified 691
229 Ga0207682_10006519 3300025893 Bacteria 4694
230 Ga0207642_10035023 3300025899 Bacteria 2140
231 Ga0207688_10027018 3300025901 Bacteria 3157
232 Ga0207680_10001306 3300025903 Bacteria 11767
233 Ga0207680_10001418 3300025903 Bacteria 11355
234 Ga0207647_10003162 3300025904 Bacteria 12354
235 Ga0207647_10006862 3300025904 Bacteria 8258
236 Ga0207699_10171065 3300025906 Bacteria 1453
237 Ga0207645_10026652 3300025907 Bacteria 3734
238 Ga0207645_10300722 3300025907 Bacteria 1068
239 Ga0207643_10077374 3300025908 Bacteria 1923
240 Ga0207643_10091137 3300025908 Bacteria 1777
241 Ga0207705_10028881 3300025909 Bacteria 3953
242 Ga0207705_10047893 3300025909 Bacteria 3074
243 Ga0207707_10183265 3300025912 Bacteria 1828
244 Ga0207707_10627877 3300025912 Bacteria 907
245 Ga0207695_10019656 3300025913 Bacteria 7769
246 Ga0207693_10165055 3300025915 Bacteria 1743
247 Ga0207660_10200180 3300025917 Bacteria 1559
248 Ga0207660_11005605 3300025917 Bacteria 680
249 Ga0207662_10033128 3300025918 Bacteria 3009
250 Ga0207657_10004412 3300025919 Bacteria 14886
251 Ga0207657_10006116 3300025919 Bacteria 12512
252 Ga0207657_10021157 3300025919 Bacteria 6129
253 Ga0207657_10098195 3300025919 Bacteria 2434
254 Ga0207657_10299326 3300025919 Bacteria 1274
255 Ga0207649_10027651 3300025920 Bacteria 3331
256 Ga0207649_10061891 3300025920 Bacteria 2357
257 Ga0207649_10873356 3300025920 Bacteria 704
258 Ga0207652_10174624 3300025921 Bacteria 1929
259 Ga0207681_10879973 3300025923 Bacteria 750
260 Ga0207694_10039710 3300025924 Bacteria 3622
261 Ga0207650_10072856 3300025925 Bacteria 2586
262 Ga0207650_10159585 3300025925 Bacteria 1786
263 Ga0207650_10516713 3300025925 Unclassified 999
264 Ga0207659_10041504 3300025926 Bacteria 3222
265 Ga0207659_10247323 3300025926 Unclassified 1445
266 Ga0207687_10014749 3300025927 Bacteria 5117
267 Ga0207687_10085163 3300025927 Bacteria 2292
268 Ga0207687_10092622 3300025927 Bacteria 2207
269 Ga0207687_10176028 3300025927 Unclassified 1654
270 Ga0207700_10058255 3300025928 Bacteria 2917
271 Ga0207664_10068594 3300025929 Bacteria 2849
272 Ga0207644_10001055 3300025931 Bacteria 17632
273 Ga0207644_10001701 3300025931 Bacteria 14200
274 Ga0207644_10002053 3300025931 Bacteria 13049
275 Ga0207644_10309378 3300025931 Bacteria 1275
276 Ga0207690_10038177 3300025932 Bacteria 3124
277 Ga0207690_10040408 3300025932 Bacteria 3049
278 Ga0207690_10102076 3300025932 Bacteria 2050
279 Ga0207690_10127243 3300025932 Bacteria 1859
280 Ga0207690_10139699 3300025932 Bacteria 1783
281 Ga0207690_10311939 3300025932 Unclassified 1234
282 Ga0207690_10316521 3300025932 Bacteria 1225
283 Ga0207706_10002977 3300025933 Bacteria 16347
284 Ga0207706_10004662 3300025933 Bacteria 12849
285 Ga0207706_10013884 3300025933 Bacteria 7305
286 Ga0207706_10045079 3300025933 Bacteria 3908
287 Ga0207706_10060807 3300025933 Bacteria 3327
288 Ga0207706_10159919 3300025933 Bacteria 1980
289 Ga0207686_10004481 3300025934 Bacteria 7482
290 Ga0207709_10095048 3300025935 Bacteria 1957
291 Ga0207709_10175380 3300025935 Bacteria 1509
292 Ga0207670_10248749 3300025936 Bacteria 1373
293 Ga0207670_10543190 3300025936 Bacteria 949
294 Ga0207669_10002568 3300025937 Bacteria 7757
295 Ga0207669_10005160 3300025937 Bacteria 5826
296 Ga0207704_10024134 3300025938 Bacteria 3291
297 Ga0207704_10074184 3300025938 Bacteria 2170
298 Ga0207704_10083205 3300025938 Bacteria 2076
299 Ga0207665_10426074 3300025939 Bacteria 1014
300 Ga0207691_10002787 3300025940 Bacteria 17036
301 Ga0207691_10027583 3300025940 Bacteria 5324
302 Ga0207691_10042467 3300025940 Bacteria 4191
303 Ga0207691_10043406 3300025940 Bacteria 4144
304 Ga0207691_10386554 3300025940 Bacteria 1194
305 Ga0207711_10000372 3300025941 Bacteria 47656
306 Ga0207711_10009940 3300025941 Bacteria 7910
307 Ga0207711_10323694 3300025941 Bacteria 1425
308 Ga0207689_10039666 3300025942 Bacteria 3898
309 Ga0207679_10206746 3300025945 Bacteria 1644
310 Ga0207667_10043092 3300025949 Bacteria 4790
311 Ga0207667_10241733 3300025949 Bacteria 1847
312 Ga0207667_10652051 3300025949 Unclassified 1058
313 Ga0207667_10695782 3300025949 Unclassified 1019
314 Ga0207651_10001542 3300025960 Bacteria 10516
315 Ga0207651_10019921 3300025960 Bacteria 4034
316 Ga0207651_10021384 3300025960 Bacteria 3931
317 Ga0207651_10033468 3300025960 Bacteria 3315
318 Ga0207651_10073751 3300025960 Bacteria 2428
319 Ga0207651_10410143 3300025960 Unclassified 1154
320 Ga0207668_10272421 3300025972 Unclassified 1384
321 Ga0207668_10290563 3300025972 Bacteria 1345
322 Ga0207668_10526178 3300025972 Bacteria 1021
323 Ga0207640_10021968 3300025981 Bacteria 3812
324 Ga0207640_10029477 3300025981 Bacteria 3369
325 Ga0207640_10665098 3300025981 Bacteria 889
326 Ga0207658_10001814 3300025986 Bacteria 15968
327 Ga0207658_10012694 3300025986 Bacteria 5753
328 Ga0207658_10384362 3300025986 Bacteria 1230
329 Ga0207677_10001036 3300026023 Bacteria 15297
330 Ga0207677_10003171 3300026023 Bacteria 8683
331 Ga0207677_10003995 3300026023 Bacteria 7868
332 Ga0207677_10007457 3300026023 Bacteria 6054
333 Ga0207677_10059125 3300026023 Bacteria 2642
334 Ga0207677_10618074 3300026023 Bacteria 953
335 Ga0207703_10001293 3300026035 Bacteria 23178
336 Ga0207703_10094024 3300026035 Bacteria 2526
337 Ga0207639_10464602 3300026041 Bacteria 1151
338 Ga0207639_10594174 3300026041 Bacteria 1020
339 Ga0207678_10006711 3300026067 Bacteria 10209
340 Ga0207702_10053883 3300026078 Bacteria 3406
341 Ga0207702_10130071 3300026078 Bacteria 2264
342 Ga0207648_10003806 3300026089 Bacteria 15770
343 Ga0207648_10010598 3300026089 Bacteria 8718
344 Ga0207676_10053689 3300026095 Bacteria 3154
345 Ga0207676_10956399 3300026095 Bacteria 842
346 Ga0207674_10739320 3300026116 Bacteria 949
347 Ga0207675_100083921 3300026118 Bacteria 2989
348 Ga0207683_10006388 3300026121 Bacteria 10095
349 Ga0207683_10011147 3300026121 Bacteria 7662
350 Ga0207683_10018134 3300026121 Bacteria 6003
351 Ga0207698_10262161 3300026142 Bacteria 1588
352 Ga0207698_10603901 3300026142 Unclassified 1082
353 Ga0268266_10044171 3300028379 Bacteria 3809
354 Ga0268266_10568149 3300028379 Bacteria 1088
355 Ga0268265_11533893 3300028380 Unclassified 670
356 Ga0268264_10418130 3300028381 Bacteria 1292
357 Ga0307410_10371931 3300031852 Bacteria 1147
358 Ga0307409_100034518 3300031995 Bacteria 3695
359 Ga0307414_10007260 3300032004 Bacteria 6225
360 Ga0307411_10047090 3300032005 Bacteria 2785
361 Ga0373938_0131098 3300034957 Bacteria 654
362 Ga0373944_0082755 3300035089 Bacteria 1062
363 Ga0373951_0190413 3300035091 Bacteria 593
364 Ga0373931_0105011 3300035691 Bacteria 1594
365 Ga0373931_0800774 3300035691 Unclassified 628
366 Ga0373935_0025493 3300035692 Bacteria 3644
367 Ga0373947_0185463 3300035725 Bacteria 1356
368 Ga0395899_0005782 3300037312 Bacteria 9597
369 Ga0395899_0014298 3300037312 Bacteria 6058
370 Ga0395899_0053690 3300037312 Bacteria 2982
371 Ga0395899_0099986 3300037312 Bacteria 2094
372 Ga0395899_0135333 3300037312 Bacteria 1757
373 Ga0395899_0350172 3300037312 Bacteria 988
374 Ga0395899_0436270 3300037312 Bacteria 860
375 Ga0395900_0013711 3300037418 Bacteria 8274
376 Ga0395900_0032868 3300037418 Bacteria 5336
377 Ga0395900_0036445 3300037418 Bacteria 5071
378 Ga0395900_0081187 3300037418 Bacteria 3331
379 Ga0395900_0144529 3300037418 Bacteria 2433
380 Ga0395900_0325865 3300037418 Bacteria 1515
381 Ga0395900_0351626 3300037418 Bacteria 1447
382 Ga0395900_0679169 3300037418 Bacteria 964
383 Ga0395900_0730860 3300037418 Unclassified 921
384 Ga0395900_1335752 3300037418 Unclassified 630
385 Ga0395898_0011825 3300037466 Bacteria 9044
386 Ga0395898_0208389 3300037466 Bacteria 1865
387 Ga0395898_0222017 3300037466 Bacteria 1802
388 Ga0395898_0466082 3300037466 Unclassified 1202
389 Ga0395898_0550673 3300037466 Bacteria 1096
390 Ga0395898_0695675 3300037466 Bacteria 958
391 Ga0395898_0775497 3300037466 Bacteria 899
392 Ga0395898_1224479 3300037466 Bacteria 681
393 Ga0395905_0008262 3300037471 Bacteria 10278
394 Ga0395905_0039430 3300037471 Bacteria 4432
395 Ga0395905_0048295 3300037471 Bacteria 3989
396 Ga0395905_0113719 3300037471 Bacteria 2543
397 Ga0395905_0245260 3300037471 Bacteria 1673
398 Ga0395905_1096081 3300037471 Bacteria 699
399 Ga0395901_0006861 3300038443 Bacteria 11503
400 Ga0395901_0041304 3300038443 Bacteria 4779
401 Ga0395901_0121458 3300038443 Bacteria 2745
402 Ga0395901_0303321 3300038443 Bacteria 1655
403 Ga0395901_0307931 3300038443 Bacteria 1641
404 Ga0395901_0501529 3300038443 Bacteria 1235
405 Ga0395901_0717559 3300038443 Unclassified 996
406 Ga0395901_1172576 3300038443 Unclassified 735
407 Ga0466969_0008227 3300044656 Bacteria 5533
408 Ga0466972_0055155 3300044658 Bacteria 1912
409 Ga0466966_0000939 3300044684 Bacteria 18614
410 Ga0466961_0014522 3300044693 Bacteria 5060
411 Ga0466963_0005605 3300044694 Bacteria 7364
412 Ga0466963_0092421 3300044694 Bacteria 2061
413 Ga0466963_0537233 3300044694 Unclassified 826
414 Ga0466971_0006574 3300044719 Bacteria 5052
415 Ga0466971_0021917 3300044719 Bacteria 2844
416 Ga0466970_0010157 3300044765 Bacteria 4771
417 Ga0466957_0001326 3300044842 Bacteria 12924
418 Ga0466957_0001949 3300044842 Bacteria 10963
419 Ga0466960_0657268 3300044901 Unclassified 626
420 Ga0466959_0009532 3300045049 Bacteria 6909
421 Ga0466959_0387610 3300045049 Bacteria 950
422 Ga0466958_0001249 3300045836 Bacteria 11903
423 Ga0466958_0004859 3300045836 Bacteria 7153
424 Ga0466967_0010261 3300045976 Bacteria 7011
425 Ga0466967_0681658 3300045976 Unclassified 1017
426 Ga0495621_0000607 3300046539 Bacteria 8971
427 Ga0495635_0293799 3300046663 Bacteria 1090
428 Ga0495669_0025601 3300046684 Bacteria 2573
429 Ga0495669_0052440 3300046684 Bacteria 1832
430 Ga0495670_0000431 3300046691 Bacteria 20088
431 Ga0495677_0073776 3300047445 Bacteria 1273
432 Ga0496101_0011745 3300048904 Bacteria 5822
433 Ga0496102_0105947 3300048905 Bacteria 2616
434 Ga0496102_0307119 3300048905 Bacteria 1495
435 Ga0496103_0324305 3300048906 Bacteria 990
436 Ga0496104_0085390 3300048907 Bacteria 3013
437 Ga0496106_0003210 3300048909 Bacteria 12244
438 Ga0496106_0489144 3300048909 Bacteria 988
439 Ga0496107_0001852 3300048910 Bacteria 13357
440 Ga0496107_0193485 3300048910 Bacteria 1511
441 Ga0496108_0000578 3300048911 Bacteria 28619
442 Ga0496109_0013232 3300048912 Bacteria 7144
443 Ga0496109_0567275 3300048912 Bacteria 1070
444 Ga0496110_0004837 3300048913 Bacteria 10498
445 Ga0496111_0000970 3300048914 Bacteria 15674
446 Ga0496111_0049549 3300048914 Bacteria 3029
447 Ga0496112_0071755 3300048915 Bacteria 3422
448 Ga0496112_0507389 3300048915 Bacteria 1141
449 Ga0496113_0000659 3300048916 Bacteria 17462
450 Ga0496114_0000006 3300048917 Bacteria 472921
451 Ga0496114_0040584 3300048917 Bacteria 3854
452 nmdc:mga05p37_645822_c1 3300050507 Bacteria 1186
453 nmdc:mga09592_405359_c1 3300050508 Bacteria 1178
454 Ga0501084_0784502 3300054114 Bacteria 803
455 Ga0466962_0036156 3300061719 Bacteria 2363
456 Ga0466962_0170875 3300061719 Bacteria 1058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10165891 Ga0070676_101658913 127
2 3300005330 Ga0070690_100019496 Ga0070690_1000194964 127
3 3300005335 Ga0070666_10000415 Ga0070666_1000041514 127
4 3300005338 Ga0068868_100000422 Ga0068868_1000004227 127
5 3300005343 Ga0070687_100043045 Ga0070687_1000430452 127
6 3300005355 Ga0070671_100006203 Ga0070671_1000062036 127
7 3300005356 Ga0070674_100006134 Ga0070674_1000061347 127
8 3300005364 Ga0070673_100005150 Ga0070673_1000051505 127
9 3300005366 Ga0070659_100558852 Ga0070659_1005588522 127
10 3300005367 Ga0070667_100000839 Ga0070667_10000083915 127
11 3300005457 Ga0070662_100329019 Ga0070662_1003290193 127
12 3300005543 Ga0070672_100488304 Ga0070672_1004883042 127
13 3300005548 Ga0070665_100910727 Ga0070665_1009107271 127
14 3300005578 Ga0068854_100285959 Ga0068854_1002859592 127
15 3300005615 Ga0070702_100520110 Ga0070702_1005201102 127
16 3300005616 Ga0068852_100626937 Ga0068852_1006269372 127
17 3300005834 Ga0068851_10169758 Ga0068851_101697581 127
18 3300005842 Ga0068858_100002249 Ga0068858_10000224919 127
19 3300005843 Ga0068860_100321821 Ga0068860_1003218212 127
20 3300006881 Ga0068865_100096480 Ga0068865_1000964803 127
21 3300009098 Ga0105245_10127530 Ga0105245_101275304 127
22 3300009148 Ga0105243_10274823 Ga0105243_102748233 127
23 3300009177 Ga0105248_10001057 Ga0105248_1000105715 127
24 3300013296 Ga0157374_10322722 Ga0157374_103227223 127
25 3300025321 Ga0207656_10399213 Ga0207656_103992131 127
26 3300025903 Ga0207680_10001418 Ga0207680_1000141815 127
27 3300025904 Ga0207647_10006862 Ga0207647_100068622 127
28 3300025918 Ga0207662_10033128 Ga0207662_100331284 127
29 3300025927 Ga0207687_10092622 Ga0207687_100926222 127
30 3300025931 Ga0207644_10002053 Ga0207644_1000205314 127
31 3300025935 Ga0207709_10175380 Ga0207709_101753801 127
32 3300025936 Ga0207670_10248749 Ga0207670_102487492 127
33 3300025938 Ga0207704_10074184 Ga0207704_100741842 127
34 3300025940 Ga0207691_10386554 Ga0207691_103865542 127
35 3300025941 Ga0207711_10000372 Ga0207711_1000037227 127
36 3300025960 Ga0207651_10021384 Ga0207651_100213843 127
37 3300025986 Ga0207658_10001814 Ga0207658_100018149 127
38 3300026023 Ga0207677_10001036 Ga0207677_1000103615 127
39 3300026035 Ga0207703_10001293 Ga0207703_100012937 127
40 3300028379 Ga0268266_10568149 Ga0268266_105681492 127
41 3300028381 Ga0268264_10418130 Ga0268264_104181301 127
42 3300035691 Ga0373931_0800774 Ga0373931_0800774_50_535 127
43 3300013296 Ga0157374_10826642 Ga0157374_108266422 128
44 3300013308 Ga0157375_10201961 Ga0157375_102019612 128
45 3300048914 Ga0496111_0049549 Ga0496111_0049549_1560_2039 128
46 3300048917 Ga0496114_0000006 Ga0496114_0000006_109030_109509 132
47 3300005338 Ga0068868_100001497 Ga0068868_10000149712 133
48 3300009098 Ga0105245_10136962 Ga0105245_101369623 133
49 3300013296 Ga0157374_10295539 Ga0157374_102955392 133
50 3300025927 Ga0207687_10014749 Ga0207687_100147493 133
51 3300026023 Ga0207677_10003171 Ga0207677_100031714 133
52 3300005458 Ga0070681_10096572 Ga0070681_100965723 134
53 3300025912 Ga0207707_10183265 Ga0207707_101832653 134
54 3300005327 Ga0070658_10005539 Ga0070658_100055399 137
55 3300025909 Ga0207705_10047893 Ga0207705_100478932 137
56 3300044694 Ga0466963_0537233 Ga0466963_0537233_397_816 137
57 3300001991 JGI24743J22301_10027434 JGI24743J22301_100274342 138
58 3300044694 Ga0466963_0092421 Ga0466963_0092421_10_426 138
59 3300013100 Ga0157373_10055204 Ga0157373_100552045 151
60 3300013105 Ga0157369_10188149 Ga0157369_101881494 151
61 3300013296 Ga0157374_10005380 Ga0157374_1000538010 151
62 3300003323 rootH1_10263190 rootH1_102631903 152
63 3300005339 Ga0070660_100034524 Ga0070660_1000345244 152
64 3300025919 Ga0207657_10004412 Ga0207657_1000441210 152
65 3300037418 Ga0395900_0325865 Ga0395900_0325865_828_1292 152
66 3300038443 Ga0395901_0717559 Ga0395901_0717559_213_677 152
67 3300038443 Ga0395901_1172576 Ga0395901_1172576_168_632 152
68 3300044656 Ga0466969_0008227 Ga0466969_0008227_4596_5060 152
69 3300044684 Ga0466966_0000939 Ga0466966_0000939_10196_10660 152
70 3300044693 Ga0466961_0014522 Ga0466961_0014522_3664_4128 152
71 3300044719 Ga0466971_0006574 Ga0466971_0006574_2550_3014 152
72 3300044765 Ga0466970_0010157 Ga0466970_0010157_3979_4443 152
73 3300044842 Ga0466957_0001326 Ga0466957_0001326_3871_4335 152
74 3300045049 Ga0466959_0009532 Ga0466959_0009532_5643_6107 152
75 3300045049 Ga0466959_0387610 Ga0466959_0387610_255_719 152
76 3300045836 Ga0466958_0001249 Ga0466958_0001249_7955_8419 152
77 3300061719 Ga0466962_0036156 Ga0466962_0036156_84_548 152
78 3300061719 Ga0466962_0170875 Ga0466962_0170875_338_802 152
79 3300005290 Ga0065712_10010008 Ga0065712_100100084 153
80 3300005293 Ga0065715_10209356 Ga0065715_102093563 153
81 3300005327 Ga0070658_10623174 Ga0070658_106231742 153
82 3300005330 Ga0070690_100163700 Ga0070690_1001637003 153
83 3300005331 Ga0070670_100204288 Ga0070670_1002042883 153
84 3300005336 Ga0070680_100165817 Ga0070680_1001658173 153
85 3300005339 Ga0070660_100032905 Ga0070660_1000329054 153
86 3300005344 Ga0070661_100037907 Ga0070661_1000379073 153
87 3300005347 Ga0070668_100677296 Ga0070668_1006772962 153
88 3300005353 Ga0070669_100046325 Ga0070669_1000463255 153
89 3300005354 Ga0070675_100062506 Ga0070675_1000625064 153
90 3300005364 Ga0070673_100050944 Ga0070673_1000509443 153
91 3300005366 Ga0070659_100023685 Ga0070659_1000236852 153
92 3300005366 Ga0070659_100094063 Ga0070659_1000940633 153
93 3300005366 Ga0070659_100372066 Ga0070659_1003720662 153
94 3300005366 Ga0070659_100435746 Ga0070659_1004357462 153
95 3300005455 Ga0070663_100552773 Ga0070663_1005527732 153
96 3300005457 Ga0070662_100068146 Ga0070662_1000681462 153
97 3300005457 Ga0070662_100164318 Ga0070662_1001643182 153
98 3300005458 Ga0070681_10179608 Ga0070681_101796082 153
99 3300005530 Ga0070679_100679176 Ga0070679_1006791762 153
100 3300005530 Ga0070679_101122968 Ga0070679_1011229682 153
101 3300005563 Ga0068855_100873648 Ga0068855_1008736482 153
102 3300005564 Ga0070664_100031963 Ga0070664_1000319636 153
103 3300005616 Ga0068852_100737599 Ga0068852_1007375992 153
104 3300009093 Ga0105240_10182065 Ga0105240_101820654 153
105 3300013100 Ga0157373_10145672 Ga0157373_101456722 153
106 3300013102 Ga0157371_10034279 Ga0157371_100342794 153
107 3300013102 Ga0157371_10195186 Ga0157371_101951862 153
108 3300013105 Ga0157369_10524984 Ga0157369_105249842 153
109 3300025912 Ga0207707_10627877 Ga0207707_106278772 153
110 3300025917 Ga0207660_10200180 Ga0207660_102001802 153
111 3300025919 Ga0207657_10021157 Ga0207657_100211576 153
112 3300025921 Ga0207652_10174624 Ga0207652_101746243 153
113 3300025925 Ga0207650_10516713 Ga0207650_105167132 153
114 3300025926 Ga0207659_10247323 Ga0207659_102473232 153
115 3300025932 Ga0207690_10139699 Ga0207690_101396994 153
116 3300025932 Ga0207690_10311939 Ga0207690_103119392 153
117 3300025932 Ga0207690_10316521 Ga0207690_103165212 153
118 3300025933 Ga0207706_10004662 Ga0207706_100046625 153
119 3300025933 Ga0207706_10013884 Ga0207706_100138845 153
120 3300025940 Ga0207691_10042467 Ga0207691_100424674 153
121 3300025949 Ga0207667_10695782 Ga0207667_106957822 153
122 3300025960 Ga0207651_10073751 Ga0207651_100737514 153
123 3300025972 Ga0207668_10290563 Ga0207668_102905633 153
124 3300034957 Ga0373938_0131098 Ga0373938_0131098_101_568 153
125 3300035091 Ga0373951_0190413 Ga0373951_0190413_48_515 153
126 3300037312 Ga0395899_0014298 Ga0395899_0014298_3434_3901 153
127 3300037418 Ga0395900_0032868 Ga0395900_0032868_4430_4897 153
128 3300037418 Ga0395900_0081187 Ga0395900_0081187_2108_2575 153
129 3300037418 Ga0395900_0351626 Ga0395900_0351626_714_1181 153
130 3300037466 Ga0395898_0011825 Ga0395898_0011825_1285_1752 153
131 3300038443 Ga0395901_0041304 Ga0395901_0041304_3028_3495 153
132 3300038443 Ga0395901_0307931 Ga0395901_0307931_965_1432 153
133 3300054114 Ga0501084_0784502 Ga0501084_0784502_25_492 153
134 3300003323 rootH1_10304483 rootH1_103044832 157
135 3300005366 Ga0070659_100018789 Ga0070659_1000187893 157
136 3300005546 Ga0070696_100149697 Ga0070696_1001496972 157
137 3300006844 Ga0075428_100067140 Ga0075428_1000671404 157
138 3300006880 Ga0075429_100396133 Ga0075429_1003961332 157
139 3300009147 Ga0114129_10150002 Ga0114129_101500022 157
140 3300028380 Ga0268265_11533893 Ga0268265_115338931 157
141 3300050507 nmdc:mga05p37_645822_c1 nmdc:mga05p37_645822_c1_235_717 157
142 3300050508 nmdc:mga09592_405359_c1 nmdc:mga09592_405359_c1_456_938 157
143 3300037312 Ga0395899_0350172 Ga0395899_0350172_57_536 158
144 3300037418 Ga0395900_0013711 Ga0395900_0013711_2961_3440 158
145 3300037466 Ga0395898_0208389 Ga0395898_0208389_1000_1479 158
146 3300037471 Ga0395905_0008262 Ga0395905_0008262_4534_5013 158
147 3300037471 Ga0395905_0113719 Ga0395905_0113719_147_623 158
148 3300038443 Ga0395901_0006861 Ga0395901_0006861_2480_2959 158
149 3300001989 JGI24739J22299_10030108 JGI24739J22299_100301083 159
150 3300001989 JGI24739J22299_10039334 JGI24739J22299_100393342 159
151 3300002077 JGI24744J21845_10000335 JGI24744J21845_1000033510 159
152 3300005293 Ga0065715_10036286 Ga0065715_100362863 159
153 3300005327 Ga0070658_10012328 Ga0070658_100123286 159
154 3300005327 Ga0070658_10075412 Ga0070658_100754121 159
155 3300005327 Ga0070658_10225022 Ga0070658_102250222 159
156 3300005327 Ga0070658_10645631 Ga0070658_106456312 159
157 3300005327 Ga0070658_10716540 Ga0070658_107165401 159
158 3300005328 Ga0070676_10019947 Ga0070676_100199475 159
159 3300005329 Ga0070683_100078711 Ga0070683_1000787113 159
160 3300005329 Ga0070683_100498591 Ga0070683_1004985912 159
161 3300005330 Ga0070690_100314336 Ga0070690_1003143362 159
162 3300005331 Ga0070670_100221014 Ga0070670_1002210142 159
163 3300005331 Ga0070670_100550306 Ga0070670_1005503062 159
164 3300005333 Ga0070677_10119412 Ga0070677_101194122 159
165 3300005335 Ga0070666_10003290 Ga0070666_100032906 159
166 3300005335 Ga0070666_10010540 Ga0070666_100105408 159
167 3300005336 Ga0070680_100937036 Ga0070680_1009370361 159
168 3300005337 Ga0070682_100471475 Ga0070682_1004714752 159
169 3300005338 Ga0068868_100227378 Ga0068868_1002273782 159
170 3300005338 Ga0068868_100505509 Ga0068868_1005055092 159
171 3300005339 Ga0070660_100013767 Ga0070660_1000137673 159
172 3300005339 Ga0070660_100022407 Ga0070660_1000224076 159
173 3300005339 Ga0070660_100257456 Ga0070660_1002574563 159
174 3300005339 Ga0070660_100418316 Ga0070660_1004183162 159
175 3300005344 Ga0070661_100009699 Ga0070661_1000096999 159
176 3300005344 Ga0070661_100093310 Ga0070661_1000933102 159
177 3300005344 Ga0070661_100108799 Ga0070661_1001087992 159
178 3300005344 Ga0070661_100167077 Ga0070661_1001670773 159
179 3300005344 Ga0070661_100453362 Ga0070661_1004533621 159
180 3300005345 Ga0070692_10033761 Ga0070692_100337612 159
181 3300005347 Ga0070668_100049354 Ga0070668_1000493545 159
182 3300005353 Ga0070669_100164242 Ga0070669_1001642422 159
183 3300005354 Ga0070675_100023540 Ga0070675_1000235404 159
184 3300005354 Ga0070675_100069765 Ga0070675_1000697652 159
185 3300005355 Ga0070671_100000793 Ga0070671_10000079316 159
186 3300005355 Ga0070671_100007657 Ga0070671_1000076575 159
187 3300005355 Ga0070671_100366997 Ga0070671_1003669972 159
188 3300005356 Ga0070674_100001248 Ga0070674_1000012489 159
189 3300005356 Ga0070674_100004983 Ga0070674_1000049833 159
190 3300005356 Ga0070674_100079168 Ga0070674_1000791683 159
191 3300005364 Ga0070673_100002090 Ga0070673_1000020905 159
192 3300005364 Ga0070673_100003531 Ga0070673_1000035319 159
193 3300005364 Ga0070673_100133280 Ga0070673_1001332804 159
194 3300005365 Ga0070688_100255611 Ga0070688_1002556113 159
195 3300005366 Ga0070659_100074043 Ga0070659_1000740435 159
196 3300005366 Ga0070659_100117176 Ga0070659_1001171762 159
197 3300005434 Ga0070709_10030762 Ga0070709_100307624 159
198 3300005435 Ga0070714_100027087 Ga0070714_1000270875 159
199 3300005435 Ga0070714_100066060 Ga0070714_1000660604 159
200 3300005435 Ga0070714_100067014 Ga0070714_1000670144 159
201 3300005436 Ga0070713_100028174 Ga0070713_1000281745 159
202 3300005455 Ga0070663_100037039 Ga0070663_1000370395 159
203 3300005455 Ga0070663_100121445 Ga0070663_1001214453 159
204 3300005455 Ga0070663_100223860 Ga0070663_1002238603 159
205 3300005456 Ga0070678_100005013 Ga0070678_1000050135 159
206 3300005456 Ga0070678_100011240 Ga0070678_1000112406 159
207 3300005456 Ga0070678_100020268 Ga0070678_1000202685 159
208 3300005457 Ga0070662_100002632 Ga0070662_1000026328 159
209 3300005457 Ga0070662_100045199 Ga0070662_1000451994 159
210 3300005458 Ga0070681_10395603 Ga0070681_103956032 159
211 3300005459 Ga0068867_100006361 Ga0068867_1000063619 159
212 3300005459 Ga0068867_100163194 Ga0068867_1001631944 159
213 3300005530 Ga0070679_101180383 Ga0070679_1011803831 159
214 3300005539 Ga0068853_100079395 Ga0068853_1000793954 159
215 3300005539 Ga0068853_100086205 Ga0068853_1000862054 159
216 3300005543 Ga0070672_100006621 Ga0070672_1000066218 159
217 3300005543 Ga0070672_100101673 Ga0070672_1001016732 159
218 3300005543 Ga0070672_100166087 Ga0070672_1001660872 159
219 3300005544 Ga0070686_100028133 Ga0070686_1000281334 159
220 3300005545 Ga0070695_100687283 Ga0070695_1006872832 159
221 3300005547 Ga0070693_100001691 Ga0070693_1000016916 159
222 3300005548 Ga0070665_100006465 Ga0070665_1000064655 159
223 3300005548 Ga0070665_100016126 Ga0070665_1000161265 159
224 3300005563 Ga0068855_100298497 Ga0068855_1002984972 159
225 3300005563 Ga0068855_100715327 Ga0068855_1007153272 159
226 3300005563 Ga0068855_100756852 Ga0068855_1007568521 159
227 3300005564 Ga0070664_100007622 Ga0070664_1000076225 159
228 3300005564 Ga0070664_100017531 Ga0070664_1000175318 159
229 3300005564 Ga0070664_100032733 Ga0070664_1000327334 159
230 3300005564 Ga0070664_100126690 Ga0070664_1001266903 159
231 3300005577 Ga0068857_100155923 Ga0068857_1001559232 159
232 3300005578 Ga0068854_100019849 Ga0068854_1000198491 159
233 3300005578 Ga0068854_100135698 Ga0068854_1001356982 159
234 3300005578 Ga0068854_100154675 Ga0068854_1001546751 159
235 3300005578 Ga0068854_100361187 Ga0068854_1003611872 159
236 3300005614 Ga0068856_100039322 Ga0068856_1000393223 159
237 3300005614 Ga0068856_100189827 Ga0068856_1001898272 159
238 3300005615 Ga0070702_100084843 Ga0070702_1000848434 159
239 3300005616 Ga0068852_100004886 Ga0068852_10000488611 159
240 3300005616 Ga0068852_100088726 Ga0068852_1000887264 159
241 3300005616 Ga0068852_100308007 Ga0068852_1003080073 159
242 3300005617 Ga0068859_100017599 Ga0068859_1000175994 159
243 3300005618 Ga0068864_100088193 Ga0068864_1000881933 159
244 3300005618 Ga0068864_100814717 Ga0068864_1008147172 159
245 3300005718 Ga0068866_10018283 Ga0068866_100182832 159
246 3300005719 Ga0068861_100398719 Ga0068861_1003987192 159
247 3300005834 Ga0068851_10006186 Ga0068851_100061865 159
248 3300005840 Ga0068870_10015557 Ga0068870_100155575 159
249 3300005840 Ga0068870_10133983 Ga0068870_101339833 159
250 3300005841 Ga0068863_100709362 Ga0068863_1007093622 159
251 3300005843 Ga0068860_100092570 Ga0068860_1000925702 159
252 3300005843 Ga0068860_100504794 Ga0068860_1005047941 159
253 3300006028 Ga0070717_10178803 Ga0070717_101788033 159
254 3300006173 Ga0070716_100431786 Ga0070716_1004317862 159
255 3300006175 Ga0070712_100055046 Ga0070712_1000550464 159
256 3300006237 Ga0097621_100473082 Ga0097621_1004730822 159
257 3300006881 Ga0068865_100006686 Ga0068865_1000066869 159
258 3300006881 Ga0068865_100370204 Ga0068865_1003702042 159
259 3300006931 Ga0097620_100017600 Ga0097620_1000176004 159
260 3300009093 Ga0105240_10070774 Ga0105240_100707743 159
261 3300009093 Ga0105240_10527381 Ga0105240_105273812 159
262 3300009098 Ga0105245_10010546 Ga0105245_100105466 159
263 3300009101 Ga0105247_10063947 Ga0105247_100639474 159
264 3300009148 Ga0105243_10023919 Ga0105243_100239193 159
265 3300009176 Ga0105242_10009591 Ga0105242_100095916 159
266 3300009177 Ga0105248_10038332 Ga0105248_100383323 159
267 3300009177 Ga0105248_10088941 Ga0105248_100889412 159
268 3300009177 Ga0105248_10438558 Ga0105248_104385583 159
269 3300009551 Ga0105238_10016671 Ga0105238_100166718 159
270 3300010375 Ga0105239_10191836 Ga0105239_101918363 159
271 3300013100 Ga0157373_10048666 Ga0157373_100486665 159
272 3300013100 Ga0157373_10163093 Ga0157373_101630932 159
273 3300013100 Ga0157373_10173697 Ga0157373_101736973 159
274 3300013100 Ga0157373_10376694 Ga0157373_103766941 159
275 3300013102 Ga0157371_10024770 Ga0157371_100247706 159
276 3300013102 Ga0157371_10071430 Ga0157371_100714304 159
277 3300013102 Ga0157371_10283381 Ga0157371_102833812 159
278 3300013105 Ga0157369_10065683 Ga0157369_100656836 159
279 3300013105 Ga0157369_10475901 Ga0157369_104759012 159
280 3300013296 Ga0157374_10012445 Ga0157374_100124456 159
281 3300013296 Ga0157374_10022956 Ga0157374_100229566 159
282 3300013297 Ga0157378_10012580 Ga0157378_100125805 159
283 3300013297 Ga0157378_10031417 Ga0157378_100314172 159
284 3300013306 Ga0163162_10020561 Ga0163162_100205616 159
285 3300013306 Ga0163162_10055919 Ga0163162_100559193 159
286 3300013307 Ga0157372_10221082 Ga0157372_102210824 159
287 3300013307 Ga0157372_10309027 Ga0157372_103090272 159
288 3300013307 Ga0157372_10440168 Ga0157372_104401682 159
289 3300013308 Ga0157375_10009954 Ga0157375_100099549 159
290 3300013308 Ga0157375_10044591 Ga0157375_100445912 159
291 3300014325 Ga0163163_10058270 Ga0163163_100582705 159
292 3300014326 Ga0157380_10266337 Ga0157380_102663372 159
293 3300014745 Ga0157377_10026060 Ga0157377_100260605 159
294 3300014745 Ga0157377_10032443 Ga0157377_100324432 159
295 3300014968 Ga0157379_10010521 Ga0157379_100105215 159
296 3300014969 Ga0157376_10035069 Ga0157376_100350693 159
297 3300014969 Ga0157376_10100365 Ga0157376_101003655 159
298 3300014969 Ga0157376_10679564 Ga0157376_106795641 159
299 3300020070 Ga0206356_11084597 Ga0206356_110845972 159
300 3300025315 Ga0207697_10001678 Ga0207697_1000167810 159
301 3300025315 Ga0207697_10038057 Ga0207697_100380574 159
302 3300025315 Ga0207697_10040718 Ga0207697_100407183 159
303 3300025893 Ga0207682_10006519 Ga0207682_100065192 159
304 3300025899 Ga0207642_10035023 Ga0207642_100350233 159
305 3300025901 Ga0207688_10027018 Ga0207688_100270184 159
306 3300025903 Ga0207680_10001306 Ga0207680_1000130612 159
307 3300025904 Ga0207647_10003162 Ga0207647_100031628 159
308 3300025906 Ga0207699_10171065 Ga0207699_101710653 159
309 3300025907 Ga0207645_10026652 Ga0207645_100266526 159
310 3300025907 Ga0207645_10300722 Ga0207645_103007222 159
311 3300025908 Ga0207643_10077374 Ga0207643_100773743 159
312 3300025908 Ga0207643_10091137 Ga0207643_100911372 159
313 3300025909 Ga0207705_10028881 Ga0207705_100288812 159
314 3300025913 Ga0207695_10019656 Ga0207695_100196569 159
315 3300025915 Ga0207693_10165055 Ga0207693_101650552 159
316 3300025917 Ga0207660_11005605 Ga0207660_110056051 159
317 3300025919 Ga0207657_10006116 Ga0207657_1000611615 159
318 3300025919 Ga0207657_10098195 Ga0207657_100981951 159
319 3300025919 Ga0207657_10299326 Ga0207657_102993262 159
320 3300025920 Ga0207649_10027651 Ga0207649_100276513 159
321 3300025920 Ga0207649_10061891 Ga0207649_100618912 159
322 3300025920 Ga0207649_10873356 Ga0207649_108733561 159
323 3300025923 Ga0207681_10879973 Ga0207681_108799732 159
324 3300025924 Ga0207694_10039710 Ga0207694_100397104 159
325 3300025925 Ga0207650_10072856 Ga0207650_100728564 159
326 3300025925 Ga0207650_10159585 Ga0207650_101595853 159
327 3300025926 Ga0207659_10041504 Ga0207659_100415043 159
328 3300025927 Ga0207687_10085163 Ga0207687_100851633 159
329 3300025927 Ga0207687_10176028 Ga0207687_101760282 159
330 3300025928 Ga0207700_10058255 Ga0207700_100582553 159
331 3300025929 Ga0207664_10068594 Ga0207664_100685943 159
332 3300025931 Ga0207644_10001055 Ga0207644_100010557 159
333 3300025931 Ga0207644_10001701 Ga0207644_100017019 159
334 3300025931 Ga0207644_10309378 Ga0207644_103093782 159
335 3300025932 Ga0207690_10038177 Ga0207690_100381775 159
336 3300025932 Ga0207690_10040408 Ga0207690_100404083 159
337 3300025932 Ga0207690_10102076 Ga0207690_101020761 159
338 3300025932 Ga0207690_10127243 Ga0207690_101272433 159
339 3300025933 Ga0207706_10002977 Ga0207706_1000297717 159
340 3300025933 Ga0207706_10045079 Ga0207706_100450794 159
341 3300025933 Ga0207706_10060807 Ga0207706_100608075 159
342 3300025933 Ga0207706_10159919 Ga0207706_101599193 159
343 3300025934 Ga0207686_10004481 Ga0207686_100044819 159
344 3300025935 Ga0207709_10095048 Ga0207709_100950483 159
345 3300025936 Ga0207670_10543190 Ga0207670_105431902 159
346 3300025937 Ga0207669_10002568 Ga0207669_1000256810 159
347 3300025937 Ga0207669_10005160 Ga0207669_100051603 159
348 3300025938 Ga0207704_10024134 Ga0207704_100241344 159
349 3300025938 Ga0207704_10083205 Ga0207704_100832054 159
350 3300025939 Ga0207665_10426074 Ga0207665_104260742 159
351 3300025940 Ga0207691_10002787 Ga0207691_1000278717 159
352 3300025940 Ga0207691_10027583 Ga0207691_100275835 159
353 3300025940 Ga0207691_10043406 Ga0207691_100434065 159
354 3300025941 Ga0207711_10009940 Ga0207711_100099409 159
355 3300025941 Ga0207711_10323694 Ga0207711_103236943 159
356 3300025942 Ga0207689_10039666 Ga0207689_100396665 159
357 3300025945 Ga0207679_10206746 Ga0207679_102067462 159
358 3300025949 Ga0207667_10043092 Ga0207667_100430922 159
359 3300025949 Ga0207667_10241733 Ga0207667_102417333 159
360 3300025949 Ga0207667_10652051 Ga0207667_106520512 159
361 3300025960 Ga0207651_10001542 Ga0207651_100015429 159
362 3300025960 Ga0207651_10019921 Ga0207651_100199215 159
363 3300025960 Ga0207651_10033468 Ga0207651_100334685 159
364 3300025960 Ga0207651_10410143 Ga0207651_104101431 159
365 3300025972 Ga0207668_10272421 Ga0207668_102724213 159
366 3300025972 Ga0207668_10526178 Ga0207668_105261782 159
367 3300025981 Ga0207640_10021968 Ga0207640_100219683 159
368 3300025981 Ga0207640_10029477 Ga0207640_100294775 159
369 3300025981 Ga0207640_10665098 Ga0207640_106650981 159
370 3300025986 Ga0207658_10012694 Ga0207658_100126947 159
371 3300025986 Ga0207658_10384362 Ga0207658_103843622 159
372 3300026023 Ga0207677_10003995 Ga0207677_100039957 159
373 3300026023 Ga0207677_10007457 Ga0207677_100074577 159
374 3300026023 Ga0207677_10059125 Ga0207677_100591253 159
375 3300026023 Ga0207677_10618074 Ga0207677_106180741 159
376 3300026035 Ga0207703_10094024 Ga0207703_100940243 159
377 3300026041 Ga0207639_10464602 Ga0207639_104646021 159
378 3300026041 Ga0207639_10594174 Ga0207639_105941741 159
379 3300026067 Ga0207678_10006711 Ga0207678_100067116 159
380 3300026078 Ga0207702_10053883 Ga0207702_100538832 159
381 3300026078 Ga0207702_10130071 Ga0207702_101300711 159
382 3300026089 Ga0207648_10003806 Ga0207648_100038066 159
383 3300026089 Ga0207648_10010598 Ga0207648_100105985 159
384 3300026095 Ga0207676_10053689 Ga0207676_100536893 159
385 3300026095 Ga0207676_10956399 Ga0207676_109563992 159
386 3300026116 Ga0207674_10739320 Ga0207674_107393202 159
387 3300026118 Ga0207675_100083921 Ga0207675_1000839212 159
388 3300026121 Ga0207683_10006388 Ga0207683_100063889 159
389 3300026121 Ga0207683_10011147 Ga0207683_100111478 159
390 3300026121 Ga0207683_10018134 Ga0207683_100181346 159
391 3300026142 Ga0207698_10262161 Ga0207698_102621612 159
392 3300026142 Ga0207698_10603901 Ga0207698_106039011 159
393 3300028379 Ga0268266_10044171 Ga0268266_100441712 159
394 3300031852 Ga0307410_10371931 Ga0307410_103719312 159
395 3300031995 Ga0307409_100034518 Ga0307409_1000345185 159
396 3300032004 Ga0307414_10007260 Ga0307414_100072606 159
397 3300032005 Ga0307411_10047090 Ga0307411_100470903 159
398 3300035089 Ga0373944_0082755 Ga0373944_0082755_388_867 159
399 3300035691 Ga0373931_0105011 Ga0373931_0105011_992_1471 159
400 3300035692 Ga0373935_0025493 Ga0373935_0025493_2064_2543 159
401 3300035725 Ga0373947_0185463 Ga0373947_0185463_391_870 159
402 3300037312 Ga0395899_0005782 Ga0395899_0005782_1174_1659 159
403 3300037312 Ga0395899_0053690 Ga0395899_0053690_913_1392 159
404 3300037312 Ga0395899_0099986 Ga0395899_0099986_1161_1649 159
405 3300037312 Ga0395899_0135333 Ga0395899_0135333_151_642 159
406 3300037312 Ga0395899_0436270 Ga0395899_0436270_251_736 159
407 3300037418 Ga0395900_0036445 Ga0395900_0036445_3611_4096 159
408 3300037418 Ga0395900_0144529 Ga0395900_0144529_782_1261 159
409 3300037418 Ga0395900_0679169 Ga0395900_0679169_366_845 159
410 3300037418 Ga0395900_0730860 Ga0395900_0730860_424_903 159
411 3300037418 Ga0395900_1335752 Ga0395900_1335752_44_523 159
412 3300037466 Ga0395898_0222017 Ga0395898_0222017_50_529 159
413 3300037466 Ga0395898_0466082 Ga0395898_0466082_198_677 159
414 3300037466 Ga0395898_0550673 Ga0395898_0550673_24_509 159
415 3300037466 Ga0395898_0695675 Ga0395898_0695675_435_914 159
416 3300037466 Ga0395898_0775497 Ga0395898_0775497_376_855 159
417 3300037466 Ga0395898_1224479 Ga0395898_1224479_156_635 159
418 3300037471 Ga0395905_0039430 Ga0395905_0039430_3196_3675 159
419 3300037471 Ga0395905_0048295 Ga0395905_0048295_45_530 159
420 3300037471 Ga0395905_0245260 Ga0395905_0245260_186_665 159
421 3300037471 Ga0395905_1096081 Ga0395905_1096081_157_642 159
422 3300038443 Ga0395901_0121458 Ga0395901_0121458_83_568 159
423 3300038443 Ga0395901_0303321 Ga0395901_0303321_689_1168 159
424 3300038443 Ga0395901_0501529 Ga0395901_0501529_16_495 159
425 3300044658 Ga0466972_0055155 Ga0466972_0055155_1032_1511 159
426 3300044694 Ga0466963_0005605 Ga0466963_0005605_967_1452 159
427 3300044719 Ga0466971_0021917 Ga0466971_0021917_984_1469 159
428 3300044842 Ga0466957_0001949 Ga0466957_0001949_5547_6032 159
429 3300044901 Ga0466960_0657268 Ga0466960_0657268_35_514 159
430 3300045836 Ga0466958_0004859 Ga0466958_0004859_6355_6840 159
431 3300045976 Ga0466967_0010261 Ga0466967_0010261_2826_3311 159
432 3300045976 Ga0466967_0681658 Ga0466967_0681658_29_514 159
433 3300046539 Ga0495621_0000607 Ga0495621_0000607_5172_5651 159
434 3300046663 Ga0495635_0293799 Ga0495635_0293799_409_888 159
435 3300046684 Ga0495669_0025601 Ga0495669_0025601_13_492 159
436 3300046684 Ga0495669_0052440 Ga0495669_0052440_202_687 159
437 3300046691 Ga0495670_0000431 Ga0495670_0000431_6777_7256 159
438 3300047445 Ga0495677_0073776 Ga0495677_0073776_441_920 159
439 3300048904 Ga0496101_0011745 Ga0496101_0011745_5041_5520 159
440 3300048905 Ga0496102_0105947 Ga0496102_0105947_1280_1759 159
441 3300048905 Ga0496102_0307119 Ga0496102_0307119_388_867 159
442 3300048906 Ga0496103_0324305 Ga0496103_0324305_253_732 159
443 3300048907 Ga0496104_0085390 Ga0496104_0085390_1353_1832 159
444 3300048909 Ga0496106_0003210 Ga0496106_0003210_7091_7570 159
445 3300048909 Ga0496106_0489144 Ga0496106_0489144_154_633 159
446 3300048910 Ga0496107_0001852 Ga0496107_0001852_5617_6096 159
447 3300048910 Ga0496107_0193485 Ga0496107_0193485_887_1366 159
448 3300048911 Ga0496108_0000578 Ga0496108_0000578_26024_26503 159
449 3300048912 Ga0496109_0013232 Ga0496109_0013232_4645_5124 159
450 3300048912 Ga0496109_0567275 Ga0496109_0567275_532_1011 159
451 3300048913 Ga0496110_0004837 Ga0496110_0004837_6368_6847 159
452 3300048914 Ga0496111_0000970 Ga0496111_0000970_11844_12323 159
453 3300048915 Ga0496112_0071755 Ga0496112_0071755_2117_2596 159
454 3300048915 Ga0496112_0507389 Ga0496112_0507389_505_984 159
455 3300048916 Ga0496113_0000659 Ga0496113_0000659_12961_13440 159
456 3300048917 Ga0496114_0040584 Ga0496114_0040584_477_956 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

63

137

0.9

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

126

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

15

138

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

45

128

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9273 9 157
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9081 9 157
5kf1-assembly1.cif.gz_B x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum, apo form, ph 5 0.8649 9 135
5kgh-assembly1.cif.gz_B x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum, mutant y297f 0.8641 9 135
5kga-assembly1.cif.gz_B x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum, mutant d287n, in complex with n-acetylglucosamine 0.864 9 135
ID Description Score Start End Superfamily
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.943 74 134 3.40.630.30
2cntA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9077 9 157 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8962 94 157 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8933 18 156 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8902 109 157 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6G7ZM18-F1-model_v4 GNAT family N-acetyltransferase 0.9746 8 157 GO:0016747
AF-A0A7W7AKH5-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase (EC 2.3.1.267) 0.9684 8 157 GO:0008999
AF-A0A430DSB9-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9683 8 156 GO:0005737
GO:0008999
AF-A0A3D0W8Y0-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9673 24 156 GO:0005737
GO:0008999
AF-A0A013VTF6-F1-model_v4 Ribosomal-protein-alanine acetyltransferase 0.9671 70 157 GO:0016747

Feature Viewer

pLDDT pTM Quality
92.45 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map