F447793

General Info

Members Datasets Scaffolds Average Seq Length
456 203 912 334

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10068276|Ga0207644_100682763
Length 363
Sequence MAATDRDYYELLGIPRDADEATIKKSFRRLARELHPDVSDHPEAEVRFREITEAYEVLSSSERRALYDRYGHAGLRSGGFSPTDFDMGNLGDLFASLFGDGIFGGTTGEARRRGADLGAEIAIELVEAARGVTVPVPFEVAATCTACGGDGVEPGTQPRTXXXXEGSGRLHQVSRSVFGEFVRAQPCPDCRGRGVLVDTRTLAERTLNVDVPAGIHDGQRIRVSGEGHAGTLGGRAGDVYVHVRVKPDPRFVREGNDIYSQVDLTIVQAALGAAFEVETLDGTVPLELPAGVQPGEVRVLRGKGMPVLQGFGRGDHRVLVNVTVPRRLTDEQRRLLEDFEAASDDQTYRVDESFFDKLKSAFR

Samples

Sample ID Description Type Environment
1 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
91 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
92 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
117 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 12.28
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 3.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207644_10068276 3300025931 Bacteria 2593
2 Ga0070658_10015384 3300005327 Bacteria 6123
3 Ga0070658_10184449 3300005327 Bacteria 1757
4 Ga0070683_100014995 3300005329 Bacteria 6798
5 Ga0070683_100105107 3300005329 Bacteria 2661
6 Ga0070680_100013349 3300005336 Bacteria 6397
7 Ga0070680_100024285 3300005336 Bacteria 4839
8 Ga0070680_100101778 3300005336 Bacteria 2385
9 Ga0070680_100150544 3300005336 Bacteria 1953
10 Ga0070680_100296368 3300005336 Unclassified 1371
11 Ga0070660_100001227 3300005339 Bacteria 17435
12 Ga0070660_100026510 3300005339 Bacteria 4315
13 Ga0070660_100028819 3300005339 Bacteria 4157
14 Ga0070661_100022246 3300005344 Bacteria 4538
15 Ga0070661_100039091 3300005344 Bacteria 3456
16 Ga0070661_100050751 3300005344 Bacteria 3035
17 Ga0070675_100363884 3300005354 Bacteria 1285
18 Ga0070671_100160291 3300005355 Bacteria 1902
19 Ga0070659_100069597 3300005366 Bacteria 2794
20 Ga0070659_100086112 3300005366 Bacteria 2514
21 Ga0070667_100004251 3300005367 Bacteria 12095
22 Ga0070709_10138614 3300005434 Bacteria 1669
23 Ga0070709_10180964 3300005434 Bacteria 1480
24 Ga0070709_10194746 3300005434 Bacteria 1432
25 Ga0070714_100019427 3300005435 Bacteria 5536
26 Ga0070714_100152369 3300005435 Bacteria 2084
27 Ga0070714_100254437 3300005435 Bacteria 1625
28 Ga0070714_100275395 3300005435 Bacteria 1562
29 Ga0070713_100083931 3300005436 Bacteria 2724
30 Ga0070713_100179467 3300005436 Unclassified 1902
31 Ga0070713_100357398 3300005436 Bacteria 1356
32 Ga0070711_100003366 3300005439 Bacteria 9316
33 Ga0070708_100015571 3300005445 Bacteria 6285
34 Ga0070681_10003001 3300005458 Bacteria 15664
35 Ga0070681_10004205 3300005458 Bacteria 13637
36 Ga0070681_10023456 3300005458 Bacteria 6205
37 Ga0070681_10053124 3300005458 Bacteria 4037
38 Ga0070681_10074508 3300005458 Bacteria 3356
39 Ga0070681_10089866 3300005458 Bacteria 3022
40 Ga0070681_10111881 3300005458 Bacteria 2670
41 Ga0070681_10133580 3300005458 Bacteria 2413
42 Ga0070706_100162351 3300005467 Bacteria 2086
43 Ga0070707_100070522 3300005468 Bacteria 3366
44 Ga0070679_100002041 3300005530 Bacteria 18130
45 Ga0070679_100032695 3300005530 Bacteria 5148
46 Ga0070684_100014526 3300005535 Bacteria 6382
47 Ga0070684_100021918 3300005535 Bacteria 5322
48 Ga0070684_100115095 3300005535 Bacteria 2414
49 Ga0070684_100133701 3300005535 Bacteria 2239
50 Ga0070696_100014265 3300005546 Bacteria 5331
51 Ga0070696_100042426 3300005546 Bacteria 3145
52 Ga0070693_100023529 3300005547 Bacteria 3294
53 Ga0070665_100004675 3300005548 Bacteria 14290
54 Ga0068855_100005572 3300005563 Bacteria 15363
55 Ga0068855_100104746 3300005563 Bacteria 3253
56 Ga0068855_100107460 3300005563 Bacteria 3206
57 Ga0068855_100242878 3300005563 Bacteria 2011
58 Ga0068857_100045053 3300005577 Bacteria 3912
59 Ga0068856_100030718 3300005614 Bacteria 5252
60 Ga0068856_100073868 3300005614 Bacteria 3376
61 Ga0068852_100008920 3300005616 Bacteria 7420
62 Ga0068852_100031361 3300005616 Bacteria 4385
63 Ga0068852_100230865 3300005616 Bacteria 1764
64 Ga0081455_10032713 3300005937 Bacteria 4684
65 Ga0081455_10050766 3300005937 Bacteria 3563
66 Ga0081539_10001235 3300005985 Bacteria 45514
67 Ga0081539_10003115 3300005985 Bacteria 21199
68 Ga0070717_10005143 3300006028 Bacteria 9537
69 Ga0070717_10081125 3300006028 Bacteria 2723
70 Ga0070717_10088324 3300006028 Unclassified 2612
71 Ga0070715_10106322 3300006163 Bacteria 1317
72 Ga0075428_100040993 3300006844 Bacteria 5092
73 Ga0075433_10001147 3300006852 Bacteria 19223
74 Ga0075434_100002007 3300006871 Bacteria 17664
75 Ga0075434_100050721 3300006871 Bacteria 4122
76 Ga0075429_100003982 3300006880 Bacteria 12638
77 Ga0075435_100012083 3300007076 Bacteria 6383
78 Ga0075435_100014916 3300007076 Bacteria 5828
79 Ga0105240_10107025 3300009093 Bacteria 3391
80 Ga0114129_10407121 3300009147 Bacteria 1792
81 Ga0105248_10298328 3300009177 Bacteria 1815
82 Ga0105237_10512809 3300009545 Bacteria 1206
83 Ga0105238_10014122 3300009551 Bacteria 8076
84 Ga0157373_10069584 3300013100 Bacteria 2488
85 Ga0157370_10003420 3300013104 Bacteria 18639
86 Ga0157370_10382025 3300013104 Bacteria 1297
87 Ga0157369_10006969 3300013105 Bacteria 13031
88 Ga0157369_10008479 3300013105 Bacteria 11788
89 Ga0157369_10019403 3300013105 Bacteria 7606
90 Ga0157369_10034084 3300013105 Bacteria 5589
91 Ga0157369_10113541 3300013105 Bacteria 2878
92 Ga0157374_10092747 3300013296 Bacteria 2882
93 Ga0157374_10322403 3300013296 Bacteria 1531
94 Ga0157372_10007863 3300013307 Bacteria 11332
95 Ga0157372_10031064 3300013307 Bacteria 5847
96 Ga0157372_10075748 3300013307 Bacteria 3797
97 Ga0157372_10087642 3300013307 Bacteria 3532
98 Ga0206356_10022735 3300020070 Bacteria 3253
99 Ga0206354_10175774 3300020081 Bacteria 1396
100 Ga0206354_10581427 3300020081 Bacteria 4182
101 Ga0206354_11447256 3300020081 Bacteria 6587
102 Ga0206353_11030619 3300020082 Bacteria 3839
103 Ga0206353_11214556 3300020082 Unclassified 1416
104 Ga0206353_11977611 3300020082 Bacteria 2968
105 Ga0207699_10015057 3300025906 Bacteria 4009
106 Ga0207707_10002237 3300025912 Bacteria 17490
107 Ga0207707_10029781 3300025912 Bacteria 4774
108 Ga0207707_10066263 3300025912 Bacteria 3145
109 Ga0207707_10254749 3300025912 Bacteria 1524
110 Ga0207695_10054722 3300025913 Bacteria 4164
111 Ga0207695_10090168 3300025913 Bacteria 3082
112 Ga0207693_10034804 3300025915 Bacteria 3972
113 Ga0207693_10157791 3300025915 Unclassified 1785
114 Ga0207663_10016268 3300025916 Bacteria 4120
115 Ga0207663_10064754 3300025916 Bacteria 2334
116 Ga0207663_10107100 3300025916 Bacteria 1890
117 Ga0207660_10028268 3300025917 Bacteria 3835
118 Ga0207660_10077360 3300025917 Bacteria 2435
119 Ga0207660_10237494 3300025917 Unclassified 1435
120 Ga0207657_10000467 3300025919 Bacteria 42840
121 Ga0207657_10000731 3300025919 Bacteria 34878
122 Ga0207657_10065361 3300025919 Bacteria 3101
123 Ga0207649_10016561 3300025920 Bacteria 4160
124 Ga0207652_10009031 3300025921 Bacteria 8029
125 Ga0207652_10024777 3300025921 Bacteria 4980
126 Ga0207652_10053554 3300025921 Bacteria 3466
127 Ga0207652_10083770 3300025921 Bacteria 2792
128 Ga0207652_10222363 3300025921 Bacteria 1701
129 Ga0207646_10183464 3300025922 Bacteria 1890
130 Ga0207694_10032086 3300025924 Bacteria 4018
131 Ga0207700_10185488 3300025928 Bacteria 1745
132 Ga0207700_10245997 3300025928 Bacteria 1526
133 Ga0207700_10309365 3300025928 Unclassified 1366
134 Ga0207664_10034926 3300025929 Bacteria 3876
135 Ga0207664_10037972 3300025929 Bacteria 3731
136 Ga0207644_10075898 3300025931 Bacteria 2471
137 Ga0207690_10018287 3300025932 Bacteria 4297
138 Ga0207690_10061399 3300025932 Bacteria 2555
139 Ga0207686_10070873 3300025934 Bacteria 2241
140 Ga0207704_10048202 3300025938 Bacteria 2552
141 Ga0207665_10000531 3300025939 Bacteria 25686
142 Ga0207661_10047236 3300025944 Bacteria 3417
143 Ga0207661_10101674 3300025944 Bacteria 2415
144 Ga0207661_10104772 3300025944 Bacteria 2382
145 Ga0207667_10038319 3300025949 Bacteria 5121
146 Ga0207667_10105337 3300025949 Bacteria 2909
147 Ga0207658_10003739 3300025986 Bacteria 10717
148 Ga0207678_10127710 3300026067 Unclassified 2169
149 Ga0207702_10007044 3300026078 Bacteria 9621
150 Ga0207702_10042476 3300026078 Bacteria 3814
151 Ga0207702_10513825 3300026078 Bacteria 1169
152 Ga0207674_10011546 3300026116 Bacteria 9921
153 Ga0207674_10055705 3300026116 Bacteria 4018
154 Ga0207683_10142744 3300026121 Bacteria 2158
155 Ga0207698_10018955 3300026142 Bacteria 4699
156 Ga0207698_10029652 3300026142 Bacteria 3922
157 Ga0268266_10047011 3300028379 Bacteria 3695
158 Ga0265318_10014377 3300028577 Bacteria 3325
159 Ga0265322_10008664 3300028654 Bacteria 2963
160 Ga0265336_10003729 3300028666 Bacteria 5902
161 Ga0265338_10141443 3300028800 Bacteria 1884
162 Ga0265328_10065540 3300031239 Bacteria 1334
163 Ga0265340_10006557 3300031247 Bacteria 6396
164 Ga0265340_10074968 3300031247 Bacteria 1599
165 Ga0265339_10015134 3300031249 Bacteria 4633
166 Ga0265331_10075867 3300031250 Bacteria 1567
167 Ga0265327_10007446 3300031251 Bacteria 8445
168 Ga0265327_10009577 3300031251 Bacteria 6964
169 Ga0265327_10050128 3300031251 Bacteria 2186
170 Ga0265316_10009243 3300031344 Bacteria 9075
171 Ga0265313_10022260 3300031595 Bacteria 3443
172 Ga0265314_10044508 3300031711 Bacteria 3146
173 Ga0265342_10043851 3300031712 Bacteria 2697
174 Ga0307416_100055927 3300032002 Bacteria 3180
175 Ga0373944_0049142 3300035089 Bacteria 1325
176 Ga0373936_0032440 3300035113 Unclassified 2066
177 Ga0373936_0043521 3300035113 Bacteria 1805
178 Ga0373945_0014480 3300035116 Bacteria 2643
179 Ga0373943_0000703 3300035170 Bacteria 14614
180 Ga0373943_0006660 3300035170 Bacteria 5181
181 Ga0373943_0010455 3300035170 Bacteria 4158
182 Ga0373946_0003486 3300035171 Bacteria 5580
183 Ga0373946_0014017 3300035171 Bacteria 3019
184 Ga0373935_0007648 3300035692 Bacteria 6476
185 Ga0373947_0002323 3300035725 Bacteria 11501
186 Ga0373947_0002946 3300035725 Bacteria 10155
187 Ga0373947_0008902 3300035725 Bacteria 5772
188 Ga0373947_0012264 3300035725 Bacteria 4910
189 Ga0373937_0390535 3300036401 Bacteria 1320
190 Ga0373925_0001856 3300037068 Bacteria 17583
191 Ga0373925_0005408 3300037068 Bacteria 9516
192 Ga0395899_0002477 3300037312 Bacteria 14979
193 Ga0395899_0168036 3300037312 Bacteria 1546
194 Ga0395900_0003203 3300037418 Bacteria 17718
195 Ga0395900_0087259 3300037418 Bacteria 3207
196 Ga0395900_0125786 3300037418 Bacteria 2629
197 Ga0395900_0146539 3300037418 Bacteria 2414
198 Ga0395898_0010794 3300037466 Bacteria 9542
199 Ga0395898_0036815 3300037466 Bacteria 4856
200 Ga0395898_0038426 3300037466 Bacteria 4744
201 Ga0395905_0000568 3300037471 Bacteria 50013
202 Ga0395905_0105509 3300037471 Bacteria 2646
203 Ga0395905_0105893 3300037471 Bacteria 2641
204 Ga0395905_0229221 3300037471 Bacteria 1737
205 Ga0395901_0012951 3300038443 Bacteria 8460
206 Ga0395901_0036295 3300038443 Bacteria 5093
207 Ga0395901_0039112 3300038443 Bacteria 4907
208 Ga0395901_0061179 3300038443 Bacteria 3918
209 Ga0395901_0198002 3300038443 Bacteria 2106
210 Ga0395901_0208489 3300038443 Bacteria 2046
211 Ga0436365_0541924 3300039437 Unclassified 1536
212 Ga0436365_1025500 3300039437 Bacteria 2141
213 Ga0436363_0811128 3300039450 Bacteria 1660
214 Ga0466965_0039661 3300044683 Bacteria 2316
215 Ga0466966_0077844 3300044684 Bacteria 2069
216 Ga0466963_0000743 3300044694 Bacteria 16069
217 Ga0466963_0002011 3300044694 Bacteria 11172
218 Ga0466963_0002261 3300044694 Bacteria 10700
219 Ga0466963_0005306 3300044694 Bacteria 7532
220 Ga0466963_0022081 3300044694 Bacteria 4026
221 Ga0466963_0037996 3300044694 Bacteria 3147
222 Ga0466963_0038129 3300044694 Bacteria 3141
223 Ga0466963_0085099 3300044694 Bacteria 2146
224 Ga0466963_0188349 3300044694 Bacteria 1441
225 Ga0466963_0190337 3300044694 Bacteria 1433
226 Ga0466964_0001166 3300044706 Bacteria 8883
227 Ga0466964_0002975 3300044706 Bacteria 6131
228 Ga0466964_0007927 3300044706 Bacteria 3978
229 Ga0466971_0000910 3300044719 Bacteria 12117
230 Ga0466971_0073826 3300044719 Bacteria 1550
231 Ga0466968_0025750 3300044735 Bacteria 2411
232 Ga0466968_0082805 3300044735 Unclassified 1412
233 Ga0466957_0000349 3300044842 Bacteria 22576
234 Ga0466957_0165701 3300044842 Bacteria 1437
235 Ga0466959_0024411 3300045049 Bacteria 4478
236 Ga0466959_0037515 3300045049 Bacteria 3581
237 Ga0466959_0040059 3300045049 Bacteria 3462
238 Ga0466959_0220180 3300045049 Bacteria 1317
239 Ga0466958_0000685 3300045836 Bacteria 14737
240 Ga0466958_0008053 3300045836 Bacteria 5828
241 Ga0466958_0041111 3300045836 Bacteria 2780
242 Ga0466958_0045639 3300045836 Bacteria 2644
243 Ga0466958_0103287 3300045836 Bacteria 1774
244 Ga0466967_0000265 3300045976 Bacteria 23015
245 Ga0466967_0001447 3300045976 Bacteria 13783
246 Ga0466967_0003034 3300045976 Bacteria 10777
247 Ga0466967_0020418 3300045976 Bacteria 5354
248 Ga0466967_0027269 3300045976 Bacteria 4749
249 Ga0466967_0029029 3300045976 Bacteria 4624
250 Ga0466967_0030138 3300045976 Bacteria 4550
251 Ga0466967_0039010 3300045976 Bacteria 4079
252 Ga0466967_0076865 3300045976 Bacteria 3004
253 Ga0466967_0088367 3300045976 Bacteria 2812
254 Ga0466967_0090581 3300045976 Bacteria 2778
255 Ga0466967_0091674 3300045976 Bacteria 2762
256 Ga0466967_0097322 3300045976 Bacteria 2686
257 Ga0466967_0103428 3300045976 Bacteria 2606
258 Ga0466967_0320404 3300045976 Unclassified 1495
259 Ga0466967_0421908 3300045976 Bacteria 1300
260 Ga0495592_0120855 3300046454 Bacteria 1843
261 Ga0495592_0181366 3300046454 Bacteria 1434
262 Ga0495603_0052007 3300046455 Bacteria 2433
263 Ga0495629_0000880 3300046459 Bacteria 24212
264 Ga0495629_0005900 3300046459 Bacteria 9128
265 Ga0495629_0019051 3300046459 Bacteria 4907
266 Ga0495629_0024608 3300046459 Bacteria 4286
267 Ga0495629_0040376 3300046459 Bacteria 3282
268 Ga0495641_0000552 3300046461 Bacteria 31604
269 Ga0495641_0010756 3300046461 Bacteria 5269
270 Ga0495651_0036649 3300046462 Bacteria 3818
271 Ga0495651_0042661 3300046462 Bacteria 3521
272 Ga0495653_0004479 3300046463 Bacteria 11279
273 Ga0495653_0041472 3300046463 Bacteria 3592
274 Ga0495580_0040093 3300046472 Bacteria 3348
275 Ga0495582_0000240 3300046473 Bacteria 30558
276 Ga0495582_0002155 3300046473 Bacteria 11012
277 Ga0495582_0049297 3300046473 Bacteria 2319
278 Ga0495639_0004699 3300046475 Bacteria 5868
279 Ga0495639_0006485 3300046475 Bacteria 5031
280 Ga0495662_0000631 3300046476 Bacteria 16407
281 Ga0495662_0001469 3300046476 Bacteria 11662
282 Ga0495664_0073616 3300046477 Bacteria 2042
283 Ga0495664_0078272 3300046477 Bacteria 1980
284 Ga0495594_0065647 3300046499 Bacteria 2013
285 Ga0495596_0069181 3300046500 Bacteria 1372
286 Ga0495608_0018577 3300046511 Bacteria 4792
287 Ga0495608_0019392 3300046511 Bacteria 4680
288 Ga0495618_0007052 3300046514 Bacteria 6802
289 Ga0495628_0096663 3300046516 Bacteria 2282
290 Ga0495628_0205377 3300046516 Bacteria 1483
291 Ga0495630_0001891 3300046517 Bacteria 14594
292 Ga0495630_0007883 3300046517 Bacteria 7636
293 Ga0495630_0017389 3300046517 Bacteria 5267
294 Ga0495630_0034360 3300046517 Bacteria 3786
295 Ga0495630_0056464 3300046517 Bacteria 2942
296 Ga0495666_0000169 3300046526 Bacteria 27666
297 Ga0495666_0007316 3300046526 Bacteria 5536
298 Ga0495652_0006606 3300046529 Bacteria 10774
299 Ga0495665_0000685 3300046531 Bacteria 17384
300 Ga0495665_0006818 3300046531 Bacteria 6162
301 Ga0495665_0118339 3300046531 Bacteria 1388
302 Ga0495640_0007017 3300046533 Bacteria 8866
303 Ga0495640_0011644 3300046533 Bacteria 6756
304 Ga0495640_0062648 3300046533 Bacteria 2522
305 Ga0495640_0121200 3300046533 Bacteria 1700
306 Ga0495586_0001729 3300046535 Bacteria 11922
307 Ga0495586_0006318 3300046535 Bacteria 6330
308 Ga0495645_0028912 3300046543 Bacteria 4029
309 Ga0495667_0030843 3300046559 Bacteria 3601
310 Ga0495667_0081589 3300046559 Bacteria 2102
311 Ga0495667_0118683 3300046559 Bacteria 1708
312 Ga0495656_0006186 3300046615 Bacteria 4188
313 Ga0495634_0003944 3300046642 Bacteria 11778
314 Ga0495634_0013945 3300046642 Bacteria 5808
315 Ga0495634_0037770 3300046642 Bacteria 3297
316 Ga0495635_0007519 3300046663 Bacteria 7602
317 Ga0495599_0099622 3300046678 Unclassified 1811
318 Ga0495647_0000214 3300046681 Bacteria 15610
319 Ga0495647_0045891 3300046681 Bacteria 1681
320 Ga0495658_0000272 3300046683 Bacteria 29389
321 Ga0495658_0000782 3300046683 Bacteria 17147
322 Ga0495658_0178670 3300046683 Bacteria 1316
323 Ga0495613_0003786 3300046689 Bacteria 11339
324 Ga0495613_0005472 3300046689 Bacteria 9538
325 Ga0495613_0015795 3300046689 Bacteria 5620
326 Ga0495613_0028196 3300046689 Bacteria 4177
327 Ga0495624_0000454 3300046690 Bacteria 32267
328 Ga0495624_0009739 3300046690 Bacteria 6648
329 Ga0495600_0001921 3300046809 Bacteria 11663
330 Ga0495581_0000754 3300047315 Bacteria 17163
331 Ga0495581_0002824 3300047315 Bacteria 9927
332 Ga0495581_0052011 3300047315 Bacteria 2366
333 Ga0495604_0094257 3300047317 Bacteria 2213
334 Ga0495604_0130763 3300047317 Bacteria 1805
335 Ga0495604_0147667 3300047317 Bacteria 1674
336 Ga0495674_0001969 3300047319 Bacteria 20234
337 Ga0495674_0061472 3300047319 Bacteria 3273
338 Ga0495674_0063438 3300047319 Bacteria 3214
339 Ga0495676_0000116 3300047321 Bacteria 61181
340 Ga0495676_0009601 3300047321 Bacteria 8808
341 Ga0495680_0001092 3300047322 Bacteria 30065
342 Ga0495680_0007595 3300047322 Bacteria 9909
343 Ga0495680_0015852 3300047322 Bacteria 6487
344 Ga0495680_0019294 3300047322 Bacteria 5761
345 Ga0495680_0116849 3300047322 Bacteria 1972
346 Ga0495684_0019534 3300047471 Bacteria 5219
347 Ga0495684_0035612 3300047471 Bacteria 3816
348 Ga0495684_0128333 3300047471 Bacteria 1906
349 Ga0495593_0000504 3300047673 Bacteria 22038
350 Ga0495593_0011497 3300047673 Bacteria 5082
351 Ga0495602_0073218 3300048088 Bacteria 2917
352 Ga0495602_0157320 3300048088 Bacteria 1778
353 Ga0495614_0000711 3300048089 Bacteria 14036
354 Ga0495614_0050118 3300048089 Bacteria 1789
355 Ga0496100_0003870 3300048903 Bacteria 7855
356 Ga0496100_0004075 3300048903 Bacteria 7705
357 Ga0496100_0012535 3300048903 Bacteria 4863
358 Ga0496100_0067326 3300048903 Bacteria 2378
359 Ga0496101_0004080 3300048904 Bacteria 9136
360 Ga0496101_0017786 3300048904 Bacteria 4824
361 Ga0496101_0030729 3300048904 Bacteria 3769
362 Ga0496101_0045591 3300048904 Bacteria 3141
363 Ga0496101_0046772 3300048904 Bacteria 3104
364 Ga0496101_0071160 3300048904 Bacteria 2549
365 Ga0496102_0004317 3300048905 Bacteria 12023
366 Ga0496102_0093619 3300048905 Bacteria 2784
367 Ga0496103_0019241 3300048906 Bacteria 4100
368 Ga0496104_0000319 3300048907 Bacteria 42768
369 Ga0496104_0002950 3300048907 Bacteria 14659
370 Ga0496104_0033278 3300048907 Bacteria 4801
371 Ga0496104_0115739 3300048907 Bacteria 2572
372 Ga0496104_0265960 3300048907 Bacteria 1627
373 Ga0496105_0000194 3300048908 Bacteria 40666
374 Ga0496105_0006495 3300048908 Bacteria 8989
375 Ga0496105_0029002 3300048908 Bacteria 4528
376 Ga0496105_0068171 3300048908 Bacteria 2938
377 Ga0496105_0242168 3300048908 Unclassified 1463
378 Ga0496106_0007207 3300048909 Bacteria 8214
379 Ga0496106_0022319 3300048909 Bacteria 4701
380 Ga0496106_0035961 3300048909 Bacteria 3704
381 Ga0496107_0005507 3300048910 Bacteria 8665
382 Ga0496107_0097619 3300048910 Bacteria 2151
383 Ga0496107_0108987 3300048910 Bacteria 2034
384 Ga0496108_0000971 3300048911 Bacteria 22338
385 Ga0496108_0006063 3300048911 Bacteria 9776
386 Ga0496108_0115730 3300048911 Bacteria 2296
387 Ga0496109_0001518 3300048912 Bacteria 19311
388 Ga0496109_0005058 3300048912 Bacteria 11014
389 Ga0496110_0000757 3300048913 Bacteria 22349
390 Ga0496110_0002108 3300048913 Bacteria 14845
391 Ga0496110_0167225 3300048913 Bacteria 1994
392 Ga0496111_0000359 3300048914 Bacteria 22584
393 Ga0496111_0034872 3300048914 Bacteria 3594
394 Ga0496111_0059920 3300048914 Bacteria 2758
395 Ga0496111_0069480 3300048914 Bacteria 2561
396 Ga0496112_0009458 3300048915 Bacteria 8784
397 Ga0496112_0355826 3300048915 Unclassified 1406
398 Ga0496113_0024554 3300048916 Bacteria 4285
399 Ga0496114_0010899 3300048917 Bacteria 7243
400 Ga0496114_0024067 3300048917 Bacteria 4969
401 Ga0496114_0051933 3300048917 Bacteria 3414
402 Ga0496114_0105052 3300048917 Unclassified 2415
403 Ga0496114_0140366 3300048917 Bacteria 2091
404 Ga0496115_0000431 3300048918 Bacteria 33991
405 Ga0496115_0003315 3300048918 Bacteria 11559
406 Ga0496115_0006946 3300048918 Bacteria 8319
407 Ga0496115_0010047 3300048918 Bacteria 7055
408 Ga0496115_0043294 3300048918 Bacteria 3590
409 Ga0496115_0043866 3300048918 Bacteria 3566
410 Ga0496115_0080110 3300048918 Bacteria 2659
411 Ga0501031_0032650 3300049568 Bacteria 3394
412 Ga0501036_0092450 3300049572 Bacteria 2555
413 Ga0501039_0098372 3300049575 Bacteria 2282
414 Ga0501041_0011624 3300049577 Bacteria 5210
415 Ga0501042_0049994 3300049578 Bacteria 2982
416 Ga0501046_0123402 3300049580 Bacteria 1969
417 Ga0501047_0030861 3300049581 Bacteria 5167
418 Ga0501047_0066004 3300049581 Bacteria 3488
419 Ga0501047_0106973 3300049581 Bacteria 2678
420 Ga0501067_0000208 3300049583 Bacteria 32744
421 Ga0501069_0058073 3300049585 Bacteria 2158
422 Ga0501069_0060983 3300049585 Bacteria 2106
423 Ga0501069_0080303 3300049585 Bacteria 1837
424 Ga0501070_0000499 3300049586 Bacteria 35735
425 Ga0501071_0055002 3300049587 Bacteria 2872
426 Ga0501073_0146944 3300049589 Bacteria 1634
427 Ga0501074_0024071 3300049590 Bacteria 4425
428 Ga0501075_0061915 3300049591 Bacteria 2820
429 Ga0501079_0001382 3300049741 Bacteria 17096
430 Ga0501080_0020932 3300049742 Bacteria 6053
431 Ga0501080_0047731 3300049742 Bacteria 3987
432 Ga0501081_0067478 3300049743 Bacteria 2490
433 Ga0501081_0237672 3300049743 Bacteria 1328
434 Ga0501083_0131519 3300049744 Bacteria 1641
435 Ga0501044_0122443 3300049823 Bacteria 2601
436 nmdc:mga05p37_172096_c1 3300050507 Bacteria 2641
437 nmdc:mga0n895_163012_c1 3300050512 Bacteria 2261
438 nmdc:mga0a205_5451_c1 3300050515 Bacteria 11462
439 Ga0495601_0002006 3300053077 Bacteria 11425
440 Ga0495601_0052603 3300053077 Bacteria 2572
441 Ga0495601_0076567 3300053077 Bacteria 2142
442 Ga0495595_0010409 3300053084 Bacteria 3865
443 Ga0495595_0071900 3300053084 Bacteria 1636
444 Ga0495619_0027625 3300053085 Bacteria 3656
445 Ga0495619_0033979 3300053085 Unclassified 3313
446 Ga0495619_0092659 3300053085 Bacteria 2047
447 Ga0495619_0124252 3300053085 Bacteria 1770
448 Ga0500566_0033743 3300053094 Bacteria 2980
449 Ga0501084_0082365 3300054114 Bacteria 2700
450 Ga0501084_0197706 3300054114 Bacteria 1696
451 Ga0501082_0086281 3300060353 Bacteria 2707
452 Ga0466962_0000178 3300061719 Bacteria 26342
453 Ga0466962_0010222 3300061719 Bacteria 4507
454 Ga0466962_0016127 3300061719 Bacteria 3604
455 Ga0530510_0107626 3300061734 Bacteria 2040
456 Ga0530510_0281462 3300061734 Bacteria 1242
457 Ga0207644_10068276
458 Ga0070658_10015384
459 Ga0070658_10184449
460 Ga0070683_100014995
461 Ga0070683_100105107
462 Ga0070680_100013349
463 Ga0070680_100024285
464 Ga0070680_100101778
465 Ga0070680_100150544
466 Ga0070680_100296368
467 Ga0070660_100001227
468 Ga0070660_100026510
469 Ga0070660_100028819
470 Ga0070661_100022246
471 Ga0070661_100039091
472 Ga0070661_100050751
473 Ga0070675_100363884
474 Ga0070671_100160291
475 Ga0070659_100069597
476 Ga0070659_100086112
477 Ga0070667_100004251
478 Ga0070709_10138614
479 Ga0070709_10180964
480 Ga0070709_10194746
481 Ga0070714_100019427
482 Ga0070714_100152369
483 Ga0070714_100254437
484 Ga0070714_100275395
485 Ga0070713_100083931
486 Ga0070713_100179467
487 Ga0070713_100357398
488 Ga0070711_100003366
489 Ga0070708_100015571
490 Ga0070681_10003001
491 Ga0070681_10004205
492 Ga0070681_10023456
493 Ga0070681_10053124
494 Ga0070681_10074508
495 Ga0070681_10089866
496 Ga0070681_10111881
497 Ga0070681_10133580
498 Ga0070706_100162351
499 Ga0070707_100070522
500 Ga0070679_100002041
501 Ga0070679_100032695
502 Ga0070684_100014526
503 Ga0070684_100021918
504 Ga0070684_100115095
505 Ga0070684_100133701
506 Ga0070696_100014265
507 Ga0070696_100042426
508 Ga0070693_100023529
509 Ga0070665_100004675
510 Ga0068855_100005572
511 Ga0068855_100104746
512 Ga0068855_100107460
513 Ga0068855_100242878
514 Ga0068857_100045053
515 Ga0068856_100030718
516 Ga0068856_100073868
517 Ga0068852_100008920
518 Ga0068852_100031361
519 Ga0068852_100230865
520 Ga0081455_10032713
521 Ga0081455_10050766
522 Ga0081539_10001235
523 Ga0081539_10003115
524 Ga0070717_10005143
525 Ga0070717_10081125
526 Ga0070717_10088324
527 Ga0070715_10106322
528 Ga0075428_100040993
529 Ga0075433_10001147
530 Ga0075434_100002007
531 Ga0075434_100050721
532 Ga0075429_100003982
533 Ga0075435_100012083
534 Ga0075435_100014916
535 Ga0105240_10107025
536 Ga0114129_10407121
537 Ga0105248_10298328
538 Ga0105237_10512809
539 Ga0105238_10014122
540 Ga0157373_10069584
541 Ga0157370_10003420
542 Ga0157370_10382025
543 Ga0157369_10006969
544 Ga0157369_10008479
545 Ga0157369_10019403
546 Ga0157369_10034084
547 Ga0157369_10113541
548 Ga0157374_10092747
549 Ga0157374_10322403
550 Ga0157372_10007863
551 Ga0157372_10031064
552 Ga0157372_10075748
553 Ga0157372_10087642
554 Ga0206356_10022735
555 Ga0206354_10175774
556 Ga0206354_10581427
557 Ga0206354_11447256
558 Ga0206353_11030619
559 Ga0206353_11214556
560 Ga0206353_11977611
561 Ga0207699_10015057
562 Ga0207707_10002237
563 Ga0207707_10029781
564 Ga0207707_10066263
565 Ga0207707_10254749
566 Ga0207695_10054722
567 Ga0207695_10090168
568 Ga0207693_10034804
569 Ga0207693_10157791
570 Ga0207663_10016268
571 Ga0207663_10064754
572 Ga0207663_10107100
573 Ga0207660_10028268
574 Ga0207660_10077360
575 Ga0207660_10237494
576 Ga0207657_10000467
577 Ga0207657_10000731
578 Ga0207657_10065361
579 Ga0207649_10016561
580 Ga0207652_10009031
581 Ga0207652_10024777
582 Ga0207652_10053554
583 Ga0207652_10083770
584 Ga0207652_10222363
585 Ga0207646_10183464
586 Ga0207694_10032086
587 Ga0207700_10185488
588 Ga0207700_10245997
589 Ga0207700_10309365
590 Ga0207664_10034926
591 Ga0207664_10037972
592 Ga0207644_10075898
593 Ga0207690_10018287
594 Ga0207690_10061399
595 Ga0207686_10070873
596 Ga0207704_10048202
597 Ga0207665_10000531
598 Ga0207661_10047236
599 Ga0207661_10101674
600 Ga0207661_10104772
601 Ga0207667_10038319
602 Ga0207667_10105337
603 Ga0207658_10003739
604 Ga0207678_10127710
605 Ga0207702_10007044
606 Ga0207702_10042476
607 Ga0207702_10513825
608 Ga0207674_10011546
609 Ga0207674_10055705
610 Ga0207683_10142744
611 Ga0207698_10018955
612 Ga0207698_10029652
613 Ga0268266_10047011
614 Ga0265318_10014377
615 Ga0265322_10008664
616 Ga0265336_10003729
617 Ga0265338_10141443
618 Ga0265328_10065540
619 Ga0265340_10006557
620 Ga0265340_10074968
621 Ga0265339_10015134
622 Ga0265331_10075867
623 Ga0265327_10007446
624 Ga0265327_10009577
625 Ga0265327_10050128
626 Ga0265316_10009243
627 Ga0265313_10022260
628 Ga0265314_10044508
629 Ga0265342_10043851
630 Ga0307416_100055927
631 Ga0373944_0049142
632 Ga0373936_0032440
633 Ga0373936_0043521
634 Ga0373945_0014480
635 Ga0373943_0000703
636 Ga0373943_0006660
637 Ga0373943_0010455
638 Ga0373946_0003486
639 Ga0373946_0014017
640 Ga0373935_0007648
641 Ga0373947_0002323
642 Ga0373947_0002946
643 Ga0373947_0008902
644 Ga0373947_0012264
645 Ga0373937_0390535
646 Ga0373925_0001856
647 Ga0373925_0005408
648 Ga0395899_0002477
649 Ga0395899_0168036
650 Ga0395900_0003203
651 Ga0395900_0087259
652 Ga0395900_0125786
653 Ga0395900_0146539
654 Ga0395898_0010794
655 Ga0395898_0036815
656 Ga0395898_0038426
657 Ga0395905_0000568
658 Ga0395905_0105509
659 Ga0395905_0105893
660 Ga0395905_0229221
661 Ga0395901_0012951
662 Ga0395901_0036295
663 Ga0395901_0039112
664 Ga0395901_0061179
665 Ga0395901_0198002
666 Ga0395901_0208489
667 Ga0436365_0541924
668 Ga0436365_1025500
669 Ga0436363_0811128
670 Ga0466965_0039661
671 Ga0466966_0077844
672 Ga0466963_0000743
673 Ga0466963_0002011
674 Ga0466963_0002261
675 Ga0466963_0005306
676 Ga0466963_0022081
677 Ga0466963_0037996
678 Ga0466963_0038129
679 Ga0466963_0085099
680 Ga0466963_0188349
681 Ga0466963_0190337
682 Ga0466964_0001166
683 Ga0466964_0002975
684 Ga0466964_0007927
685 Ga0466971_0000910
686 Ga0466971_0073826
687 Ga0466968_0025750
688 Ga0466968_0082805
689 Ga0466957_0000349
690 Ga0466957_0165701
691 Ga0466959_0024411
692 Ga0466959_0037515
693 Ga0466959_0040059
694 Ga0466959_0220180
695 Ga0466958_0000685
696 Ga0466958_0008053
697 Ga0466958_0041111
698 Ga0466958_0045639
699 Ga0466958_0103287
700 Ga0466967_0000265
701 Ga0466967_0001447
702 Ga0466967_0003034
703 Ga0466967_0020418
704 Ga0466967_0027269
705 Ga0466967_0029029
706 Ga0466967_0030138
707 Ga0466967_0039010
708 Ga0466967_0076865
709 Ga0466967_0088367
710 Ga0466967_0090581
711 Ga0466967_0091674
712 Ga0466967_0097322
713 Ga0466967_0103428
714 Ga0466967_0320404
715 Ga0466967_0421908
716 Ga0495592_0120855
717 Ga0495592_0181366
718 Ga0495603_0052007
719 Ga0495629_0000880
720 Ga0495629_0005900
721 Ga0495629_0019051
722 Ga0495629_0024608
723 Ga0495629_0040376
724 Ga0495641_0000552
725 Ga0495641_0010756
726 Ga0495651_0036649
727 Ga0495651_0042661
728 Ga0495653_0004479
729 Ga0495653_0041472
730 Ga0495580_0040093
731 Ga0495582_0000240
732 Ga0495582_0002155
733 Ga0495582_0049297
734 Ga0495639_0004699
735 Ga0495639_0006485
736 Ga0495662_0000631
737 Ga0495662_0001469
738 Ga0495664_0073616
739 Ga0495664_0078272
740 Ga0495594_0065647
741 Ga0495596_0069181
742 Ga0495608_0018577
743 Ga0495608_0019392
744 Ga0495618_0007052
745 Ga0495628_0096663
746 Ga0495628_0205377
747 Ga0495630_0001891
748 Ga0495630_0007883
749 Ga0495630_0017389
750 Ga0495630_0034360
751 Ga0495630_0056464
752 Ga0495666_0000169
753 Ga0495666_0007316
754 Ga0495652_0006606
755 Ga0495665_0000685
756 Ga0495665_0006818
757 Ga0495665_0118339
758 Ga0495640_0007017
759 Ga0495640_0011644
760 Ga0495640_0062648
761 Ga0495640_0121200
762 Ga0495586_0001729
763 Ga0495586_0006318
764 Ga0495645_0028912
765 Ga0495667_0030843
766 Ga0495667_0081589
767 Ga0495667_0118683
768 Ga0495656_0006186
769 Ga0495634_0003944
770 Ga0495634_0013945
771 Ga0495634_0037770
772 Ga0495635_0007519
773 Ga0495599_0099622
774 Ga0495647_0000214
775 Ga0495647_0045891
776 Ga0495658_0000272
777 Ga0495658_0000782
778 Ga0495658_0178670
779 Ga0495613_0003786
780 Ga0495613_0005472
781 Ga0495613_0015795
782 Ga0495613_0028196
783 Ga0495624_0000454
784 Ga0495624_0009739
785 Ga0495600_0001921
786 Ga0495581_0000754
787 Ga0495581_0002824
788 Ga0495581_0052011
789 Ga0495604_0094257
790 Ga0495604_0130763
791 Ga0495604_0147667
792 Ga0495674_0001969
793 Ga0495674_0061472
794 Ga0495674_0063438
795 Ga0495676_0000116
796 Ga0495676_0009601
797 Ga0495680_0001092
798 Ga0495680_0007595
799 Ga0495680_0015852
800 Ga0495680_0019294
801 Ga0495680_0116849
802 Ga0495684_0019534
803 Ga0495684_0035612
804 Ga0495684_0128333
805 Ga0495593_0000504
806 Ga0495593_0011497
807 Ga0495602_0073218
808 Ga0495602_0157320
809 Ga0495614_0000711
810 Ga0495614_0050118
811 Ga0496100_0003870
812 Ga0496100_0004075
813 Ga0496100_0012535
814 Ga0496100_0067326
815 Ga0496101_0004080
816 Ga0496101_0017786
817 Ga0496101_0030729
818 Ga0496101_0045591
819 Ga0496101_0046772
820 Ga0496101_0071160
821 Ga0496102_0004317
822 Ga0496102_0093619
823 Ga0496103_0019241
824 Ga0496104_0000319
825 Ga0496104_0002950
826 Ga0496104_0033278
827 Ga0496104_0115739
828 Ga0496104_0265960
829 Ga0496105_0000194
830 Ga0496105_0006495
831 Ga0496105_0029002
832 Ga0496105_0068171
833 Ga0496105_0242168
834 Ga0496106_0007207
835 Ga0496106_0022319
836 Ga0496106_0035961
837 Ga0496107_0005507
838 Ga0496107_0097619
839 Ga0496107_0108987
840 Ga0496108_0000971
841 Ga0496108_0006063
842 Ga0496108_0115730
843 Ga0496109_0001518
844 Ga0496109_0005058
845 Ga0496110_0000757
846 Ga0496110_0002108
847 Ga0496110_0167225
848 Ga0496111_0000359
849 Ga0496111_0034872
850 Ga0496111_0059920
851 Ga0496111_0069480
852 Ga0496112_0009458
853 Ga0496112_0355826
854 Ga0496113_0024554
855 Ga0496114_0010899
856 Ga0496114_0024067
857 Ga0496114_0051933
858 Ga0496114_0105052
859 Ga0496114_0140366
860 Ga0496115_0000431
861 Ga0496115_0003315
862 Ga0496115_0006946
863 Ga0496115_0010047
864 Ga0496115_0043294
865 Ga0496115_0043866
866 Ga0496115_0080110
867 Ga0501031_0032650
868 Ga0501036_0092450
869 Ga0501039_0098372
870 Ga0501041_0011624
871 Ga0501042_0049994
872 Ga0501046_0123402
873 Ga0501047_0030861
874 Ga0501047_0066004
875 Ga0501047_0106973
876 Ga0501067_0000208
877 Ga0501069_0058073
878 Ga0501069_0060983
879 Ga0501069_0080303
880 Ga0501070_0000499
881 Ga0501071_0055002
882 Ga0501073_0146944
883 Ga0501074_0024071
884 Ga0501075_0061915
885 Ga0501079_0001382
886 Ga0501080_0020932
887 Ga0501080_0047731
888 Ga0501081_0067478
889 Ga0501081_0237672
890 Ga0501083_0131519
891 Ga0501044_0122443
892 nmdc:mga05p37_172096_c1
893 nmdc:mga0n895_163012_c1
894 nmdc:mga0a205_5451_c1
895 Ga0495601_0002006
896 Ga0495601_0052603
897 Ga0495601_0076567
898 Ga0495595_0010409
899 Ga0495595_0071900
900 Ga0495619_0027625
901 Ga0495619_0033979
902 Ga0495619_0092659
903 Ga0495619_0124252
904 Ga0500566_0033743
905 Ga0501084_0082365
906 Ga0501084_0197706
907 Ga0501082_0086281
908 Ga0466962_0000178
909 Ga0466962_0010222
910 Ga0466962_0016127
911 Ga0530510_0107626
912 Ga0530510_0281462

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

7

68

0.99

PF01556

DnaJ_C

DnaJ C terminal domain

189

325

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jmg-assembly2.cif.gz_B crystal structure of xrbj 0.9763 4 56
8gym-assembly1.cif.gz_j1 cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2 0.9631 4 67
2dn9-assembly1.cif.gz_A solution structure of j-domain from the dnaj homolog, human tid1 protein 0.9626 5 69
5ayl-assembly1.cif.gz_A crystal structure of erdj5 form ii 0.9621 5 69
2ys8-assembly1.cif.gz_A solution structure of the dnaj-like domain from human ras-associated protein rap1 0.9591 4 57
ID Description Score Start End Superfamily
af_K7N008_53_137_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9882 5 67 1.10.287.110
af_Q6IML7_191_273_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9854 4 56 1.10.287.110
4wb7A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9799 4 58 1.10.287.110
af_Q54KN8_591_701_2.60.260.20 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9771 232 326 2.60.260.20
4wb7B01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9768 4 58 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A7M7G571-F1-model_v4 DnaJ homolog subfamily C member 16 (Endoplasmic reticulum DNA J domain-containing protein 8) 0.9706 1 69 GO:0005789
GO:0006914
AF-A0A523NN38-F1-model_v4 J domain-containing protein 0.9526 229 326 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6L8ZA96-F1-model_v4 deleted 0.9443 194 328
AF-A0A7Y1XJL3-F1-model_v4 DnaJ domain-containing protein 0.9433 1 69 GO:0036503
GO:0051087
GO:0051787
AF-B0E6A5-F1-model_v4 J domain-containing protein 0.9425 3 76 GO:0005783
GO:0016020
GO:0036503
GO:0051087
GO:0051787

Map