F447793
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 456 | 203 | 912 | 334 |
Family's Representative Sequence
| Representative Sequence | 3300025931|Ga0207644_10068276|Ga0207644_100682763 |
| Length | 363 |
| Sequence | MAATDRDYYELLGIPRDADEATIKKSFRRLARELHPDVSDHPEAEVRFREITEAYEVLSSSERRALYDRYGHAGLRSGGFSPTDFDMGNLGDLFASLFGDGIFGGTTGEARRRGADLGAEIAIELVEAARGVTVPVPFEVAATCTACGGDGVEPGTQPRTXXXXEGSGRLHQVSRSVFGEFVRAQPCPDCRGRGVLVDTRTLAERTLNVDVPAGIHDGQRIRVSGEGHAGTLGGRAGDVYVHVRVKPDPRFVREGNDIYSQVDLTIVQAALGAAFEVETLDGTVPLELPAGVQPGEVRVLRGKGMPVLQGFGRGDHRVLVNVTVPRRLTDEQRRLLEDFEAASDDQTYRVDESFFDKLKSAFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 25 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 28 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 34 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 77 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 78 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 81 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 82 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 91 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 92 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 94 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 95 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 96 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 97 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 100 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 101 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 102 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 103 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 104 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 105 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 106 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 116 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 162 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 163 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 203 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.46 |
| Metatranscriptomes | 1.54 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.22 |
| Nodule | 0 |
| Rhizoplane | 12.28 |
| Rhizosphere | 86.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207644_10068276 | 3300025931 | Bacteria | 2593 |
| 2 | Ga0070658_10015384 | 3300005327 | Bacteria | 6123 |
| 3 | Ga0070658_10184449 | 3300005327 | Bacteria | 1757 |
| 4 | Ga0070683_100014995 | 3300005329 | Bacteria | 6798 |
| 5 | Ga0070683_100105107 | 3300005329 | Bacteria | 2661 |
| 6 | Ga0070680_100013349 | 3300005336 | Bacteria | 6397 |
| 7 | Ga0070680_100024285 | 3300005336 | Bacteria | 4839 |
| 8 | Ga0070680_100101778 | 3300005336 | Bacteria | 2385 |
| 9 | Ga0070680_100150544 | 3300005336 | Bacteria | 1953 |
| 10 | Ga0070680_100296368 | 3300005336 | Unclassified | 1371 |
| 11 | Ga0070660_100001227 | 3300005339 | Bacteria | 17435 |
| 12 | Ga0070660_100026510 | 3300005339 | Bacteria | 4315 |
| 13 | Ga0070660_100028819 | 3300005339 | Bacteria | 4157 |
| 14 | Ga0070661_100022246 | 3300005344 | Bacteria | 4538 |
| 15 | Ga0070661_100039091 | 3300005344 | Bacteria | 3456 |
| 16 | Ga0070661_100050751 | 3300005344 | Bacteria | 3035 |
| 17 | Ga0070675_100363884 | 3300005354 | Bacteria | 1285 |
| 18 | Ga0070671_100160291 | 3300005355 | Bacteria | 1902 |
| 19 | Ga0070659_100069597 | 3300005366 | Bacteria | 2794 |
| 20 | Ga0070659_100086112 | 3300005366 | Bacteria | 2514 |
| 21 | Ga0070667_100004251 | 3300005367 | Bacteria | 12095 |
| 22 | Ga0070709_10138614 | 3300005434 | Bacteria | 1669 |
| 23 | Ga0070709_10180964 | 3300005434 | Bacteria | 1480 |
| 24 | Ga0070709_10194746 | 3300005434 | Bacteria | 1432 |
| 25 | Ga0070714_100019427 | 3300005435 | Bacteria | 5536 |
| 26 | Ga0070714_100152369 | 3300005435 | Bacteria | 2084 |
| 27 | Ga0070714_100254437 | 3300005435 | Bacteria | 1625 |
| 28 | Ga0070714_100275395 | 3300005435 | Bacteria | 1562 |
| 29 | Ga0070713_100083931 | 3300005436 | Bacteria | 2724 |
| 30 | Ga0070713_100179467 | 3300005436 | Unclassified | 1902 |
| 31 | Ga0070713_100357398 | 3300005436 | Bacteria | 1356 |
| 32 | Ga0070711_100003366 | 3300005439 | Bacteria | 9316 |
| 33 | Ga0070708_100015571 | 3300005445 | Bacteria | 6285 |
| 34 | Ga0070681_10003001 | 3300005458 | Bacteria | 15664 |
| 35 | Ga0070681_10004205 | 3300005458 | Bacteria | 13637 |
| 36 | Ga0070681_10023456 | 3300005458 | Bacteria | 6205 |
| 37 | Ga0070681_10053124 | 3300005458 | Bacteria | 4037 |
| 38 | Ga0070681_10074508 | 3300005458 | Bacteria | 3356 |
| 39 | Ga0070681_10089866 | 3300005458 | Bacteria | 3022 |
| 40 | Ga0070681_10111881 | 3300005458 | Bacteria | 2670 |
| 41 | Ga0070681_10133580 | 3300005458 | Bacteria | 2413 |
| 42 | Ga0070706_100162351 | 3300005467 | Bacteria | 2086 |
| 43 | Ga0070707_100070522 | 3300005468 | Bacteria | 3366 |
| 44 | Ga0070679_100002041 | 3300005530 | Bacteria | 18130 |
| 45 | Ga0070679_100032695 | 3300005530 | Bacteria | 5148 |
| 46 | Ga0070684_100014526 | 3300005535 | Bacteria | 6382 |
| 47 | Ga0070684_100021918 | 3300005535 | Bacteria | 5322 |
| 48 | Ga0070684_100115095 | 3300005535 | Bacteria | 2414 |
| 49 | Ga0070684_100133701 | 3300005535 | Bacteria | 2239 |
| 50 | Ga0070696_100014265 | 3300005546 | Bacteria | 5331 |
| 51 | Ga0070696_100042426 | 3300005546 | Bacteria | 3145 |
| 52 | Ga0070693_100023529 | 3300005547 | Bacteria | 3294 |
| 53 | Ga0070665_100004675 | 3300005548 | Bacteria | 14290 |
| 54 | Ga0068855_100005572 | 3300005563 | Bacteria | 15363 |
| 55 | Ga0068855_100104746 | 3300005563 | Bacteria | 3253 |
| 56 | Ga0068855_100107460 | 3300005563 | Bacteria | 3206 |
| 57 | Ga0068855_100242878 | 3300005563 | Bacteria | 2011 |
| 58 | Ga0068857_100045053 | 3300005577 | Bacteria | 3912 |
| 59 | Ga0068856_100030718 | 3300005614 | Bacteria | 5252 |
| 60 | Ga0068856_100073868 | 3300005614 | Bacteria | 3376 |
| 61 | Ga0068852_100008920 | 3300005616 | Bacteria | 7420 |
| 62 | Ga0068852_100031361 | 3300005616 | Bacteria | 4385 |
| 63 | Ga0068852_100230865 | 3300005616 | Bacteria | 1764 |
| 64 | Ga0081455_10032713 | 3300005937 | Bacteria | 4684 |
| 65 | Ga0081455_10050766 | 3300005937 | Bacteria | 3563 |
| 66 | Ga0081539_10001235 | 3300005985 | Bacteria | 45514 |
| 67 | Ga0081539_10003115 | 3300005985 | Bacteria | 21199 |
| 68 | Ga0070717_10005143 | 3300006028 | Bacteria | 9537 |
| 69 | Ga0070717_10081125 | 3300006028 | Bacteria | 2723 |
| 70 | Ga0070717_10088324 | 3300006028 | Unclassified | 2612 |
| 71 | Ga0070715_10106322 | 3300006163 | Bacteria | 1317 |
| 72 | Ga0075428_100040993 | 3300006844 | Bacteria | 5092 |
| 73 | Ga0075433_10001147 | 3300006852 | Bacteria | 19223 |
| 74 | Ga0075434_100002007 | 3300006871 | Bacteria | 17664 |
| 75 | Ga0075434_100050721 | 3300006871 | Bacteria | 4122 |
| 76 | Ga0075429_100003982 | 3300006880 | Bacteria | 12638 |
| 77 | Ga0075435_100012083 | 3300007076 | Bacteria | 6383 |
| 78 | Ga0075435_100014916 | 3300007076 | Bacteria | 5828 |
| 79 | Ga0105240_10107025 | 3300009093 | Bacteria | 3391 |
| 80 | Ga0114129_10407121 | 3300009147 | Bacteria | 1792 |
| 81 | Ga0105248_10298328 | 3300009177 | Bacteria | 1815 |
| 82 | Ga0105237_10512809 | 3300009545 | Bacteria | 1206 |
| 83 | Ga0105238_10014122 | 3300009551 | Bacteria | 8076 |
| 84 | Ga0157373_10069584 | 3300013100 | Bacteria | 2488 |
| 85 | Ga0157370_10003420 | 3300013104 | Bacteria | 18639 |
| 86 | Ga0157370_10382025 | 3300013104 | Bacteria | 1297 |
| 87 | Ga0157369_10006969 | 3300013105 | Bacteria | 13031 |
| 88 | Ga0157369_10008479 | 3300013105 | Bacteria | 11788 |
| 89 | Ga0157369_10019403 | 3300013105 | Bacteria | 7606 |
| 90 | Ga0157369_10034084 | 3300013105 | Bacteria | 5589 |
| 91 | Ga0157369_10113541 | 3300013105 | Bacteria | 2878 |
| 92 | Ga0157374_10092747 | 3300013296 | Bacteria | 2882 |
| 93 | Ga0157374_10322403 | 3300013296 | Bacteria | 1531 |
| 94 | Ga0157372_10007863 | 3300013307 | Bacteria | 11332 |
| 95 | Ga0157372_10031064 | 3300013307 | Bacteria | 5847 |
| 96 | Ga0157372_10075748 | 3300013307 | Bacteria | 3797 |
| 97 | Ga0157372_10087642 | 3300013307 | Bacteria | 3532 |
| 98 | Ga0206356_10022735 | 3300020070 | Bacteria | 3253 |
| 99 | Ga0206354_10175774 | 3300020081 | Bacteria | 1396 |
| 100 | Ga0206354_10581427 | 3300020081 | Bacteria | 4182 |
| 101 | Ga0206354_11447256 | 3300020081 | Bacteria | 6587 |
| 102 | Ga0206353_11030619 | 3300020082 | Bacteria | 3839 |
| 103 | Ga0206353_11214556 | 3300020082 | Unclassified | 1416 |
| 104 | Ga0206353_11977611 | 3300020082 | Bacteria | 2968 |
| 105 | Ga0207699_10015057 | 3300025906 | Bacteria | 4009 |
| 106 | Ga0207707_10002237 | 3300025912 | Bacteria | 17490 |
| 107 | Ga0207707_10029781 | 3300025912 | Bacteria | 4774 |
| 108 | Ga0207707_10066263 | 3300025912 | Bacteria | 3145 |
| 109 | Ga0207707_10254749 | 3300025912 | Bacteria | 1524 |
| 110 | Ga0207695_10054722 | 3300025913 | Bacteria | 4164 |
| 111 | Ga0207695_10090168 | 3300025913 | Bacteria | 3082 |
| 112 | Ga0207693_10034804 | 3300025915 | Bacteria | 3972 |
| 113 | Ga0207693_10157791 | 3300025915 | Unclassified | 1785 |
| 114 | Ga0207663_10016268 | 3300025916 | Bacteria | 4120 |
| 115 | Ga0207663_10064754 | 3300025916 | Bacteria | 2334 |
| 116 | Ga0207663_10107100 | 3300025916 | Bacteria | 1890 |
| 117 | Ga0207660_10028268 | 3300025917 | Bacteria | 3835 |
| 118 | Ga0207660_10077360 | 3300025917 | Bacteria | 2435 |
| 119 | Ga0207660_10237494 | 3300025917 | Unclassified | 1435 |
| 120 | Ga0207657_10000467 | 3300025919 | Bacteria | 42840 |
| 121 | Ga0207657_10000731 | 3300025919 | Bacteria | 34878 |
| 122 | Ga0207657_10065361 | 3300025919 | Bacteria | 3101 |
| 123 | Ga0207649_10016561 | 3300025920 | Bacteria | 4160 |
| 124 | Ga0207652_10009031 | 3300025921 | Bacteria | 8029 |
| 125 | Ga0207652_10024777 | 3300025921 | Bacteria | 4980 |
| 126 | Ga0207652_10053554 | 3300025921 | Bacteria | 3466 |
| 127 | Ga0207652_10083770 | 3300025921 | Bacteria | 2792 |
| 128 | Ga0207652_10222363 | 3300025921 | Bacteria | 1701 |
| 129 | Ga0207646_10183464 | 3300025922 | Bacteria | 1890 |
| 130 | Ga0207694_10032086 | 3300025924 | Bacteria | 4018 |
| 131 | Ga0207700_10185488 | 3300025928 | Bacteria | 1745 |
| 132 | Ga0207700_10245997 | 3300025928 | Bacteria | 1526 |
| 133 | Ga0207700_10309365 | 3300025928 | Unclassified | 1366 |
| 134 | Ga0207664_10034926 | 3300025929 | Bacteria | 3876 |
| 135 | Ga0207664_10037972 | 3300025929 | Bacteria | 3731 |
| 136 | Ga0207644_10075898 | 3300025931 | Bacteria | 2471 |
| 137 | Ga0207690_10018287 | 3300025932 | Bacteria | 4297 |
| 138 | Ga0207690_10061399 | 3300025932 | Bacteria | 2555 |
| 139 | Ga0207686_10070873 | 3300025934 | Bacteria | 2241 |
| 140 | Ga0207704_10048202 | 3300025938 | Bacteria | 2552 |
| 141 | Ga0207665_10000531 | 3300025939 | Bacteria | 25686 |
| 142 | Ga0207661_10047236 | 3300025944 | Bacteria | 3417 |
| 143 | Ga0207661_10101674 | 3300025944 | Bacteria | 2415 |
| 144 | Ga0207661_10104772 | 3300025944 | Bacteria | 2382 |
| 145 | Ga0207667_10038319 | 3300025949 | Bacteria | 5121 |
| 146 | Ga0207667_10105337 | 3300025949 | Bacteria | 2909 |
| 147 | Ga0207658_10003739 | 3300025986 | Bacteria | 10717 |
| 148 | Ga0207678_10127710 | 3300026067 | Unclassified | 2169 |
| 149 | Ga0207702_10007044 | 3300026078 | Bacteria | 9621 |
| 150 | Ga0207702_10042476 | 3300026078 | Bacteria | 3814 |
| 151 | Ga0207702_10513825 | 3300026078 | Bacteria | 1169 |
| 152 | Ga0207674_10011546 | 3300026116 | Bacteria | 9921 |
| 153 | Ga0207674_10055705 | 3300026116 | Bacteria | 4018 |
| 154 | Ga0207683_10142744 | 3300026121 | Bacteria | 2158 |
| 155 | Ga0207698_10018955 | 3300026142 | Bacteria | 4699 |
| 156 | Ga0207698_10029652 | 3300026142 | Bacteria | 3922 |
| 157 | Ga0268266_10047011 | 3300028379 | Bacteria | 3695 |
| 158 | Ga0265318_10014377 | 3300028577 | Bacteria | 3325 |
| 159 | Ga0265322_10008664 | 3300028654 | Bacteria | 2963 |
| 160 | Ga0265336_10003729 | 3300028666 | Bacteria | 5902 |
| 161 | Ga0265338_10141443 | 3300028800 | Bacteria | 1884 |
| 162 | Ga0265328_10065540 | 3300031239 | Bacteria | 1334 |
| 163 | Ga0265340_10006557 | 3300031247 | Bacteria | 6396 |
| 164 | Ga0265340_10074968 | 3300031247 | Bacteria | 1599 |
| 165 | Ga0265339_10015134 | 3300031249 | Bacteria | 4633 |
| 166 | Ga0265331_10075867 | 3300031250 | Bacteria | 1567 |
| 167 | Ga0265327_10007446 | 3300031251 | Bacteria | 8445 |
| 168 | Ga0265327_10009577 | 3300031251 | Bacteria | 6964 |
| 169 | Ga0265327_10050128 | 3300031251 | Bacteria | 2186 |
| 170 | Ga0265316_10009243 | 3300031344 | Bacteria | 9075 |
| 171 | Ga0265313_10022260 | 3300031595 | Bacteria | 3443 |
| 172 | Ga0265314_10044508 | 3300031711 | Bacteria | 3146 |
| 173 | Ga0265342_10043851 | 3300031712 | Bacteria | 2697 |
| 174 | Ga0307416_100055927 | 3300032002 | Bacteria | 3180 |
| 175 | Ga0373944_0049142 | 3300035089 | Bacteria | 1325 |
| 176 | Ga0373936_0032440 | 3300035113 | Unclassified | 2066 |
| 177 | Ga0373936_0043521 | 3300035113 | Bacteria | 1805 |
| 178 | Ga0373945_0014480 | 3300035116 | Bacteria | 2643 |
| 179 | Ga0373943_0000703 | 3300035170 | Bacteria | 14614 |
| 180 | Ga0373943_0006660 | 3300035170 | Bacteria | 5181 |
| 181 | Ga0373943_0010455 | 3300035170 | Bacteria | 4158 |
| 182 | Ga0373946_0003486 | 3300035171 | Bacteria | 5580 |
| 183 | Ga0373946_0014017 | 3300035171 | Bacteria | 3019 |
| 184 | Ga0373935_0007648 | 3300035692 | Bacteria | 6476 |
| 185 | Ga0373947_0002323 | 3300035725 | Bacteria | 11501 |
| 186 | Ga0373947_0002946 | 3300035725 | Bacteria | 10155 |
| 187 | Ga0373947_0008902 | 3300035725 | Bacteria | 5772 |
| 188 | Ga0373947_0012264 | 3300035725 | Bacteria | 4910 |
| 189 | Ga0373937_0390535 | 3300036401 | Bacteria | 1320 |
| 190 | Ga0373925_0001856 | 3300037068 | Bacteria | 17583 |
| 191 | Ga0373925_0005408 | 3300037068 | Bacteria | 9516 |
| 192 | Ga0395899_0002477 | 3300037312 | Bacteria | 14979 |
| 193 | Ga0395899_0168036 | 3300037312 | Bacteria | 1546 |
| 194 | Ga0395900_0003203 | 3300037418 | Bacteria | 17718 |
| 195 | Ga0395900_0087259 | 3300037418 | Bacteria | 3207 |
| 196 | Ga0395900_0125786 | 3300037418 | Bacteria | 2629 |
| 197 | Ga0395900_0146539 | 3300037418 | Bacteria | 2414 |
| 198 | Ga0395898_0010794 | 3300037466 | Bacteria | 9542 |
| 199 | Ga0395898_0036815 | 3300037466 | Bacteria | 4856 |
| 200 | Ga0395898_0038426 | 3300037466 | Bacteria | 4744 |
| 201 | Ga0395905_0000568 | 3300037471 | Bacteria | 50013 |
| 202 | Ga0395905_0105509 | 3300037471 | Bacteria | 2646 |
| 203 | Ga0395905_0105893 | 3300037471 | Bacteria | 2641 |
| 204 | Ga0395905_0229221 | 3300037471 | Bacteria | 1737 |
| 205 | Ga0395901_0012951 | 3300038443 | Bacteria | 8460 |
| 206 | Ga0395901_0036295 | 3300038443 | Bacteria | 5093 |
| 207 | Ga0395901_0039112 | 3300038443 | Bacteria | 4907 |
| 208 | Ga0395901_0061179 | 3300038443 | Bacteria | 3918 |
| 209 | Ga0395901_0198002 | 3300038443 | Bacteria | 2106 |
| 210 | Ga0395901_0208489 | 3300038443 | Bacteria | 2046 |
| 211 | Ga0436365_0541924 | 3300039437 | Unclassified | 1536 |
| 212 | Ga0436365_1025500 | 3300039437 | Bacteria | 2141 |
| 213 | Ga0436363_0811128 | 3300039450 | Bacteria | 1660 |
| 214 | Ga0466965_0039661 | 3300044683 | Bacteria | 2316 |
| 215 | Ga0466966_0077844 | 3300044684 | Bacteria | 2069 |
| 216 | Ga0466963_0000743 | 3300044694 | Bacteria | 16069 |
| 217 | Ga0466963_0002011 | 3300044694 | Bacteria | 11172 |
| 218 | Ga0466963_0002261 | 3300044694 | Bacteria | 10700 |
| 219 | Ga0466963_0005306 | 3300044694 | Bacteria | 7532 |
| 220 | Ga0466963_0022081 | 3300044694 | Bacteria | 4026 |
| 221 | Ga0466963_0037996 | 3300044694 | Bacteria | 3147 |
| 222 | Ga0466963_0038129 | 3300044694 | Bacteria | 3141 |
| 223 | Ga0466963_0085099 | 3300044694 | Bacteria | 2146 |
| 224 | Ga0466963_0188349 | 3300044694 | Bacteria | 1441 |
| 225 | Ga0466963_0190337 | 3300044694 | Bacteria | 1433 |
| 226 | Ga0466964_0001166 | 3300044706 | Bacteria | 8883 |
| 227 | Ga0466964_0002975 | 3300044706 | Bacteria | 6131 |
| 228 | Ga0466964_0007927 | 3300044706 | Bacteria | 3978 |
| 229 | Ga0466971_0000910 | 3300044719 | Bacteria | 12117 |
| 230 | Ga0466971_0073826 | 3300044719 | Bacteria | 1550 |
| 231 | Ga0466968_0025750 | 3300044735 | Bacteria | 2411 |
| 232 | Ga0466968_0082805 | 3300044735 | Unclassified | 1412 |
| 233 | Ga0466957_0000349 | 3300044842 | Bacteria | 22576 |
| 234 | Ga0466957_0165701 | 3300044842 | Bacteria | 1437 |
| 235 | Ga0466959_0024411 | 3300045049 | Bacteria | 4478 |
| 236 | Ga0466959_0037515 | 3300045049 | Bacteria | 3581 |
| 237 | Ga0466959_0040059 | 3300045049 | Bacteria | 3462 |
| 238 | Ga0466959_0220180 | 3300045049 | Bacteria | 1317 |
| 239 | Ga0466958_0000685 | 3300045836 | Bacteria | 14737 |
| 240 | Ga0466958_0008053 | 3300045836 | Bacteria | 5828 |
| 241 | Ga0466958_0041111 | 3300045836 | Bacteria | 2780 |
| 242 | Ga0466958_0045639 | 3300045836 | Bacteria | 2644 |
| 243 | Ga0466958_0103287 | 3300045836 | Bacteria | 1774 |
| 244 | Ga0466967_0000265 | 3300045976 | Bacteria | 23015 |
| 245 | Ga0466967_0001447 | 3300045976 | Bacteria | 13783 |
| 246 | Ga0466967_0003034 | 3300045976 | Bacteria | 10777 |
| 247 | Ga0466967_0020418 | 3300045976 | Bacteria | 5354 |
| 248 | Ga0466967_0027269 | 3300045976 | Bacteria | 4749 |
| 249 | Ga0466967_0029029 | 3300045976 | Bacteria | 4624 |
| 250 | Ga0466967_0030138 | 3300045976 | Bacteria | 4550 |
| 251 | Ga0466967_0039010 | 3300045976 | Bacteria | 4079 |
| 252 | Ga0466967_0076865 | 3300045976 | Bacteria | 3004 |
| 253 | Ga0466967_0088367 | 3300045976 | Bacteria | 2812 |
| 254 | Ga0466967_0090581 | 3300045976 | Bacteria | 2778 |
| 255 | Ga0466967_0091674 | 3300045976 | Bacteria | 2762 |
| 256 | Ga0466967_0097322 | 3300045976 | Bacteria | 2686 |
| 257 | Ga0466967_0103428 | 3300045976 | Bacteria | 2606 |
| 258 | Ga0466967_0320404 | 3300045976 | Unclassified | 1495 |
| 259 | Ga0466967_0421908 | 3300045976 | Bacteria | 1300 |
| 260 | Ga0495592_0120855 | 3300046454 | Bacteria | 1843 |
| 261 | Ga0495592_0181366 | 3300046454 | Bacteria | 1434 |
| 262 | Ga0495603_0052007 | 3300046455 | Bacteria | 2433 |
| 263 | Ga0495629_0000880 | 3300046459 | Bacteria | 24212 |
| 264 | Ga0495629_0005900 | 3300046459 | Bacteria | 9128 |
| 265 | Ga0495629_0019051 | 3300046459 | Bacteria | 4907 |
| 266 | Ga0495629_0024608 | 3300046459 | Bacteria | 4286 |
| 267 | Ga0495629_0040376 | 3300046459 | Bacteria | 3282 |
| 268 | Ga0495641_0000552 | 3300046461 | Bacteria | 31604 |
| 269 | Ga0495641_0010756 | 3300046461 | Bacteria | 5269 |
| 270 | Ga0495651_0036649 | 3300046462 | Bacteria | 3818 |
| 271 | Ga0495651_0042661 | 3300046462 | Bacteria | 3521 |
| 272 | Ga0495653_0004479 | 3300046463 | Bacteria | 11279 |
| 273 | Ga0495653_0041472 | 3300046463 | Bacteria | 3592 |
| 274 | Ga0495580_0040093 | 3300046472 | Bacteria | 3348 |
| 275 | Ga0495582_0000240 | 3300046473 | Bacteria | 30558 |
| 276 | Ga0495582_0002155 | 3300046473 | Bacteria | 11012 |
| 277 | Ga0495582_0049297 | 3300046473 | Bacteria | 2319 |
| 278 | Ga0495639_0004699 | 3300046475 | Bacteria | 5868 |
| 279 | Ga0495639_0006485 | 3300046475 | Bacteria | 5031 |
| 280 | Ga0495662_0000631 | 3300046476 | Bacteria | 16407 |
| 281 | Ga0495662_0001469 | 3300046476 | Bacteria | 11662 |
| 282 | Ga0495664_0073616 | 3300046477 | Bacteria | 2042 |
| 283 | Ga0495664_0078272 | 3300046477 | Bacteria | 1980 |
| 284 | Ga0495594_0065647 | 3300046499 | Bacteria | 2013 |
| 285 | Ga0495596_0069181 | 3300046500 | Bacteria | 1372 |
| 286 | Ga0495608_0018577 | 3300046511 | Bacteria | 4792 |
| 287 | Ga0495608_0019392 | 3300046511 | Bacteria | 4680 |
| 288 | Ga0495618_0007052 | 3300046514 | Bacteria | 6802 |
| 289 | Ga0495628_0096663 | 3300046516 | Bacteria | 2282 |
| 290 | Ga0495628_0205377 | 3300046516 | Bacteria | 1483 |
| 291 | Ga0495630_0001891 | 3300046517 | Bacteria | 14594 |
| 292 | Ga0495630_0007883 | 3300046517 | Bacteria | 7636 |
| 293 | Ga0495630_0017389 | 3300046517 | Bacteria | 5267 |
| 294 | Ga0495630_0034360 | 3300046517 | Bacteria | 3786 |
| 295 | Ga0495630_0056464 | 3300046517 | Bacteria | 2942 |
| 296 | Ga0495666_0000169 | 3300046526 | Bacteria | 27666 |
| 297 | Ga0495666_0007316 | 3300046526 | Bacteria | 5536 |
| 298 | Ga0495652_0006606 | 3300046529 | Bacteria | 10774 |
| 299 | Ga0495665_0000685 | 3300046531 | Bacteria | 17384 |
| 300 | Ga0495665_0006818 | 3300046531 | Bacteria | 6162 |
| 301 | Ga0495665_0118339 | 3300046531 | Bacteria | 1388 |
| 302 | Ga0495640_0007017 | 3300046533 | Bacteria | 8866 |
| 303 | Ga0495640_0011644 | 3300046533 | Bacteria | 6756 |
| 304 | Ga0495640_0062648 | 3300046533 | Bacteria | 2522 |
| 305 | Ga0495640_0121200 | 3300046533 | Bacteria | 1700 |
| 306 | Ga0495586_0001729 | 3300046535 | Bacteria | 11922 |
| 307 | Ga0495586_0006318 | 3300046535 | Bacteria | 6330 |
| 308 | Ga0495645_0028912 | 3300046543 | Bacteria | 4029 |
| 309 | Ga0495667_0030843 | 3300046559 | Bacteria | 3601 |
| 310 | Ga0495667_0081589 | 3300046559 | Bacteria | 2102 |
| 311 | Ga0495667_0118683 | 3300046559 | Bacteria | 1708 |
| 312 | Ga0495656_0006186 | 3300046615 | Bacteria | 4188 |
| 313 | Ga0495634_0003944 | 3300046642 | Bacteria | 11778 |
| 314 | Ga0495634_0013945 | 3300046642 | Bacteria | 5808 |
| 315 | Ga0495634_0037770 | 3300046642 | Bacteria | 3297 |
| 316 | Ga0495635_0007519 | 3300046663 | Bacteria | 7602 |
| 317 | Ga0495599_0099622 | 3300046678 | Unclassified | 1811 |
| 318 | Ga0495647_0000214 | 3300046681 | Bacteria | 15610 |
| 319 | Ga0495647_0045891 | 3300046681 | Bacteria | 1681 |
| 320 | Ga0495658_0000272 | 3300046683 | Bacteria | 29389 |
| 321 | Ga0495658_0000782 | 3300046683 | Bacteria | 17147 |
| 322 | Ga0495658_0178670 | 3300046683 | Bacteria | 1316 |
| 323 | Ga0495613_0003786 | 3300046689 | Bacteria | 11339 |
| 324 | Ga0495613_0005472 | 3300046689 | Bacteria | 9538 |
| 325 | Ga0495613_0015795 | 3300046689 | Bacteria | 5620 |
| 326 | Ga0495613_0028196 | 3300046689 | Bacteria | 4177 |
| 327 | Ga0495624_0000454 | 3300046690 | Bacteria | 32267 |
| 328 | Ga0495624_0009739 | 3300046690 | Bacteria | 6648 |
| 329 | Ga0495600_0001921 | 3300046809 | Bacteria | 11663 |
| 330 | Ga0495581_0000754 | 3300047315 | Bacteria | 17163 |
| 331 | Ga0495581_0002824 | 3300047315 | Bacteria | 9927 |
| 332 | Ga0495581_0052011 | 3300047315 | Bacteria | 2366 |
| 333 | Ga0495604_0094257 | 3300047317 | Bacteria | 2213 |
| 334 | Ga0495604_0130763 | 3300047317 | Bacteria | 1805 |
| 335 | Ga0495604_0147667 | 3300047317 | Bacteria | 1674 |
| 336 | Ga0495674_0001969 | 3300047319 | Bacteria | 20234 |
| 337 | Ga0495674_0061472 | 3300047319 | Bacteria | 3273 |
| 338 | Ga0495674_0063438 | 3300047319 | Bacteria | 3214 |
| 339 | Ga0495676_0000116 | 3300047321 | Bacteria | 61181 |
| 340 | Ga0495676_0009601 | 3300047321 | Bacteria | 8808 |
| 341 | Ga0495680_0001092 | 3300047322 | Bacteria | 30065 |
| 342 | Ga0495680_0007595 | 3300047322 | Bacteria | 9909 |
| 343 | Ga0495680_0015852 | 3300047322 | Bacteria | 6487 |
| 344 | Ga0495680_0019294 | 3300047322 | Bacteria | 5761 |
| 345 | Ga0495680_0116849 | 3300047322 | Bacteria | 1972 |
| 346 | Ga0495684_0019534 | 3300047471 | Bacteria | 5219 |
| 347 | Ga0495684_0035612 | 3300047471 | Bacteria | 3816 |
| 348 | Ga0495684_0128333 | 3300047471 | Bacteria | 1906 |
| 349 | Ga0495593_0000504 | 3300047673 | Bacteria | 22038 |
| 350 | Ga0495593_0011497 | 3300047673 | Bacteria | 5082 |
| 351 | Ga0495602_0073218 | 3300048088 | Bacteria | 2917 |
| 352 | Ga0495602_0157320 | 3300048088 | Bacteria | 1778 |
| 353 | Ga0495614_0000711 | 3300048089 | Bacteria | 14036 |
| 354 | Ga0495614_0050118 | 3300048089 | Bacteria | 1789 |
| 355 | Ga0496100_0003870 | 3300048903 | Bacteria | 7855 |
| 356 | Ga0496100_0004075 | 3300048903 | Bacteria | 7705 |
| 357 | Ga0496100_0012535 | 3300048903 | Bacteria | 4863 |
| 358 | Ga0496100_0067326 | 3300048903 | Bacteria | 2378 |
| 359 | Ga0496101_0004080 | 3300048904 | Bacteria | 9136 |
| 360 | Ga0496101_0017786 | 3300048904 | Bacteria | 4824 |
| 361 | Ga0496101_0030729 | 3300048904 | Bacteria | 3769 |
| 362 | Ga0496101_0045591 | 3300048904 | Bacteria | 3141 |
| 363 | Ga0496101_0046772 | 3300048904 | Bacteria | 3104 |
| 364 | Ga0496101_0071160 | 3300048904 | Bacteria | 2549 |
| 365 | Ga0496102_0004317 | 3300048905 | Bacteria | 12023 |
| 366 | Ga0496102_0093619 | 3300048905 | Bacteria | 2784 |
| 367 | Ga0496103_0019241 | 3300048906 | Bacteria | 4100 |
| 368 | Ga0496104_0000319 | 3300048907 | Bacteria | 42768 |
| 369 | Ga0496104_0002950 | 3300048907 | Bacteria | 14659 |
| 370 | Ga0496104_0033278 | 3300048907 | Bacteria | 4801 |
| 371 | Ga0496104_0115739 | 3300048907 | Bacteria | 2572 |
| 372 | Ga0496104_0265960 | 3300048907 | Bacteria | 1627 |
| 373 | Ga0496105_0000194 | 3300048908 | Bacteria | 40666 |
| 374 | Ga0496105_0006495 | 3300048908 | Bacteria | 8989 |
| 375 | Ga0496105_0029002 | 3300048908 | Bacteria | 4528 |
| 376 | Ga0496105_0068171 | 3300048908 | Bacteria | 2938 |
| 377 | Ga0496105_0242168 | 3300048908 | Unclassified | 1463 |
| 378 | Ga0496106_0007207 | 3300048909 | Bacteria | 8214 |
| 379 | Ga0496106_0022319 | 3300048909 | Bacteria | 4701 |
| 380 | Ga0496106_0035961 | 3300048909 | Bacteria | 3704 |
| 381 | Ga0496107_0005507 | 3300048910 | Bacteria | 8665 |
| 382 | Ga0496107_0097619 | 3300048910 | Bacteria | 2151 |
| 383 | Ga0496107_0108987 | 3300048910 | Bacteria | 2034 |
| 384 | Ga0496108_0000971 | 3300048911 | Bacteria | 22338 |
| 385 | Ga0496108_0006063 | 3300048911 | Bacteria | 9776 |
| 386 | Ga0496108_0115730 | 3300048911 | Bacteria | 2296 |
| 387 | Ga0496109_0001518 | 3300048912 | Bacteria | 19311 |
| 388 | Ga0496109_0005058 | 3300048912 | Bacteria | 11014 |
| 389 | Ga0496110_0000757 | 3300048913 | Bacteria | 22349 |
| 390 | Ga0496110_0002108 | 3300048913 | Bacteria | 14845 |
| 391 | Ga0496110_0167225 | 3300048913 | Bacteria | 1994 |
| 392 | Ga0496111_0000359 | 3300048914 | Bacteria | 22584 |
| 393 | Ga0496111_0034872 | 3300048914 | Bacteria | 3594 |
| 394 | Ga0496111_0059920 | 3300048914 | Bacteria | 2758 |
| 395 | Ga0496111_0069480 | 3300048914 | Bacteria | 2561 |
| 396 | Ga0496112_0009458 | 3300048915 | Bacteria | 8784 |
| 397 | Ga0496112_0355826 | 3300048915 | Unclassified | 1406 |
| 398 | Ga0496113_0024554 | 3300048916 | Bacteria | 4285 |
| 399 | Ga0496114_0010899 | 3300048917 | Bacteria | 7243 |
| 400 | Ga0496114_0024067 | 3300048917 | Bacteria | 4969 |
| 401 | Ga0496114_0051933 | 3300048917 | Bacteria | 3414 |
| 402 | Ga0496114_0105052 | 3300048917 | Unclassified | 2415 |
| 403 | Ga0496114_0140366 | 3300048917 | Bacteria | 2091 |
| 404 | Ga0496115_0000431 | 3300048918 | Bacteria | 33991 |
| 405 | Ga0496115_0003315 | 3300048918 | Bacteria | 11559 |
| 406 | Ga0496115_0006946 | 3300048918 | Bacteria | 8319 |
| 407 | Ga0496115_0010047 | 3300048918 | Bacteria | 7055 |
| 408 | Ga0496115_0043294 | 3300048918 | Bacteria | 3590 |
| 409 | Ga0496115_0043866 | 3300048918 | Bacteria | 3566 |
| 410 | Ga0496115_0080110 | 3300048918 | Bacteria | 2659 |
| 411 | Ga0501031_0032650 | 3300049568 | Bacteria | 3394 |
| 412 | Ga0501036_0092450 | 3300049572 | Bacteria | 2555 |
| 413 | Ga0501039_0098372 | 3300049575 | Bacteria | 2282 |
| 414 | Ga0501041_0011624 | 3300049577 | Bacteria | 5210 |
| 415 | Ga0501042_0049994 | 3300049578 | Bacteria | 2982 |
| 416 | Ga0501046_0123402 | 3300049580 | Bacteria | 1969 |
| 417 | Ga0501047_0030861 | 3300049581 | Bacteria | 5167 |
| 418 | Ga0501047_0066004 | 3300049581 | Bacteria | 3488 |
| 419 | Ga0501047_0106973 | 3300049581 | Bacteria | 2678 |
| 420 | Ga0501067_0000208 | 3300049583 | Bacteria | 32744 |
| 421 | Ga0501069_0058073 | 3300049585 | Bacteria | 2158 |
| 422 | Ga0501069_0060983 | 3300049585 | Bacteria | 2106 |
| 423 | Ga0501069_0080303 | 3300049585 | Bacteria | 1837 |
| 424 | Ga0501070_0000499 | 3300049586 | Bacteria | 35735 |
| 425 | Ga0501071_0055002 | 3300049587 | Bacteria | 2872 |
| 426 | Ga0501073_0146944 | 3300049589 | Bacteria | 1634 |
| 427 | Ga0501074_0024071 | 3300049590 | Bacteria | 4425 |
| 428 | Ga0501075_0061915 | 3300049591 | Bacteria | 2820 |
| 429 | Ga0501079_0001382 | 3300049741 | Bacteria | 17096 |
| 430 | Ga0501080_0020932 | 3300049742 | Bacteria | 6053 |
| 431 | Ga0501080_0047731 | 3300049742 | Bacteria | 3987 |
| 432 | Ga0501081_0067478 | 3300049743 | Bacteria | 2490 |
| 433 | Ga0501081_0237672 | 3300049743 | Bacteria | 1328 |
| 434 | Ga0501083_0131519 | 3300049744 | Bacteria | 1641 |
| 435 | Ga0501044_0122443 | 3300049823 | Bacteria | 2601 |
| 436 | nmdc:mga05p37_172096_c1 | 3300050507 | Bacteria | 2641 |
| 437 | nmdc:mga0n895_163012_c1 | 3300050512 | Bacteria | 2261 |
| 438 | nmdc:mga0a205_5451_c1 | 3300050515 | Bacteria | 11462 |
| 439 | Ga0495601_0002006 | 3300053077 | Bacteria | 11425 |
| 440 | Ga0495601_0052603 | 3300053077 | Bacteria | 2572 |
| 441 | Ga0495601_0076567 | 3300053077 | Bacteria | 2142 |
| 442 | Ga0495595_0010409 | 3300053084 | Bacteria | 3865 |
| 443 | Ga0495595_0071900 | 3300053084 | Bacteria | 1636 |
| 444 | Ga0495619_0027625 | 3300053085 | Bacteria | 3656 |
| 445 | Ga0495619_0033979 | 3300053085 | Unclassified | 3313 |
| 446 | Ga0495619_0092659 | 3300053085 | Bacteria | 2047 |
| 447 | Ga0495619_0124252 | 3300053085 | Bacteria | 1770 |
| 448 | Ga0500566_0033743 | 3300053094 | Bacteria | 2980 |
| 449 | Ga0501084_0082365 | 3300054114 | Bacteria | 2700 |
| 450 | Ga0501084_0197706 | 3300054114 | Bacteria | 1696 |
| 451 | Ga0501082_0086281 | 3300060353 | Bacteria | 2707 |
| 452 | Ga0466962_0000178 | 3300061719 | Bacteria | 26342 |
| 453 | Ga0466962_0010222 | 3300061719 | Bacteria | 4507 |
| 454 | Ga0466962_0016127 | 3300061719 | Bacteria | 3604 |
| 455 | Ga0530510_0107626 | 3300061734 | Bacteria | 2040 |
| 456 | Ga0530510_0281462 | 3300061734 | Bacteria | 1242 |
| 457 | Ga0207644_10068276 | |||
| 458 | Ga0070658_10015384 | |||
| 459 | Ga0070658_10184449 | |||
| 460 | Ga0070683_100014995 | |||
| 461 | Ga0070683_100105107 | |||
| 462 | Ga0070680_100013349 | |||
| 463 | Ga0070680_100024285 | |||
| 464 | Ga0070680_100101778 | |||
| 465 | Ga0070680_100150544 | |||
| 466 | Ga0070680_100296368 | |||
| 467 | Ga0070660_100001227 | |||
| 468 | Ga0070660_100026510 | |||
| 469 | Ga0070660_100028819 | |||
| 470 | Ga0070661_100022246 | |||
| 471 | Ga0070661_100039091 | |||
| 472 | Ga0070661_100050751 | |||
| 473 | Ga0070675_100363884 | |||
| 474 | Ga0070671_100160291 | |||
| 475 | Ga0070659_100069597 | |||
| 476 | Ga0070659_100086112 | |||
| 477 | Ga0070667_100004251 | |||
| 478 | Ga0070709_10138614 | |||
| 479 | Ga0070709_10180964 | |||
| 480 | Ga0070709_10194746 | |||
| 481 | Ga0070714_100019427 | |||
| 482 | Ga0070714_100152369 | |||
| 483 | Ga0070714_100254437 | |||
| 484 | Ga0070714_100275395 | |||
| 485 | Ga0070713_100083931 | |||
| 486 | Ga0070713_100179467 | |||
| 487 | Ga0070713_100357398 | |||
| 488 | Ga0070711_100003366 | |||
| 489 | Ga0070708_100015571 | |||
| 490 | Ga0070681_10003001 | |||
| 491 | Ga0070681_10004205 | |||
| 492 | Ga0070681_10023456 | |||
| 493 | Ga0070681_10053124 | |||
| 494 | Ga0070681_10074508 | |||
| 495 | Ga0070681_10089866 | |||
| 496 | Ga0070681_10111881 | |||
| 497 | Ga0070681_10133580 | |||
| 498 | Ga0070706_100162351 | |||
| 499 | Ga0070707_100070522 | |||
| 500 | Ga0070679_100002041 | |||
| 501 | Ga0070679_100032695 | |||
| 502 | Ga0070684_100014526 | |||
| 503 | Ga0070684_100021918 | |||
| 504 | Ga0070684_100115095 | |||
| 505 | Ga0070684_100133701 | |||
| 506 | Ga0070696_100014265 | |||
| 507 | Ga0070696_100042426 | |||
| 508 | Ga0070693_100023529 | |||
| 509 | Ga0070665_100004675 | |||
| 510 | Ga0068855_100005572 | |||
| 511 | Ga0068855_100104746 | |||
| 512 | Ga0068855_100107460 | |||
| 513 | Ga0068855_100242878 | |||
| 514 | Ga0068857_100045053 | |||
| 515 | Ga0068856_100030718 | |||
| 516 | Ga0068856_100073868 | |||
| 517 | Ga0068852_100008920 | |||
| 518 | Ga0068852_100031361 | |||
| 519 | Ga0068852_100230865 | |||
| 520 | Ga0081455_10032713 | |||
| 521 | Ga0081455_10050766 | |||
| 522 | Ga0081539_10001235 | |||
| 523 | Ga0081539_10003115 | |||
| 524 | Ga0070717_10005143 | |||
| 525 | Ga0070717_10081125 | |||
| 526 | Ga0070717_10088324 | |||
| 527 | Ga0070715_10106322 | |||
| 528 | Ga0075428_100040993 | |||
| 529 | Ga0075433_10001147 | |||
| 530 | Ga0075434_100002007 | |||
| 531 | Ga0075434_100050721 | |||
| 532 | Ga0075429_100003982 | |||
| 533 | Ga0075435_100012083 | |||
| 534 | Ga0075435_100014916 | |||
| 535 | Ga0105240_10107025 | |||
| 536 | Ga0114129_10407121 | |||
| 537 | Ga0105248_10298328 | |||
| 538 | Ga0105237_10512809 | |||
| 539 | Ga0105238_10014122 | |||
| 540 | Ga0157373_10069584 | |||
| 541 | Ga0157370_10003420 | |||
| 542 | Ga0157370_10382025 | |||
| 543 | Ga0157369_10006969 | |||
| 544 | Ga0157369_10008479 | |||
| 545 | Ga0157369_10019403 | |||
| 546 | Ga0157369_10034084 | |||
| 547 | Ga0157369_10113541 | |||
| 548 | Ga0157374_10092747 | |||
| 549 | Ga0157374_10322403 | |||
| 550 | Ga0157372_10007863 | |||
| 551 | Ga0157372_10031064 | |||
| 552 | Ga0157372_10075748 | |||
| 553 | Ga0157372_10087642 | |||
| 554 | Ga0206356_10022735 | |||
| 555 | Ga0206354_10175774 | |||
| 556 | Ga0206354_10581427 | |||
| 557 | Ga0206354_11447256 | |||
| 558 | Ga0206353_11030619 | |||
| 559 | Ga0206353_11214556 | |||
| 560 | Ga0206353_11977611 | |||
| 561 | Ga0207699_10015057 | |||
| 562 | Ga0207707_10002237 | |||
| 563 | Ga0207707_10029781 | |||
| 564 | Ga0207707_10066263 | |||
| 565 | Ga0207707_10254749 | |||
| 566 | Ga0207695_10054722 | |||
| 567 | Ga0207695_10090168 | |||
| 568 | Ga0207693_10034804 | |||
| 569 | Ga0207693_10157791 | |||
| 570 | Ga0207663_10016268 | |||
| 571 | Ga0207663_10064754 | |||
| 572 | Ga0207663_10107100 | |||
| 573 | Ga0207660_10028268 | |||
| 574 | Ga0207660_10077360 | |||
| 575 | Ga0207660_10237494 | |||
| 576 | Ga0207657_10000467 | |||
| 577 | Ga0207657_10000731 | |||
| 578 | Ga0207657_10065361 | |||
| 579 | Ga0207649_10016561 | |||
| 580 | Ga0207652_10009031 | |||
| 581 | Ga0207652_10024777 | |||
| 582 | Ga0207652_10053554 | |||
| 583 | Ga0207652_10083770 | |||
| 584 | Ga0207652_10222363 | |||
| 585 | Ga0207646_10183464 | |||
| 586 | Ga0207694_10032086 | |||
| 587 | Ga0207700_10185488 | |||
| 588 | Ga0207700_10245997 | |||
| 589 | Ga0207700_10309365 | |||
| 590 | Ga0207664_10034926 | |||
| 591 | Ga0207664_10037972 | |||
| 592 | Ga0207644_10075898 | |||
| 593 | Ga0207690_10018287 | |||
| 594 | Ga0207690_10061399 | |||
| 595 | Ga0207686_10070873 | |||
| 596 | Ga0207704_10048202 | |||
| 597 | Ga0207665_10000531 | |||
| 598 | Ga0207661_10047236 | |||
| 599 | Ga0207661_10101674 | |||
| 600 | Ga0207661_10104772 | |||
| 601 | Ga0207667_10038319 | |||
| 602 | Ga0207667_10105337 | |||
| 603 | Ga0207658_10003739 | |||
| 604 | Ga0207678_10127710 | |||
| 605 | Ga0207702_10007044 | |||
| 606 | Ga0207702_10042476 | |||
| 607 | Ga0207702_10513825 | |||
| 608 | Ga0207674_10011546 | |||
| 609 | Ga0207674_10055705 | |||
| 610 | Ga0207683_10142744 | |||
| 611 | Ga0207698_10018955 | |||
| 612 | Ga0207698_10029652 | |||
| 613 | Ga0268266_10047011 | |||
| 614 | Ga0265318_10014377 | |||
| 615 | Ga0265322_10008664 | |||
| 616 | Ga0265336_10003729 | |||
| 617 | Ga0265338_10141443 | |||
| 618 | Ga0265328_10065540 | |||
| 619 | Ga0265340_10006557 | |||
| 620 | Ga0265340_10074968 | |||
| 621 | Ga0265339_10015134 | |||
| 622 | Ga0265331_10075867 | |||
| 623 | Ga0265327_10007446 | |||
| 624 | Ga0265327_10009577 | |||
| 625 | Ga0265327_10050128 | |||
| 626 | Ga0265316_10009243 | |||
| 627 | Ga0265313_10022260 | |||
| 628 | Ga0265314_10044508 | |||
| 629 | Ga0265342_10043851 | |||
| 630 | Ga0307416_100055927 | |||
| 631 | Ga0373944_0049142 | |||
| 632 | Ga0373936_0032440 | |||
| 633 | Ga0373936_0043521 | |||
| 634 | Ga0373945_0014480 | |||
| 635 | Ga0373943_0000703 | |||
| 636 | Ga0373943_0006660 | |||
| 637 | Ga0373943_0010455 | |||
| 638 | Ga0373946_0003486 | |||
| 639 | Ga0373946_0014017 | |||
| 640 | Ga0373935_0007648 | |||
| 641 | Ga0373947_0002323 | |||
| 642 | Ga0373947_0002946 | |||
| 643 | Ga0373947_0008902 | |||
| 644 | Ga0373947_0012264 | |||
| 645 | Ga0373937_0390535 | |||
| 646 | Ga0373925_0001856 | |||
| 647 | Ga0373925_0005408 | |||
| 648 | Ga0395899_0002477 | |||
| 649 | Ga0395899_0168036 | |||
| 650 | Ga0395900_0003203 | |||
| 651 | Ga0395900_0087259 | |||
| 652 | Ga0395900_0125786 | |||
| 653 | Ga0395900_0146539 | |||
| 654 | Ga0395898_0010794 | |||
| 655 | Ga0395898_0036815 | |||
| 656 | Ga0395898_0038426 | |||
| 657 | Ga0395905_0000568 | |||
| 658 | Ga0395905_0105509 | |||
| 659 | Ga0395905_0105893 | |||
| 660 | Ga0395905_0229221 | |||
| 661 | Ga0395901_0012951 | |||
| 662 | Ga0395901_0036295 | |||
| 663 | Ga0395901_0039112 | |||
| 664 | Ga0395901_0061179 | |||
| 665 | Ga0395901_0198002 | |||
| 666 | Ga0395901_0208489 | |||
| 667 | Ga0436365_0541924 | |||
| 668 | Ga0436365_1025500 | |||
| 669 | Ga0436363_0811128 | |||
| 670 | Ga0466965_0039661 | |||
| 671 | Ga0466966_0077844 | |||
| 672 | Ga0466963_0000743 | |||
| 673 | Ga0466963_0002011 | |||
| 674 | Ga0466963_0002261 | |||
| 675 | Ga0466963_0005306 | |||
| 676 | Ga0466963_0022081 | |||
| 677 | Ga0466963_0037996 | |||
| 678 | Ga0466963_0038129 | |||
| 679 | Ga0466963_0085099 | |||
| 680 | Ga0466963_0188349 | |||
| 681 | Ga0466963_0190337 | |||
| 682 | Ga0466964_0001166 | |||
| 683 | Ga0466964_0002975 | |||
| 684 | Ga0466964_0007927 | |||
| 685 | Ga0466971_0000910 | |||
| 686 | Ga0466971_0073826 | |||
| 687 | Ga0466968_0025750 | |||
| 688 | Ga0466968_0082805 | |||
| 689 | Ga0466957_0000349 | |||
| 690 | Ga0466957_0165701 | |||
| 691 | Ga0466959_0024411 | |||
| 692 | Ga0466959_0037515 | |||
| 693 | Ga0466959_0040059 | |||
| 694 | Ga0466959_0220180 | |||
| 695 | Ga0466958_0000685 | |||
| 696 | Ga0466958_0008053 | |||
| 697 | Ga0466958_0041111 | |||
| 698 | Ga0466958_0045639 | |||
| 699 | Ga0466958_0103287 | |||
| 700 | Ga0466967_0000265 | |||
| 701 | Ga0466967_0001447 | |||
| 702 | Ga0466967_0003034 | |||
| 703 | Ga0466967_0020418 | |||
| 704 | Ga0466967_0027269 | |||
| 705 | Ga0466967_0029029 | |||
| 706 | Ga0466967_0030138 | |||
| 707 | Ga0466967_0039010 | |||
| 708 | Ga0466967_0076865 | |||
| 709 | Ga0466967_0088367 | |||
| 710 | Ga0466967_0090581 | |||
| 711 | Ga0466967_0091674 | |||
| 712 | Ga0466967_0097322 | |||
| 713 | Ga0466967_0103428 | |||
| 714 | Ga0466967_0320404 | |||
| 715 | Ga0466967_0421908 | |||
| 716 | Ga0495592_0120855 | |||
| 717 | Ga0495592_0181366 | |||
| 718 | Ga0495603_0052007 | |||
| 719 | Ga0495629_0000880 | |||
| 720 | Ga0495629_0005900 | |||
| 721 | Ga0495629_0019051 | |||
| 722 | Ga0495629_0024608 | |||
| 723 | Ga0495629_0040376 | |||
| 724 | Ga0495641_0000552 | |||
| 725 | Ga0495641_0010756 | |||
| 726 | Ga0495651_0036649 | |||
| 727 | Ga0495651_0042661 | |||
| 728 | Ga0495653_0004479 | |||
| 729 | Ga0495653_0041472 | |||
| 730 | Ga0495580_0040093 | |||
| 731 | Ga0495582_0000240 | |||
| 732 | Ga0495582_0002155 | |||
| 733 | Ga0495582_0049297 | |||
| 734 | Ga0495639_0004699 | |||
| 735 | Ga0495639_0006485 | |||
| 736 | Ga0495662_0000631 | |||
| 737 | Ga0495662_0001469 | |||
| 738 | Ga0495664_0073616 | |||
| 739 | Ga0495664_0078272 | |||
| 740 | Ga0495594_0065647 | |||
| 741 | Ga0495596_0069181 | |||
| 742 | Ga0495608_0018577 | |||
| 743 | Ga0495608_0019392 | |||
| 744 | Ga0495618_0007052 | |||
| 745 | Ga0495628_0096663 | |||
| 746 | Ga0495628_0205377 | |||
| 747 | Ga0495630_0001891 | |||
| 748 | Ga0495630_0007883 | |||
| 749 | Ga0495630_0017389 | |||
| 750 | Ga0495630_0034360 | |||
| 751 | Ga0495630_0056464 | |||
| 752 | Ga0495666_0000169 | |||
| 753 | Ga0495666_0007316 | |||
| 754 | Ga0495652_0006606 | |||
| 755 | Ga0495665_0000685 | |||
| 756 | Ga0495665_0006818 | |||
| 757 | Ga0495665_0118339 | |||
| 758 | Ga0495640_0007017 | |||
| 759 | Ga0495640_0011644 | |||
| 760 | Ga0495640_0062648 | |||
| 761 | Ga0495640_0121200 | |||
| 762 | Ga0495586_0001729 | |||
| 763 | Ga0495586_0006318 | |||
| 764 | Ga0495645_0028912 | |||
| 765 | Ga0495667_0030843 | |||
| 766 | Ga0495667_0081589 | |||
| 767 | Ga0495667_0118683 | |||
| 768 | Ga0495656_0006186 | |||
| 769 | Ga0495634_0003944 | |||
| 770 | Ga0495634_0013945 | |||
| 771 | Ga0495634_0037770 | |||
| 772 | Ga0495635_0007519 | |||
| 773 | Ga0495599_0099622 | |||
| 774 | Ga0495647_0000214 | |||
| 775 | Ga0495647_0045891 | |||
| 776 | Ga0495658_0000272 | |||
| 777 | Ga0495658_0000782 | |||
| 778 | Ga0495658_0178670 | |||
| 779 | Ga0495613_0003786 | |||
| 780 | Ga0495613_0005472 | |||
| 781 | Ga0495613_0015795 | |||
| 782 | Ga0495613_0028196 | |||
| 783 | Ga0495624_0000454 | |||
| 784 | Ga0495624_0009739 | |||
| 785 | Ga0495600_0001921 | |||
| 786 | Ga0495581_0000754 | |||
| 787 | Ga0495581_0002824 | |||
| 788 | Ga0495581_0052011 | |||
| 789 | Ga0495604_0094257 | |||
| 790 | Ga0495604_0130763 | |||
| 791 | Ga0495604_0147667 | |||
| 792 | Ga0495674_0001969 | |||
| 793 | Ga0495674_0061472 | |||
| 794 | Ga0495674_0063438 | |||
| 795 | Ga0495676_0000116 | |||
| 796 | Ga0495676_0009601 | |||
| 797 | Ga0495680_0001092 | |||
| 798 | Ga0495680_0007595 | |||
| 799 | Ga0495680_0015852 | |||
| 800 | Ga0495680_0019294 | |||
| 801 | Ga0495680_0116849 | |||
| 802 | Ga0495684_0019534 | |||
| 803 | Ga0495684_0035612 | |||
| 804 | Ga0495684_0128333 | |||
| 805 | Ga0495593_0000504 | |||
| 806 | Ga0495593_0011497 | |||
| 807 | Ga0495602_0073218 | |||
| 808 | Ga0495602_0157320 | |||
| 809 | Ga0495614_0000711 | |||
| 810 | Ga0495614_0050118 | |||
| 811 | Ga0496100_0003870 | |||
| 812 | Ga0496100_0004075 | |||
| 813 | Ga0496100_0012535 | |||
| 814 | Ga0496100_0067326 | |||
| 815 | Ga0496101_0004080 | |||
| 816 | Ga0496101_0017786 | |||
| 817 | Ga0496101_0030729 | |||
| 818 | Ga0496101_0045591 | |||
| 819 | Ga0496101_0046772 | |||
| 820 | Ga0496101_0071160 | |||
| 821 | Ga0496102_0004317 | |||
| 822 | Ga0496102_0093619 | |||
| 823 | Ga0496103_0019241 | |||
| 824 | Ga0496104_0000319 | |||
| 825 | Ga0496104_0002950 | |||
| 826 | Ga0496104_0033278 | |||
| 827 | Ga0496104_0115739 | |||
| 828 | Ga0496104_0265960 | |||
| 829 | Ga0496105_0000194 | |||
| 830 | Ga0496105_0006495 | |||
| 831 | Ga0496105_0029002 | |||
| 832 | Ga0496105_0068171 | |||
| 833 | Ga0496105_0242168 | |||
| 834 | Ga0496106_0007207 | |||
| 835 | Ga0496106_0022319 | |||
| 836 | Ga0496106_0035961 | |||
| 837 | Ga0496107_0005507 | |||
| 838 | Ga0496107_0097619 | |||
| 839 | Ga0496107_0108987 | |||
| 840 | Ga0496108_0000971 | |||
| 841 | Ga0496108_0006063 | |||
| 842 | Ga0496108_0115730 | |||
| 843 | Ga0496109_0001518 | |||
| 844 | Ga0496109_0005058 | |||
| 845 | Ga0496110_0000757 | |||
| 846 | Ga0496110_0002108 | |||
| 847 | Ga0496110_0167225 | |||
| 848 | Ga0496111_0000359 | |||
| 849 | Ga0496111_0034872 | |||
| 850 | Ga0496111_0059920 | |||
| 851 | Ga0496111_0069480 | |||
| 852 | Ga0496112_0009458 | |||
| 853 | Ga0496112_0355826 | |||
| 854 | Ga0496113_0024554 | |||
| 855 | Ga0496114_0010899 | |||
| 856 | Ga0496114_0024067 | |||
| 857 | Ga0496114_0051933 | |||
| 858 | Ga0496114_0105052 | |||
| 859 | Ga0496114_0140366 | |||
| 860 | Ga0496115_0000431 | |||
| 861 | Ga0496115_0003315 | |||
| 862 | Ga0496115_0006946 | |||
| 863 | Ga0496115_0010047 | |||
| 864 | Ga0496115_0043294 | |||
| 865 | Ga0496115_0043866 | |||
| 866 | Ga0496115_0080110 | |||
| 867 | Ga0501031_0032650 | |||
| 868 | Ga0501036_0092450 | |||
| 869 | Ga0501039_0098372 | |||
| 870 | Ga0501041_0011624 | |||
| 871 | Ga0501042_0049994 | |||
| 872 | Ga0501046_0123402 | |||
| 873 | Ga0501047_0030861 | |||
| 874 | Ga0501047_0066004 | |||
| 875 | Ga0501047_0106973 | |||
| 876 | Ga0501067_0000208 | |||
| 877 | Ga0501069_0058073 | |||
| 878 | Ga0501069_0060983 | |||
| 879 | Ga0501069_0080303 | |||
| 880 | Ga0501070_0000499 | |||
| 881 | Ga0501071_0055002 | |||
| 882 | Ga0501073_0146944 | |||
| 883 | Ga0501074_0024071 | |||
| 884 | Ga0501075_0061915 | |||
| 885 | Ga0501079_0001382 | |||
| 886 | Ga0501080_0020932 | |||
| 887 | Ga0501080_0047731 | |||
| 888 | Ga0501081_0067478 | |||
| 889 | Ga0501081_0237672 | |||
| 890 | Ga0501083_0131519 | |||
| 891 | Ga0501044_0122443 | |||
| 892 | nmdc:mga05p37_172096_c1 | |||
| 893 | nmdc:mga0n895_163012_c1 | |||
| 894 | nmdc:mga0a205_5451_c1 | |||
| 895 | Ga0495601_0002006 | |||
| 896 | Ga0495601_0052603 | |||
| 897 | Ga0495601_0076567 | |||
| 898 | Ga0495595_0010409 | |||
| 899 | Ga0495595_0071900 | |||
| 900 | Ga0495619_0027625 | |||
| 901 | Ga0495619_0033979 | |||
| 902 | Ga0495619_0092659 | |||
| 903 | Ga0495619_0124252 | |||
| 904 | Ga0500566_0033743 | |||
| 905 | Ga0501084_0082365 | |||
| 906 | Ga0501084_0197706 | |||
| 907 | Ga0501082_0086281 | |||
| 908 | Ga0466962_0000178 | |||
| 909 | Ga0466962_0010222 | |||
| 910 | Ga0466962_0016127 | |||
| 911 | Ga0530510_0107626 | |||
| 912 | Ga0530510_0281462 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jmg-assembly2.cif.gz_B | crystal structure of xrbj | 0.9763 | 4 | 56 |
| 8gym-assembly1.cif.gz_j1 | cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 | 0.9631 | 4 | 67 |
| 2dn9-assembly1.cif.gz_A | solution structure of j-domain from the dnaj homolog, human tid1 protein | 0.9626 | 5 | 69 |
| 5ayl-assembly1.cif.gz_A | crystal structure of erdj5 form ii | 0.9621 | 5 | 69 |
| 2ys8-assembly1.cif.gz_A | solution structure of the dnaj-like domain from human ras-associated protein rap1 | 0.9591 | 4 | 57 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7N008_53_137_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9882 | 5 | 67 | 1.10.287.110 |
| af_Q6IML7_191_273_1.10.287.110 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9854 | 4 | 56 | 1.10.287.110 |
| 4wb7A01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9799 | 4 | 58 | 1.10.287.110 |
| af_Q54KN8_591_701_2.60.260.20 | Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain | 0.9771 | 232 | 326 | 2.60.260.20 |
| 4wb7B01 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain | 0.9768 | 4 | 58 | 1.10.287.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7M7G571-F1-model_v4 | DnaJ homolog subfamily C member 16 (Endoplasmic reticulum DNA J domain-containing protein 8) | 0.9706 | 1 | 69 |
GO:0005789
GO:0006914 |
| AF-A0A523NN38-F1-model_v4 | J domain-containing protein | 0.9526 | 229 | 326 |
GO:0005737
GO:0042026 GO:0051082 GO:0051085 |
| AF-A0A6L8ZA96-F1-model_v4 | deleted | 0.9443 | 194 | 328 |
|
| AF-A0A7Y1XJL3-F1-model_v4 | DnaJ domain-containing protein | 0.9433 | 1 | 69 |
GO:0036503
GO:0051087 GO:0051787 |
| AF-B0E6A5-F1-model_v4 | J domain-containing protein | 0.9425 | 3 | 76 |
GO:0005783
GO:0016020 GO:0036503 GO:0051087 GO:0051787 |