F447783

General Info

Members Datasets Scaffolds Average Seq Length
456 256 433 151

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10182986|Ga0213876_101829862
Length 180
Sequence MSGDTPSAPRSLAEAYEQLEAQAKAKPAEPPLSSKARRARTVARLAAVQALYQMEIGGAGVEAVIREFADFRFEADLEDRLLADADEDFFAAIVRGAVEHQHGVDQAIAKRLAQGWRLDRIDATLRAMFRAGTYELMHRPDVPTEVAIDEYVEIAKSFFEGPEPGFVNGALDGIARDVRG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
17 2849560528 Caulobacter zeae 410 Isolate Unclassified
18 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
19 2851153111 Caulobacter radicis 736 Isolate Unclassified
20 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
21 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
22 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
23 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
145 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
148 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
161 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
162 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
163 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
164 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
167 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
168 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
184 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
198 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
199 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
217 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
218 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
219 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
224 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
225 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
229 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
232 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
233 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
234 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
235 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
238 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
239 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
243 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
246 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
249 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
250 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
251 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
252 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
253 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
254 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
255 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
256 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.46
Nodule 0
Rhizoplane 2.63
Rhizosphere 64.91
Stem 0
Stem Tuber 0
Unclassified 8.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055537_1001849 3300003773 Bacteria 7643
2 Ga0055536_1039668 3300003781 Bacteria 1128
3 Ga0055536_1039936 3300003781 Bacteria 1122
4 Ga0055530_10005476 3300003791 Bacteria 6015
5 Ga0055530_10042110 3300003791 Bacteria 1110
6 Ga0055531_10006551 3300003794 Bacteria 6588
7 Ga0055531_10073415 3300003794 Bacteria 780
8 Ga0065165_1000911 3300005262 Bacteria 38161
9 Ga0070658_10072478 3300005327 Bacteria 2823
10 Ga0070658_10176324 3300005327 Bacteria 1797
11 Ga0070676_10523096 3300005328 Bacteria 845
12 Ga0070670_100000039 3300005331 Bacteria 152618
13 Ga0070670_100066765 3300005331 Bacteria 3087
14 Ga0070670_100099982 3300005331 Bacteria 2496
15 Ga0068868_100586243 3300005338 Bacteria 986
16 Ga0070668_100001314 3300005347 Bacteria 17796
17 Ga0070668_100008342 3300005347 Bacteria 7694
18 Ga0070668_100092997 3300005347 Bacteria 2379
19 Ga0070669_100017499 3300005353 Bacteria 5112
20 Ga0070669_100111916 3300005353 Bacteria 2072
21 Ga0070671_100052127 3300005355 Bacteria 3403
22 Ga0070659_100019177 3300005366 Bacteria 5177
23 Ga0070667_100000164 3300005367 Bacteria 82930
24 Ga0070667_100008541 3300005367 Bacteria 8490
25 Ga0070667_100009378 3300005367 Bacteria 8116
26 Ga0070713_101800839 3300005436 Bacteria 594
27 Ga0070663_100183025 3300005455 Bacteria 1627
28 Ga0070663_100743160 3300005455 Bacteria 837
29 Ga0070679_101209787 3300005530 Bacteria 701
30 Ga0068853_100242168 3300005539 Bacteria 1653
31 Ga0070672_100641328 3300005543 Bacteria 927
32 Ga0070686_101031214 3300005544 Bacteria 676
33 Ga0070665_100000489 3300005548 Bacteria 56677
34 Ga0070665_100046995 3300005548 Bacteria 4332
35 Ga0070665_100057710 3300005548 Bacteria 3892
36 Ga0070665_100747881 3300005548 Bacteria 991
37 Ga0068855_100012184 3300005563 Bacteria 10392
38 Ga0068855_100135152 3300005563 Bacteria 2814
39 Ga0068855_100327404 3300005563 Bacteria 1692
40 Ga0068855_101045651 3300005563 Bacteria 856
41 Ga0070664_100020803 3300005564 Bacteria 5405
42 Ga0068854_101017910 3300005578 Unclassified 734
43 Ga0068852_100006205 3300005616 Bacteria 8617
44 Ga0068852_100944855 3300005616 Bacteria 880
45 Ga0068859_100007694 3300005617 Bacteria 10942
46 Ga0068859_100074718 3300005617 Bacteria 3428
47 Ga0068859_100198810 3300005617 Bacteria 2089
48 Ga0068859_102304441 3300005617 Bacteria 594
49 Ga0068864_100000068 3300005618 Bacteria 115507
50 Ga0068864_100000115 3300005618 Bacteria 79542
51 Ga0068864_100637010 3300005618 Bacteria 1037
52 Ga0068864_100825912 3300005618 Bacteria 912
53 Ga0068861_100103396 3300005719 Bacteria 2270
54 Ga0068861_100460953 3300005719 Bacteria 1141
55 Ga0068861_101373609 3300005719 Bacteria 689
56 Ga0068863_100000007 3300005841 Bacteria 257578
57 Ga0068863_100012835 3300005841 Bacteria 8079
58 Ga0068863_100015866 3300005841 Bacteria 7226
59 Ga0068863_100051273 3300005841 Bacteria 3911
60 Ga0068863_100348797 3300005841 Bacteria 1441
61 Ga0068858_100000031 3300005842 Bacteria 143397
62 Ga0068858_100002686 3300005842 Bacteria 17901
63 Ga0068858_100007071 3300005842 Bacteria 10894
64 Ga0068858_100217668 3300005842 Bacteria 1808
65 Ga0068860_100000625 3300005843 Bacteria 41833
66 Ga0068860_100026830 3300005843 Bacteria 5550
67 Ga0068860_100042258 3300005843 Bacteria 4354
68 Ga0068862_100001908 3300005844 Bacteria 18938
69 Ga0068862_100019762 3300005844 Bacteria 5626
70 Ga0068862_100030528 3300005844 Bacteria 4542
71 Ga0075367_10759934 3300006178 Bacteria 617
72 Ga0075369_10007617 3300006186 Bacteria 4136
73 Ga0075366_10031053 3300006195 Bacteria 3143
74 Ga0075366_10191926 3300006195 Bacteria 1241
75 Ga0075366_11078929 3300006195 Bacteria 501
76 Ga0068865_100273499 3300006881 Bacteria 1342
77 Ga0097620_100007694 3300006931 Bacteria 10942
78 Ga0097620_100074716 3300006931 Bacteria 3428
79 Ga0097620_100198806 3300006931 Bacteria 2089
80 Ga0097620_102304606 3300006931 Bacteria 594
81 Ga0105250_10014477 3300009092 Bacteria 3241
82 Ga0105240_10105361 3300009093 Bacteria 3423
83 Ga0105240_11682467 3300009093 Bacteria 663
84 Ga0105247_10318460 3300009101 Bacteria 1084
85 Ga0105243_10708652 3300009148 Bacteria 982
86 Ga0105248_10031199 3300009177 Bacteria 5956
87 Ga0105248_10039633 3300009177 Bacteria 5279
88 Ga0105248_10066598 3300009177 Bacteria 4044
89 Ga0105248_10117460 3300009177 Bacteria 3000
90 Ga0105249_10001181 3300009553 Bacteria 23119
91 Ga0105239_11441154 3300010375 Bacteria 795
92 Ga0157327_1016883 3300012512 Bacteria 777
93 Ga0157373_10002645 3300013100 Bacteria 13586
94 Ga0157370_10129336 3300013104 Bacteria 2356
95 Ga0157369_10358236 3300013105 Bacteria 1515
96 Ga0157374_10216845 3300013296 Bacteria 1877
97 Ga0163162_10268722 3300013306 Bacteria 1837
98 Ga0163162_10487182 3300013306 Bacteria 1364
99 Ga0163162_10591445 3300013306 Bacteria 1236
100 Ga0157372_10356173 3300013307 Bacteria 1705
101 Ga0157372_12746740 3300013307 Bacteria 565
102 Ga0157375_10867734 3300013308 Bacteria 1048
103 Ga0163163_10018714 3300014325 Bacteria 6490
104 Ga0163163_10040269 3300014325 Bacteria 4563
105 Ga0163163_10226615 3300014325 Bacteria 1918
106 Ga0163163_11299881 3300014325 Bacteria 789
107 Ga0163163_11579633 3300014325 Bacteria 717
108 Ga0182008_10239445 3300014497 Bacteria 933
109 Ga0157379_10000909 3300014968 Bacteria 23893
110 Ga0157379_10024695 3300014968 Bacteria 5334
111 Ga0157379_11210715 3300014968 Bacteria 727
112 Ga0163161_11044212 3300017792 Bacteria 700
113 Ga0213876_10129239 3300021384 Bacteria 1342
114 Ga0213876_10182986 3300021384 Bacteria 1114
115 Ga0209026_1000477 3300025250 Bacteria 30249
116 Ga0209148_1008328 3300025254 Bacteria 2090
117 Ga0209565_1000392 3300025263 Bacteria 36920
118 Ga0209673_1002199 3300025273 Bacteria 14296
119 Ga0209673_1057664 3300025273 Bacteria 988
120 Ga0209675_1005101 3300025291 Bacteria 5603
121 Ga0209676_1000031 3300025292 Bacteria 478976
122 Ga0209676_1000391 3300025292 Bacteria 80028
123 Ga0209564_1000667 3300025295 Bacteria 50734
124 Ga0209564_1024270 3300025295 Bacteria 2076
125 Ga0209564_1030590 3300025295 Bacteria 1665
126 Ga0209758_1006495 3300025297 Bacteria 8364
127 Ga0209758_1006985 3300025297 Bacteria 7860
128 Ga0209050_1001337 3300025298 Bacteria 27313
129 Ga0209050_1006784 3300025298 Bacteria 6674
130 Ga0209050_1033427 3300025298 Bacteria 1559
131 Ga0209256_1005130 3300025299 Bacteria 7751
132 Ga0209256_1007782 3300025299 Bacteria 5169
133 Ga0209256_1038409 3300025299 Bacteria 1241
134 Ga0209051_1004749 3300025303 Bacteria 8221
135 Ga0209257_1000264 3300025304 Bacteria 120518
136 Ga0209257_1000625 3300025304 Bacteria 56966
137 Ga0209257_1013303 3300025304 Bacteria 3680
138 Ga0207696_1011282 3300025711 Bacteria 3229
139 Ga0207680_10423623 3300025903 Bacteria 943
140 Ga0207705_10060478 3300025909 Bacteria 2736
141 Ga0207705_10706752 3300025909 Bacteria 783
142 Ga0207707_10025726 3300025912 Bacteria 5148
143 Ga0207695_10010898 3300025913 Bacteria 11064
144 Ga0207660_10112819 3300025917 Bacteria 2048
145 Ga0207652_10451550 3300025921 Bacteria 1159
146 Ga0207681_10058520 3300025923 Bacteria 2639
147 Ga0207681_10293852 3300025923 Bacteria 1283
148 Ga0207650_10000099 3300025925 Bacteria 113522
149 Ga0207650_10110396 3300025925 Bacteria 2128
150 Ga0207650_10249422 3300025925 Bacteria 1437
151 Ga0207644_10023439 3300025931 Bacteria 4228
152 Ga0207644_10071254 3300025931 Bacteria 2542
153 Ga0207644_11667993 3300025931 Bacteria 534
154 Ga0207690_10019805 3300025932 Bacteria 4148
155 Ga0207711_10002202 3300025941 Bacteria 17507
156 Ga0207711_10008270 3300025941 Bacteria 8709
157 Ga0207711_10010573 3300025941 Bacteria 7671
158 Ga0207711_10050004 3300025941 Bacteria 3579
159 Ga0207679_10025200 3300025945 Bacteria 4088
160 Ga0207667_10013885 3300025949 Bacteria 9202
161 Ga0207667_10102522 3300025949 Bacteria 2952
162 Ga0207712_10000810 3300025961 Bacteria 23035
163 Ga0207668_10000413 3300025972 Bacteria 26960
164 Ga0207668_10005338 3300025972 Bacteria 7560
165 Ga0207668_10009302 3300025972 Bacteria 5882
166 Ga0207658_10000106 3300025986 Bacteria 90920
167 Ga0207658_10069476 3300025986 Bacteria 2661
168 Ga0207658_10132060 3300025986 Bacteria 2007
169 Ga0207703_10000038 3300026035 Bacteria 175917
170 Ga0207703_10002283 3300026035 Bacteria 16717
171 Ga0207703_10083855 3300026035 Bacteria 2664
172 Ga0207703_10353006 3300026035 Bacteria 1354
173 Ga0207639_10149620 3300026041 Bacteria 1954
174 Ga0207678_10188423 3300026067 Bacteria 1762
175 Ga0207678_10302637 3300026067 Bacteria 1374
176 Ga0207702_10810582 3300026078 Bacteria 925
177 Ga0207702_11063394 3300026078 Bacteria 803
178 Ga0207702_11415675 3300026078 Bacteria 689
179 Ga0207641_10000012 3300026088 Bacteria 375486
180 Ga0207641_10002857 3300026088 Bacteria 15687
181 Ga0207641_10095223 3300026088 Bacteria 2613
182 Ga0207641_10213781 3300026088 Bacteria 1784
183 Ga0207641_10364529 3300026088 Bacteria 1380
184 Ga0207676_10000119 3300026095 Bacteria 69303
185 Ga0207676_10000610 3300026095 Bacteria 29371
186 Ga0207676_10756411 3300026095 Bacteria 945
187 Ga0207675_100139706 3300026118 Bacteria 2301
188 Ga0207675_100231530 3300026118 Bacteria 1783
189 Ga0207698_10747423 3300026142 Bacteria 977
190 Ga0268266_10004729 3300028379 Bacteria 12943
191 Ga0268266_10052251 3300028379 Bacteria 3509
192 Ga0268266_10144080 3300028379 Bacteria 2140
193 Ga0268266_10184589 3300028379 Bacteria 1901
194 Ga0268265_10003868 3300028380 Bacteria 10572
195 Ga0268265_10038332 3300028380 Bacteria 3525
196 Ga0268265_10041590 3300028380 Bacteria 3403
197 Ga0268264_10000059 3300028381 Bacteria 306927
198 Ga0268264_10034926 3300028381 Bacteria 4138
199 Ga0268264_10038712 3300028381 Bacteria 3937
200 Ga0307517_10012217 3300028786 Bacteria 11814
201 Ga0307517_10143126 3300028786 Bacteria 1670
202 Ga0307515_10184073 3300028794 Bacteria 2026
203 Ga0307515_10368791 3300028794 Bacteria 1073
204 Ga0265338_10050898 3300028800 Bacteria 3738
205 Ga0265338_10225573 3300028800 Bacteria 1397
206 Ga0265338_10434083 3300028800 Bacteria 932
207 Ga0265340_10023067 3300031247 Bacteria 3175
208 Ga0265327_10000166 3300031251 Bacteria 141539
209 Ga0265327_10000758 3300031251 Bacteria 50091
210 Ga0265327_10001144 3300031251 Bacteria 36241
211 Ga0307513_10025779 3300031456 Bacteria 6800
212 Ga0307513_10027970 3300031456 Bacteria 6461
213 Ga0307508_10288900 3300031616 Bacteria 1233
214 Ga0265314_10112022 3300031711 Bacteria 1732
215 Ga0307407_10093419 3300031903 Bacteria 1850
216 Ga0307409_100275011 3300031995 Bacteria 1553
217 Ga0307416_101898020 3300032002 Bacteria 699
218 Ga0307416_103166363 3300032002 Bacteria 551
219 Ga0307411_10309803 3300032005 Bacteria 1270
220 Ga0307510_10056604 3300033180 Bacteria 4080
221 Ga0373935_0103270 3300035692 Bacteria 1882
222 Ga0373937_0561592 3300036401 Bacteria 1084
223 Ga0373925_0050501 3300037068 Bacteria 3102
224 Ga0395899_0000100 3300037312 Bacteria 151710
225 Ga0395899_0136232 3300037312 Bacteria 1750
226 Ga0395900_0000009 3300037418 Bacteria 476249
227 Ga0395900_0029418 3300037418 Bacteria 5635
228 Ga0395900_0137456 3300037418 Bacteria 2504
229 Ga0395900_0660470 3300037418 Bacteria 981
230 Ga0395898_0101595 3300037466 Bacteria 2761
231 Ga0395898_0154842 3300037466 Bacteria 2192
232 Ga0395898_0294024 3300037466 Bacteria 1549
233 Ga0395905_0016592 3300037471 Bacteria 6999
234 Ga0395905_0086901 3300037471 Bacteria 2931
235 Ga0395905_0293926 3300037471 Bacteria 1511
236 Ga0436364_0700085 3300037853 Bacteria 2114
237 Ga0395901_0000014 3300038443 Bacteria 375100
238 Ga0395901_0627504 3300038443 Bacteria 1081
239 Ga0395901_0987737 3300038443 Bacteria 818
240 Ga0395901_1208540 3300038443 Bacteria 721
241 Ga0436365_0021072 3300039437 Bacteria 1155
242 Ga0436365_0946242 3300039437 Bacteria 671
243 Ga0436365_1139091 3300039437 Bacteria 1346
244 Ga0436360_1006068 3300039438 Bacteria 642
245 Ga0436360_1044028 3300039438 Bacteria 2640
246 Ga0439445_0124216 3300042004 Bacteria 742
247 Ga0439446_0016071 3300042156 Bacteria 2082
248 Ga0439435_0044745 3300042436 Bacteria 1249
249 Ga0439459_0005106 3300042438 Bacteria 2143
250 Ga0466969_0455558 3300044656 Bacteria 582
251 Ga0466965_0272799 3300044683 Bacteria 912
252 Ga0495627_000360 3300046453 Bacteria 42630
253 Ga0495590_0007815 3300046457 Bacteria 4104
254 Ga0495629_0074451 3300046459 Bacteria 2371
255 Ga0495638_0001615 3300046460 Bacteria 20105
256 Ga0495638_0011171 3300046460 Bacteria 6201
257 Ga0495638_0043980 3300046460 Bacteria 2815
258 Ga0495638_0046994 3300046460 Bacteria 2709
259 Ga0495650_0063483 3300046471 Bacteria 1472
260 Ga0495596_0418944 3300046500 Bacteria 522
261 Ga0495583_0017377 3300046506 Bacteria 3822
262 Ga0495606_0092220 3300046507 Bacteria 1861
263 Ga0495610_0001891 3300046512 Bacteria 18089
264 Ga0495610_0002172 3300046512 Bacteria 16661
265 Ga0495610_0096975 3300046512 Bacteria 1327
266 Ga0495616_0001376 3300046513 Bacteria 16933
267 Ga0495616_0101355 3300046513 Bacteria 1350
268 Ga0495616_0397914 3300046513 Bacteria 566
269 Ga0495620_0024475 3300046515 Bacteria 2871
270 Ga0495631_0004495 3300046518 Bacteria 7417
271 Ga0495631_0166869 3300046518 Bacteria 944
272 Ga0495631_0247393 3300046518 Bacteria 760
273 Ga0495632_0006957 3300046519 Bacteria 7178
274 Ga0495637_0014631 3300046520 Bacteria 3698
275 Ga0495643_0051866 3300046522 Bacteria 2205
276 Ga0495643_0146698 3300046522 Bacteria 1172
277 Ga0495648_0000724 3300046524 Bacteria 35198
278 Ga0495648_0059322 3300046524 Bacteria 2283
279 Ga0495654_0000109 3300046530 Bacteria 93356
280 Ga0495597_0012714 3300046542 Bacteria 4054
281 Ga0495597_0035166 3300046542 Bacteria 2261
282 Ga0495597_0049386 3300046542 Bacteria 1859
283 Ga0495597_0079256 3300046542 Bacteria 1407
284 Ga0495622_0009433 3300046557 Bacteria 4514
285 Ga0495622_0204119 3300046557 Bacteria 880
286 Ga0495633_0156162 3300046558 Bacteria 1053
287 Ga0495668_0000039 3300046616 Bacteria 231402
288 Ga0495668_0007592 3300046616 Bacteria 6917
289 Ga0495668_0008982 3300046616 Bacteria 6171
290 Ga0495668_0076912 3300046616 Bacteria 1832
291 Ga0495668_0087740 3300046616 Bacteria 1705
292 Ga0495668_0103975 3300046616 Bacteria 1554
293 Ga0495668_0109496 3300046616 Bacteria 1511
294 Ga0495668_0295823 3300046616 Bacteria 887
295 Ga0495611_0013778 3300046648 Bacteria 3447
296 Ga0495611_0192781 3300046648 Bacteria 951
297 Ga0495625_0000271 3300046660 Bacteria 80817
298 Ga0495625_0011581 3300046660 Bacteria 7178
299 Ga0495625_0025386 3300046660 Bacteria 4495
300 Ga0495625_0033287 3300046660 Bacteria 3813
301 Ga0495625_0119985 3300046660 Bacteria 1790
302 Ga0495635_0388780 3300046663 Bacteria 928
303 Ga0495658_0726525 3300046683 Bacteria 636
304 Ga0495613_0004569 3300046689 Bacteria 10382
305 Ga0495613_0499328 3300046689 Bacteria 819
306 Ga0495671_0141405 3300046692 Bacteria 1173
307 Ga0495589_0091238 3300046794 Bacteria 1479
308 Ga0495660_0006079 3300046810 Bacteria 7169
309 Ga0495660_0067514 3300046810 Bacteria 1904
310 Ga0495660_0126277 3300046810 Bacteria 1288
311 Ga0495581_0469195 3300047315 Bacteria 732
312 Ga0495672_0001875 3300047320 Bacteria 20021
313 Ga0495672_0041690 3300047320 Bacteria 2774
314 Ga0495687_127410 3300047443 Bacteria 907
315 Ga0495677_0147913 3300047445 Bacteria 904
316 Ga0495679_031945 3300047446 Bacteria 1694
317 Ga0495673_0000189 3300047469 Bacteria 99018
318 Ga0495673_0000296 3300047469 Bacteria 66691
319 Ga0495673_0005796 3300047469 Bacteria 7394
320 Ga0495681_0080598 3300047470 Bacteria 1454
321 Ga0495681_0186773 3300047470 Bacteria 848
322 Ga0495686_0001394 3300047472 Bacteria 26804
323 Ga0495686_0003688 3300047472 Bacteria 13088
324 Ga0495686_0051600 3300047472 Bacteria 2580
325 Ga0495686_0281928 3300047472 Bacteria 923
326 Ga0495593_0099419 3300047673 Bacteria 1493
327 Ga0495602_0113582 3300048088 Bacteria 2195
328 Ga0496100_0565828 3300048903 Bacteria 880
329 Ga0496100_0917034 3300048903 Bacteria 688
330 Ga0496101_0090971 3300048904 Bacteria 2270
331 Ga0496102_0233153 3300048905 Bacteria 1735
332 Ga0496106_0030438 3300048909 Bacteria 4025
333 Ga0496106_0786800 3300048909 Bacteria 755
334 Ga0496106_0944790 3300048909 Bacteria 680
335 Ga0496107_0000037 3300048910 Bacteria 78089
336 Ga0496114_1511939 3300048917 Bacteria 559
337 Ga0496115_0005281 3300048918 Bacteria 9392
338 Ga0496115_0090930 3300048918 Bacteria 2494
339 Ga0496115_0628815 3300048918 Bacteria 851
340 Ga0496116_0170323 3300048919 Bacteria 1181
341 Ga0496117_0093756 3300048920 Bacteria 1924
342 Ga0496118_0005891 3300048921 Bacteria 13725
343 Ga0496119_0023770 3300048922 Bacteria 4334
344 Ga0496121_0000009 3300048924 Bacteria 836971
345 Ga0496121_0028692 3300048924 Bacteria 5174
346 Ga0496121_0136551 3300048924 Bacteria 1826
347 Ga0496122_0189095 3300048925 Bacteria 1218
348 Ga0496123_0227607 3300048926 Bacteria 936
349 Ga0496123_0338563 3300048926 Bacteria 704
350 Ga0496124_0074078 3300048927 Bacteria 2815
351 Ga0496125_0068479 3300048928 Bacteria 2792
352 Ga0496126_0005629 3300048929 Bacteria 14247
353 Ga0495678_001148 3300049459 Bacteria 22016
354 Ga0495682_0120298 3300049460 Bacteria 940
355 Ga0501047_0001192 3300049581 Bacteria 25737
356 Ga0501047_0362060 3300049581 Bacteria 1286
357 Ga0501047_0624381 3300049581 Bacteria 898
358 Ga0501070_0328264 3300049586 Bacteria 1244
359 Ga0501035_0005859 3300049822 Bacteria 11581
360 Ga0501035_0188528 3300049822 Bacteria 1774
361 Ga0501044_0768810 3300049823 Bacteria 844
362 nmdc:mga0k408_40641_c1 3300050493 Bacteria 2677
363 nmdc:mga0k408_54130_c1 3300050493 Bacteria 2326
364 nmdc:mga0sz30_4746_c2 3300050516 Bacteria 3327
365 Ga0500635_0001089 3300053080 Bacteria 6493
366 Ga0500578_0000035 3300053086 Bacteria 136406
367 Ga0500578_0256426 3300053086 Bacteria 1052
368 Ga0500643_139230 3300053087 Bacteria 652
369 Ga0500644_0000341 3300053088 Bacteria 23674
370 Ga0500647_0003051 3300053091 Bacteria 6424
371 Ga0500651_0042521 3300053093 Bacteria 2863
372 Ga0500566_0023945 3300053094 Bacteria 3586
373 Ga0500641_0012436 3300053096 Bacteria 3108
374 Ga0500641_0029077 3300053096 Bacteria 2163
375 Ga0500650_0073471 3300053098 Bacteria 1599
376 Ga0500554_006594 3300053102 Bacteria 2615
377 Ga0500555_027703 3300053103 Bacteria 1616
378 Ga0500555_108149 3300053103 Bacteria 701
379 Ga0500556_0000111 3300053104 Bacteria 72589
380 Ga0500556_0061008 3300053104 Bacteria 1389
381 Ga0500562_000348 3300053108 Bacteria 11115
382 Ga0500562_005290 3300053108 Bacteria 3242
383 Ga0500562_009904 3300053108 Bacteria 2410
384 Ga0500562_013362 3300053108 Bacteria 2096
385 Ga0500569_001684 3300053109 Bacteria 4216
386 Ga0500572_028022 3300053111 Bacteria 1547
387 Ga0500595_003363 3300053119 Bacteria 7501
388 Ga0500597_291339 3300053120 Bacteria 654
389 Ga0500607_070336 3300053121 Bacteria 1809
390 Ga0500608_000163 3300053122 Bacteria 27612
391 Ga0500608_003023 3300053122 Bacteria 6225
392 Ga0500614_002328 3300053123 Bacteria 4254
393 Ga0500614_155478 3300053123 Bacteria 690
394 Ga0500618_000186 3300053125 Bacteria 51092
395 Ga0500642_0009190 3300053130 Bacteria 3418
396 Ga0500642_0044259 3300053130 Bacteria 1938
397 Ga0500642_0170143 3300053130 Bacteria 1020
398 Ga0500658_0011117 3300053134 Bacteria 3316
399 Ga0500559_0000035 3300053136 Bacteria 110851
400 Ga0500559_0000324 3300053136 Bacteria 36134
401 Ga0500559_0005509 3300053136 Bacteria 5821
402 Ga0500559_0024197 3300053136 Bacteria 2582
403 Ga0500559_0218873 3300053136 Bacteria 898
404 Ga0500561_0165084 3300053137 Bacteria 693
405 Ga0500564_000144 3300053138 Bacteria 18381
406 Ga0500577_0002627 3300053142 Bacteria 4602
407 Ga0500577_0277684 3300053142 Bacteria 730
408 Ga0500588_0053675 3300053146 Bacteria 1267
409 Ga0500603_034823 3300053150 Bacteria 1317
410 Ga0500616_0051455 3300053153 Bacteria 2170
411 Ga0500616_0075245 3300053153 Bacteria 1710
412 Ga0500616_0278750 3300053153 Bacteria 703
413 Ga0500619_012911 3300053154 Bacteria 2198
414 Ga0500619_141612 3300053154 Bacteria 819
415 Ga0500620_025304 3300053155 Bacteria 1825
416 Ga0500622_0000180 3300053156 Bacteria 68052
417 Ga0500622_0007585 3300053156 Bacteria 6145
418 Ga0500622_0013756 3300053156 Bacteria 4359
419 Ga0500627_0051577 3300053158 Bacteria 1794
420 Ga0500638_009580 3300053162 Bacteria 4199
421 Ga0500638_327036 3300053162 Bacteria 579
422 Ga0500639_116936 3300053163 Bacteria 1287
423 Ga0500639_198170 3300053163 Bacteria 866
424 Ga0500636_0014403 3300053177 Bacteria 4651
425 Ga0500636_0135965 3300053177 Bacteria 1365
426 Ga0500636_0470779 3300053177 Bacteria 562
427 Ga0500637_0032237 3300053178 Bacteria 2921
428 Ga0500637_0142924 3300053178 Bacteria 1384
429 Ga0500645_000433 3300053730 Bacteria 28666
430 Ga0500645_002551 3300053730 Bacteria 8022
431 Ga0500552_027863 3300053733 Bacteria 852
432 Ga0500596_002099 3300053735 Bacteria 3966
433 Ga0500661_042595 3300055283 Bacteria 805

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0726525 Ga0495658_0726525_226_609 127
2 3300053120 Ga0500597_291339 Ga0500597_291339_19_402 127
3 3300053733 Ga0500552_027863 Ga0500552_027863_18_401 127
4 3300046500 Ga0495596_0418944 Ga0495596_0418944_21_410 128
5 iso_pu_bacteria 2585428106 2587916898 145
6 iso_pu_bacteria 2643221640 2644225574 145
7 iso_pu_bacteria 2643221642 2644234965 145
8 iso_pu_bacteria 2857504554 2857507603 145
9 iso_pu_bacteria 2884960567 2884964608 145
10 iso_pu_bacteria 2928531327 2928535526 145
11 3300005366 Ga0070659_100019177 Ga0070659_1000191773 146
12 3300005539 Ga0068853_100242168 Ga0068853_1002421682 146
13 3300005564 Ga0070664_100020803 Ga0070664_1000208037 146
14 3300013100 Ga0157373_10002645 Ga0157373_100026459 146
15 3300025932 Ga0207690_10019805 Ga0207690_100198052 146
16 3300025945 Ga0207679_10025200 Ga0207679_100252007 146
17 3300026041 Ga0207639_10149620 Ga0207639_101496203 146
18 iso_pu_bacteria 2791355048 2792462015 147
19 iso_pu_bacteria 2843744320 2843748877 147
20 iso_pu_bacteria 2849560528 2849563075 147
21 iso_pu_bacteria 2849573788 2849578641 147
22 iso_pu_bacteria 2851153111 2851153498 147
23 iso_pu_bacteria 2898329390 2898333569 147
24 3300005347 Ga0070668_100092997 Ga0070668_1000929974 148
25 3300005353 Ga0070669_100111916 Ga0070669_1001119162 148
26 3300005367 Ga0070667_100009378 Ga0070667_1000093783 148
27 3300005617 Ga0068859_100074718 Ga0068859_1000747182 148
28 3300005617 Ga0068859_102304441 Ga0068859_1023044411 148
29 3300005618 Ga0068864_100825912 Ga0068864_1008259122 148
30 3300005719 Ga0068861_100460953 Ga0068861_1004609531 148
31 3300005841 Ga0068863_100051273 Ga0068863_1000512736 148
32 3300005842 Ga0068858_100217668 Ga0068858_1002176684 148
33 3300005843 Ga0068860_100026830 Ga0068860_1000268304 148
34 3300005844 Ga0068862_100030528 Ga0068862_1000305285 148
35 3300006931 Ga0097620_100074716 Ga0097620_1000747162 148
36 3300006931 Ga0097620_102304606 Ga0097620_1023046062 148
37 3300025903 Ga0207680_10423623 Ga0207680_104236232 148
38 3300025923 Ga0207681_10058520 Ga0207681_100585204 148
39 3300025972 Ga0207668_10009302 Ga0207668_100093025 148
40 3300025986 Ga0207658_10132060 Ga0207658_101320603 148
41 3300026078 Ga0207702_11415675 Ga0207702_114156751 148
42 3300026088 Ga0207641_10364529 Ga0207641_103645293 148
43 3300026095 Ga0207676_10756411 Ga0207676_107564112 148
44 3300026118 Ga0207675_100231530 Ga0207675_1002315303 148
45 3300028380 Ga0268265_10041590 Ga0268265_100415903 148
46 3300028381 Ga0268264_10034926 Ga0268264_100349262 148
47 3300046616 Ga0495668_0109496 Ga0495668_0109496_382_828 148
48 3300047472 Ga0495686_0281928 Ga0495686_0281928_164_610 148
49 3300048909 Ga0496106_0944790 Ga0496106_0944790_43_489 148
50 3300049822 Ga0501035_0005859 Ga0501035_0005859_1766_2293 148
51 3300053091 Ga0500647_0003051 Ga0500647_0003051_3755_4201 148
52 3300053096 Ga0500641_0012436 Ga0500641_0012436_2402_2848 148
53 3300053103 Ga0500555_027703 Ga0500555_027703_214_660 148
54 3300053108 Ga0500562_013362 Ga0500562_013362_507_953 148
55 3300053111 Ga0500572_028022 Ga0500572_028022_819_1265 148
56 3300053153 Ga0500616_0075245 Ga0500616_0075245_193_651 148
57 3300053153 Ga0500616_0278750 Ga0500616_0278750_235_681 148
58 3300053156 Ga0500622_0013756 Ga0500622_0013756_296_742 148
59 3300053730 Ga0500645_000433 Ga0500645_000433_26436_26882 148
60 3300003781 Ga0055536_1039668 Ga0055536_10396681 149
61 3300003781 Ga0055536_1039936 Ga0055536_10399361 149
62 3300003791 Ga0055530_10005476 Ga0055530_100054766 149
63 3300003791 Ga0055530_10042110 Ga0055530_100421102 149
64 3300003794 Ga0055531_10006551 Ga0055531_100065516 149
65 3300003794 Ga0055531_10073415 Ga0055531_100734152 149
66 3300005331 Ga0070670_100000039 Ga0070670_10000003966 149
67 3300005331 Ga0070670_100066765 Ga0070670_1000667654 149
68 3300005331 Ga0070670_100099982 Ga0070670_1000999822 149
69 3300005347 Ga0070668_100001314 Ga0070668_10000131419 149
70 3300005347 Ga0070668_100008342 Ga0070668_1000083426 149
71 3300005353 Ga0070669_100017499 Ga0070669_1000174991 149
72 3300005367 Ga0070667_100000164 Ga0070667_10000016466 149
73 3300005367 Ga0070667_100008541 Ga0070667_1000085418 149
74 3300005544 Ga0070686_101031214 Ga0070686_1010312141 149
75 3300005548 Ga0070665_100000489 Ga0070665_10000048962 149
76 3300005548 Ga0070665_100046995 Ga0070665_1000469952 149
77 3300005563 Ga0068855_100135152 Ga0068855_1001351522 149
78 3300005563 Ga0068855_100327404 Ga0068855_1003274042 149
79 3300005563 Ga0068855_101045651 Ga0068855_1010456512 149
80 3300005616 Ga0068852_100944855 Ga0068852_1009448552 149
81 3300005617 Ga0068859_100007694 Ga0068859_10000769410 149
82 3300005617 Ga0068859_100198810 Ga0068859_1001988104 149
83 3300005618 Ga0068864_100000068 Ga0068864_1000000688 149
84 3300005618 Ga0068864_100000115 Ga0068864_10000011567 149
85 3300005719 Ga0068861_100103396 Ga0068861_1001033962 149
86 3300005719 Ga0068861_101373609 Ga0068861_1013736092 149
87 3300005841 Ga0068863_100000007 Ga0068863_100000007110 149
88 3300005841 Ga0068863_100012835 Ga0068863_1000128358 149
89 3300005841 Ga0068863_100015866 Ga0068863_1000158662 149
90 3300005842 Ga0068858_100000031 Ga0068858_10000003150 149
91 3300005842 Ga0068858_100002686 Ga0068858_10000268612 149
92 3300005842 Ga0068858_100007071 Ga0068858_1000070714 149
93 3300005843 Ga0068860_100000625 Ga0068860_10000062548 149
94 3300005843 Ga0068860_100042258 Ga0068860_1000422587 149
95 3300005844 Ga0068862_100001908 Ga0068862_10000190810 149
96 3300005844 Ga0068862_100019762 Ga0068862_1000197625 149
97 3300006178 Ga0075367_10759934 Ga0075367_107599342 149
98 3300006186 Ga0075369_10007617 Ga0075369_100076172 149
99 3300006195 Ga0075366_10031053 Ga0075366_100310534 149
100 3300006195 Ga0075366_11078929 Ga0075366_110789291 149
101 3300006881 Ga0068865_100273499 Ga0068865_1002734992 149
102 3300006931 Ga0097620_100007694 Ga0097620_10000769410 149
103 3300006931 Ga0097620_100198806 Ga0097620_1001988062 149
104 3300009092 Ga0105250_10014477 Ga0105250_100144773 149
105 3300009101 Ga0105247_10318460 Ga0105247_103184602 149
106 3300009148 Ga0105243_10708652 Ga0105243_107086522 149
107 3300009177 Ga0105248_10031199 Ga0105248_100311994 149
108 3300009177 Ga0105248_10039633 Ga0105248_100396334 149
109 3300009177 Ga0105248_10066598 Ga0105248_100665984 149
110 3300009177 Ga0105248_10117460 Ga0105248_101174603 149
111 3300009553 Ga0105249_10001181 Ga0105249_1000118110 149
112 3300013306 Ga0163162_10268722 Ga0163162_102687223 149
113 3300013306 Ga0163162_10591445 Ga0163162_105914452 149
114 3300013307 Ga0157372_12746740 Ga0157372_127467401 149
115 3300013308 Ga0157375_10867734 Ga0157375_108677342 149
116 3300014325 Ga0163163_10018714 Ga0163163_100187144 149
117 3300014325 Ga0163163_10040269 Ga0163163_100402696 149
118 3300014325 Ga0163163_10226615 Ga0163163_102266151 149
119 3300014325 Ga0163163_11579633 Ga0163163_115796332 149
120 3300014968 Ga0157379_10000909 Ga0157379_1000090922 149
121 3300014968 Ga0157379_10024695 Ga0157379_100246955 149
122 3300017792 Ga0163161_11044212 Ga0163161_110442122 149
123 3300021384 Ga0213876_10129239 Ga0213876_101292392 149
124 3300021384 Ga0213876_10182986 Ga0213876_101829862 149
125 3300025250 Ga0209026_1000477 Ga0209026_100047710 149
126 3300025292 Ga0209676_1000031 Ga0209676_100003124 149
127 3300025292 Ga0209676_1000391 Ga0209676_100039169 149
128 3300025295 Ga0209564_1030590 Ga0209564_10305903 149
129 3300025298 Ga0209050_1001337 Ga0209050_10013376 149
130 3300025298 Ga0209050_1006784 Ga0209050_10067843 149
131 3300025299 Ga0209256_1038409 Ga0209256_10384093 149
132 3300025303 Ga0209051_1004749 Ga0209051_10047494 149
133 3300025304 Ga0209257_1000625 Ga0209257_10006256 149
134 3300025304 Ga0209257_1013303 Ga0209257_10133034 149
135 3300025711 Ga0207696_1011282 Ga0207696_10112823 149
136 3300025923 Ga0207681_10293852 Ga0207681_102938521 149
137 3300025925 Ga0207650_10000099 Ga0207650_100000996 149
138 3300025925 Ga0207650_10110396 Ga0207650_101103962 149
139 3300025925 Ga0207650_10249422 Ga0207650_102494222 149
140 3300025931 Ga0207644_10071254 Ga0207644_100712543 149
141 3300025941 Ga0207711_10002202 Ga0207711_100022023 149
142 3300025941 Ga0207711_10008270 Ga0207711_1000827010 149
143 3300025941 Ga0207711_10010573 Ga0207711_100105732 149
144 3300025941 Ga0207711_10050004 Ga0207711_100500043 149
145 3300025949 Ga0207667_10102522 Ga0207667_101025222 149
146 3300025961 Ga0207712_10000810 Ga0207712_1000081022 149
147 3300025972 Ga0207668_10000413 Ga0207668_1000041319 149
148 3300025972 Ga0207668_10005338 Ga0207668_100053385 149
149 3300025986 Ga0207658_10000106 Ga0207658_1000010671 149
150 3300025986 Ga0207658_10069476 Ga0207658_100694761 149
151 3300026035 Ga0207703_10000038 Ga0207703_10000038137 149
152 3300026035 Ga0207703_10002283 Ga0207703_1000228311 149
153 3300026035 Ga0207703_10083855 Ga0207703_100838552 149
154 3300026035 Ga0207703_10353006 Ga0207703_103530062 149
155 3300026078 Ga0207702_10810582 Ga0207702_108105822 149
156 3300026088 Ga0207641_10000012 Ga0207641_10000012199 149
157 3300026088 Ga0207641_10002857 Ga0207641_1000285710 149
158 3300026088 Ga0207641_10213781 Ga0207641_102137812 149
159 3300026095 Ga0207676_10000119 Ga0207676_1000011915 149
160 3300026095 Ga0207676_10000610 Ga0207676_1000061011 149
161 3300026118 Ga0207675_100139706 Ga0207675_1001397064 149
162 3300026142 Ga0207698_10747423 Ga0207698_107474232 149
163 3300028379 Ga0268266_10004729 Ga0268266_100047293 149
164 3300028379 Ga0268266_10052251 Ga0268266_100522512 149
165 3300028380 Ga0268265_10003868 Ga0268265_100038685 149
166 3300028380 Ga0268265_10038332 Ga0268265_100383322 149
167 3300028381 Ga0268264_10000059 Ga0268264_10000059115 149
168 3300028381 Ga0268264_10038712 Ga0268264_100387123 149
169 3300028800 Ga0265338_10434083 Ga0265338_104340831 149
170 3300031251 Ga0265327_10000166 Ga0265327_1000016652 149
171 3300031616 Ga0307508_10288900 Ga0307508_102889002 149
172 3300031903 Ga0307407_10093419 Ga0307407_100934192 149
173 3300031995 Ga0307409_100275011 Ga0307409_1002750112 149
174 3300032002 Ga0307416_101898020 Ga0307416_1018980201 149
175 3300032002 Ga0307416_103166363 Ga0307416_1031663631 149
176 3300032005 Ga0307411_10309803 Ga0307411_103098032 149
177 3300036401 Ga0373937_0561592 Ga0373937_0561592_405_926 149
178 3300037312 Ga0395899_0136232 Ga0395899_0136232_559_1011 149
179 3300037418 Ga0395900_0660470 Ga0395900_0660470_109_576 149
180 3300037466 Ga0395898_0154842 Ga0395898_0154842_1475_1942 149
181 3300037853 Ga0436364_0700085 Ga0436364_0700085_461_979 149
182 3300038443 Ga0395901_0627504 Ga0395901_0627504_568_1017 149
183 3300038443 Ga0395901_0987737 Ga0395901_0987737_208_660 149
184 3300039437 Ga0436365_0021072 Ga0436365_0021072_337_879 149
185 3300039437 Ga0436365_1139091 Ga0436365_1139091_339_788 149
186 3300039438 Ga0436360_1006068 Ga0436360_1006068_29_550 149
187 3300039438 Ga0436360_1044028 Ga0436360_1044028_1125_1577 149
188 3300044656 Ga0466969_0455558 Ga0466969_0455558_89_538 149
189 3300046459 Ga0495629_0074451 Ga0495629_0074451_1204_1653 149
190 3300046507 Ga0495606_0092220 Ga0495606_0092220_176_625 149
191 3300046518 Ga0495631_0247393 Ga0495631_0247393_264_713 149
192 3300046542 Ga0495597_0012714 Ga0495597_0012714_3210_3659 149
193 3300046542 Ga0495597_0049386 Ga0495597_0049386_97_546 149
194 3300046557 Ga0495622_0009433 Ga0495622_0009433_2650_3099 149
195 3300046557 Ga0495622_0204119 Ga0495622_0204119_340_789 149
196 3300046616 Ga0495668_0000039 Ga0495668_0000039_34428_34877 149
197 3300046616 Ga0495668_0008982 Ga0495668_0008982_4110_4559 149
198 3300046616 Ga0495668_0076912 Ga0495668_0076912_802_1251 149
199 3300046616 Ga0495668_0295823 Ga0495668_0295823_183_641 149
200 3300046648 Ga0495611_0192781 Ga0495611_0192781_63_512 149
201 3300046663 Ga0495635_0388780 Ga0495635_0388780_66_515 149
202 3300046689 Ga0495613_0499328 Ga0495613_0499328_33_482 149
203 3300047315 Ga0495581_0469195 Ga0495581_0469195_19_468 149
204 3300047443 Ga0495687_127410 Ga0495687_127410_97_546 149
205 3300047472 Ga0495686_0051600 Ga0495686_0051600_851_1300 149
206 3300047673 Ga0495593_0099419 Ga0495593_0099419_945_1394 149
207 3300048088 Ga0495602_0113582 Ga0495602_0113582_957_1406 149
208 3300048903 Ga0496100_0565828 Ga0496100_0565828_350_799 149
209 3300048903 Ga0496100_0917034 Ga0496100_0917034_83_532 149
210 3300048905 Ga0496102_0233153 Ga0496102_0233153_1053_1502 149
211 3300048909 Ga0496106_0786800 Ga0496106_0786800_119_568 149
212 3300048917 Ga0496114_1511939 Ga0496114_1511939_75_524 149
213 3300048918 Ga0496115_0090930 Ga0496115_0090930_1289_1738 149
214 3300048918 Ga0496115_0628815 Ga0496115_0628815_178_630 149
215 3300048919 Ga0496116_0170323 Ga0496116_0170323_520_969 149
216 3300048920 Ga0496117_0093756 Ga0496117_0093756_411_860 149
217 3300048921 Ga0496118_0005891 Ga0496118_0005891_5136_5585 149
218 3300048922 Ga0496119_0023770 Ga0496119_0023770_2041_2490 149
219 3300048924 Ga0496121_0000009 Ga0496121_0000009_75176_75625 149
220 3300048926 Ga0496123_0338563 Ga0496123_0338563_171_620 149
221 3300048927 Ga0496124_0074078 Ga0496124_0074078_1672_2121 149
222 3300048928 Ga0496125_0068479 Ga0496125_0068479_1526_1975 149
223 3300048929 Ga0496126_0005629 Ga0496126_0005629_13082_13531 149
224 3300049460 Ga0495682_0120298 Ga0495682_0120298_374_823 149
225 3300049581 Ga0501047_0001192 Ga0501047_0001192_3844_4296 149
226 3300050493 nmdc:mga0k408_40641_c1 nmdc:mga0k408_40641_c1_1583_2032 149
227 3300050516 nmdc:mga0sz30_4746_c2 nmdc:mga0sz30_4746_c2_154_603 149
228 3300053080 Ga0500635_0001089 Ga0500635_0001089_4582_5031 149
229 3300053086 Ga0500578_0256426 Ga0500578_0256426_83_532 149
230 3300053093 Ga0500651_0042521 Ga0500651_0042521_1315_1764 149
231 3300053094 Ga0500566_0023945 Ga0500566_0023945_1878_2327 149
232 3300053096 Ga0500641_0029077 Ga0500641_0029077_318_767 149
233 3300053098 Ga0500650_0073471 Ga0500650_0073471_1012_1461 149
234 3300053103 Ga0500555_108149 Ga0500555_108149_229_678 149
235 3300053104 Ga0500556_0061008 Ga0500556_0061008_131_580 149
236 3300053108 Ga0500562_005290 Ga0500562_005290_2583_3032 149
237 3300053109 Ga0500569_001684 Ga0500569_001684_2185_2634 149
238 3300053119 Ga0500595_003363 Ga0500595_003363_4974_5423 149
239 3300053121 Ga0500607_070336 Ga0500607_070336_1120_1569 149
240 3300053122 Ga0500608_000163 Ga0500608_000163_6639_7088 149
241 3300053122 Ga0500608_003023 Ga0500608_003023_3300_3749 149
242 3300053123 Ga0500614_002328 Ga0500614_002328_3042_3491 149
243 3300053130 Ga0500642_0009190 Ga0500642_0009190_106_555 149
244 3300053130 Ga0500642_0044259 Ga0500642_0044259_114_563 149
245 3300053130 Ga0500642_0170143 Ga0500642_0170143_94_543 149
246 3300053136 Ga0500559_0005509 Ga0500559_0005509_2466_2915 149
247 3300053136 Ga0500559_0024197 Ga0500559_0024197_273_722 149
248 3300053137 Ga0500561_0165084 Ga0500561_0165084_135_584 149
249 3300053142 Ga0500577_0277684 Ga0500577_0277684_182_631 149
250 3300053150 Ga0500603_034823 Ga0500603_034823_100_549 149
251 3300053154 Ga0500619_012911 Ga0500619_012911_357_806 149
252 3300053155 Ga0500620_025304 Ga0500620_025304_357_806 149
253 3300053156 Ga0500622_0007585 Ga0500622_0007585_2332_2781 149
254 3300053162 Ga0500638_009580 Ga0500638_009580_3202_3651 149
255 3300053162 Ga0500638_327036 Ga0500638_327036_19_468 149
256 3300053163 Ga0500639_116936 Ga0500639_116936_498_947 149
257 3300053177 Ga0500636_0014403 Ga0500636_0014403_4175_4624 149
258 3300053177 Ga0500636_0470779 Ga0500636_0470779_32_481 149
259 3300053178 Ga0500637_0032237 Ga0500637_0032237_1520_1969 149
260 3300053178 Ga0500637_0142924 Ga0500637_0142924_35_484 149
261 3300053735 Ga0500596_002099 Ga0500596_002099_2683_3132 149
262 iso_pu_bacteria 2510917020 2511122172 149
263 iso_pu_bacteria 2582581279 2585149191 149
264 iso_pu_bacteria 2582581280 2585155109 149
265 iso_pu_bacteria 2582581293 2585199064 149
266 iso_pu_bacteria 2643221545 2643750690 149
267 iso_pu_bacteria 2643221552 2643782034 149
268 iso_pu_bacteria 2643221583 2643926269 149
269 iso_pu_bacteria 2643221584 2643927885 149
270 iso_pu_bacteria 2643221691 2644509764 149
271 iso_pu_bacteria 2818991435 2819535924 149
272 iso_pu_bacteria 2818991454 2819646156 149
273 3300005327 Ga0070658_10072478 Ga0070658_100724782 150
274 3300005328 Ga0070676_10523096 Ga0070676_105230962 150
275 3300005338 Ga0068868_100586243 Ga0068868_1005862431 150
276 3300005530 Ga0070679_101209787 Ga0070679_1012097872 150
277 3300009093 Ga0105240_11682467 Ga0105240_116824671 150
278 3300014325 Ga0163163_11299881 Ga0163163_112998812 150
279 3300025909 Ga0207705_10060478 Ga0207705_100604782 150
280 3300025921 Ga0207652_10451550 Ga0207652_104515502 150
281 3300028800 Ga0265338_10225573 Ga0265338_102255732 150
282 3300031251 Ga0265327_10000758 Ga0265327_1000075825 150
283 3300031456 Ga0307513_10025779 Ga0307513_100257798 150
284 3300031711 Ga0265314_10112022 Ga0265314_101120223 150
285 3300044683 Ga0466965_0272799 Ga0466965_0272799_411_893 150
286 3300046689 Ga0495613_0004569 Ga0495613_0004569_1842_2297 150
287 3300047320 Ga0495672_0041690 Ga0495672_0041690_806_1264 150
288 3300049581 Ga0501047_0362060 Ga0501047_0362060_507_980 150
289 3300049586 Ga0501070_0328264 Ga0501070_0328264_394_867 150
290 3300049822 Ga0501035_0188528 Ga0501035_0188528_103_576 150
291 3300053136 Ga0500559_0000035 Ga0500559_0000035_105895_106353 150
292 3300053136 Ga0500559_0218873 Ga0500559_0218873_38_517 150
293 3300053154 Ga0500619_141612 Ga0500619_141612_64_522 150
294 3300053163 Ga0500639_198170 Ga0500639_198170_147_605 150
295 3300053177 Ga0500636_0135965 Ga0500636_0135965_251_730 150
296 3300005455 Ga0070663_100743160 Ga0070663_1007431602 151
297 3300005563 Ga0068855_100012184 Ga0068855_1000121844 151
298 3300005578 Ga0068854_101017910 Ga0068854_1010179102 151
299 3300005616 Ga0068852_100006205 Ga0068852_1000062059 151
300 3300005841 Ga0068863_100348797 Ga0068863_1003487973 151
301 3300009093 Ga0105240_10105361 Ga0105240_101053616 151
302 3300013104 Ga0157370_10129336 Ga0157370_101293362 151
303 3300013105 Ga0157369_10358236 Ga0157369_103582362 151
304 3300013307 Ga0157372_10356173 Ga0157372_103561732 151
305 3300025299 Ga0209256_1007782 Ga0209256_10077824 151
306 3300025912 Ga0207707_10025726 Ga0207707_100257265 151
307 3300025913 Ga0207695_10010898 Ga0207695_1001089811 151
308 3300025917 Ga0207660_10112819 Ga0207660_101128192 151
309 3300025949 Ga0207667_10013885 Ga0207667_1001388510 151
310 3300026067 Ga0207678_10302637 Ga0207678_103026372 151
311 3300026078 Ga0207702_11063394 Ga0207702_110633941 151
312 3300026088 Ga0207641_10095223 Ga0207641_100952233 151
313 3300028800 Ga0265338_10050898 Ga0265338_100508984 151
314 3300031247 Ga0265340_10023067 Ga0265340_100230675 151
315 3300037312 Ga0395899_0000100 Ga0395899_0000100_114279_114755 151
316 3300037418 Ga0395900_0000009 Ga0395900_0000009_176801_177277 151
317 3300037466 Ga0395898_0294024 Ga0395898_0294024_255_731 151
318 3300037471 Ga0395905_0016592 Ga0395905_0016592_2841_3317 151
319 3300038443 Ga0395901_0000014 Ga0395901_0000014_128000_128476 151
320 3300053108 Ga0500562_000348 Ga0500562_000348_140_601 151
321 3300005327 Ga0070658_10176324 Ga0070658_101763242 152
322 3300005355 Ga0070671_100052127 Ga0070671_1000521272 152
323 3300005436 Ga0070713_101800839 Ga0070713_1018008391 152
324 3300005543 Ga0070672_100641328 Ga0070672_1006413282 152
325 3300005548 Ga0070665_100057710 Ga0070665_1000577103 152
326 3300005548 Ga0070665_100747881 Ga0070665_1007478812 152
327 3300005618 Ga0068864_100637010 Ga0068864_1006370102 152
328 3300010375 Ga0105239_11441154 Ga0105239_114411541 152
329 3300013296 Ga0157374_10216845 Ga0157374_102168451 152
330 3300013306 Ga0163162_10487182 Ga0163162_104871822 152
331 3300014968 Ga0157379_11210715 Ga0157379_112107151 152
332 3300025909 Ga0207705_10706752 Ga0207705_107067522 152
333 3300025931 Ga0207644_10023439 Ga0207644_100234395 152
334 3300025931 Ga0207644_11667993 Ga0207644_116679931 152
335 3300028379 Ga0268266_10144080 Ga0268266_101440802 152
336 3300028379 Ga0268266_10184589 Ga0268266_101845892 152
337 3300028786 Ga0307517_10012217 Ga0307517_100122173 152
338 3300028794 Ga0307515_10368791 Ga0307515_103687912 152
339 3300031251 Ga0265327_10001144 Ga0265327_1000114440 152
340 3300031456 Ga0307513_10027970 Ga0307513_100279702 152
341 3300033180 Ga0307510_10056604 Ga0307510_100566046 152
342 3300037418 Ga0395900_0029418 Ga0395900_0029418_3283_3750 152
343 3300037466 Ga0395898_0101595 Ga0395898_0101595_1915_2382 152
344 3300037471 Ga0395905_0086901 Ga0395905_0086901_1243_1710 152
345 3300037471 Ga0395905_0293926 Ga0395905_0293926_461_928 152
346 3300038443 Ga0395901_1208540 Ga0395901_1208540_220_687 152
347 3300039437 Ga0436365_0946242 Ga0436365_0946242_77_541 152
348 3300046471 Ga0495650_0063483 Ga0495650_0063483_92_550 152
349 3300046506 Ga0495583_0017377 Ga0495583_0017377_1666_2130 152
350 3300046512 Ga0495610_0002172 Ga0495610_0002172_12368_12826 152
351 3300046513 Ga0495616_0101355 Ga0495616_0101355_51_509 152
352 3300046518 Ga0495631_0004495 Ga0495631_0004495_709_1167 152
353 3300046542 Ga0495597_0035166 Ga0495597_0035166_1647_2105 152
354 3300046616 Ga0495668_0007592 Ga0495668_0007592_4691_5149 152
355 3300046616 Ga0495668_0103975 Ga0495668_0103975_479_943 152
356 3300046648 Ga0495611_0013778 Ga0495611_0013778_850_1314 152
357 3300046660 Ga0495625_0119985 Ga0495625_0119985_1099_1563 152
358 3300047445 Ga0495677_0147913 Ga0495677_0147913_304_768 152
359 3300047472 Ga0495686_0001394 Ga0495686_0001394_10943_11401 152
360 3300049459 Ga0495678_001148 Ga0495678_001148_5414_5872 152
361 3300049581 Ga0501047_0624381 Ga0501047_0624381_251_715 152
362 3300053086 Ga0500578_0000035 Ga0500578_0000035_30464_30922 152
363 3300053146 Ga0500588_0053675 Ga0500588_0053675_43_501 152
364 3300003773 Ga0055537_1001849 Ga0055537_10018496 153
365 3300005262 Ga0065165_1000911 Ga0065165_100091130 153
366 3300005455 Ga0070663_100183025 Ga0070663_1001830253 153
367 3300006195 Ga0075366_10191926 Ga0075366_101919262 153
368 3300012512 Ga0157327_1016883 Ga0157327_10168832 153
369 3300014497 Ga0182008_10239445 Ga0182008_102394452 153
370 3300025254 Ga0209148_1008328 Ga0209148_10083282 153
371 3300025263 Ga0209565_1000392 Ga0209565_100039219 153
372 3300025273 Ga0209673_1002199 Ga0209673_10021996 153
373 3300025273 Ga0209673_1057664 Ga0209673_10576642 153
374 3300025291 Ga0209675_1005101 Ga0209675_10051014 153
375 3300025295 Ga0209564_1000667 Ga0209564_100066744 153
376 3300025295 Ga0209564_1024270 Ga0209564_10242702 153
377 3300025297 Ga0209758_1006495 Ga0209758_10064954 153
378 3300025297 Ga0209758_1006985 Ga0209758_10069856 153
379 3300025298 Ga0209050_1033427 Ga0209050_10334272 153
380 3300025299 Ga0209256_1005130 Ga0209256_10051309 153
381 3300025304 Ga0209257_1000264 Ga0209257_100026421 153
382 3300026067 Ga0207678_10188423 Ga0207678_101884232 153
383 3300028786 Ga0307517_10143126 Ga0307517_101431263 153
384 3300028794 Ga0307515_10184073 Ga0307515_101840732 153
385 3300035692 Ga0373935_0103270 Ga0373935_0103270_1280_1747 153
386 3300037068 Ga0373925_0050501 Ga0373925_0050501_2048_2515 153
387 3300037418 Ga0395900_0137456 Ga0395900_0137456_1201_1674 153
388 3300042004 Ga0439445_0124216 Ga0439445_0124216_74_535 153
389 3300042156 Ga0439446_0016071 Ga0439446_0016071_634_1095 153
390 3300042436 Ga0439435_0044745 Ga0439435_0044745_130_591 153
391 3300042438 Ga0439459_0005106 Ga0439459_0005106_1531_1992 153
392 3300046453 Ga0495627_000360 Ga0495627_000360_32883_33344 153
393 3300046457 Ga0495590_0007815 Ga0495590_0007815_1149_1610 153
394 3300046460 Ga0495638_0001615 Ga0495638_0001615_2754_3215 153
395 3300046460 Ga0495638_0011171 Ga0495638_0011171_142_603 153
396 3300046460 Ga0495638_0043980 Ga0495638_0043980_878_1339 153
397 3300046460 Ga0495638_0046994 Ga0495638_0046994_1371_1832 153
398 3300046512 Ga0495610_0001891 Ga0495610_0001891_1405_1866 153
399 3300046512 Ga0495610_0096975 Ga0495610_0096975_271_732 153
400 3300046513 Ga0495616_0001376 Ga0495616_0001376_15781_16242 153
401 3300046513 Ga0495616_0397914 Ga0495616_0397914_74_535 153
402 3300046515 Ga0495620_0024475 Ga0495620_0024475_2259_2720 153
403 3300046518 Ga0495631_0166869 Ga0495631_0166869_25_486 153
404 3300046519 Ga0495632_0006957 Ga0495632_0006957_3117_3578 153
405 3300046520 Ga0495637_0014631 Ga0495637_0014631_1045_1506 153
406 3300046522 Ga0495643_0051866 Ga0495643_0051866_545_1006 153
407 3300046522 Ga0495643_0146698 Ga0495643_0146698_376_837 153
408 3300046524 Ga0495648_0000724 Ga0495648_0000724_5371_5832 153
409 3300046524 Ga0495648_0059322 Ga0495648_0059322_1287_1748 153
410 3300046530 Ga0495654_0000109 Ga0495654_0000109_16843_17304 153
411 3300046542 Ga0495597_0079256 Ga0495597_0079256_165_626 153
412 3300046558 Ga0495633_0156162 Ga0495633_0156162_65_526 153
413 3300046616 Ga0495668_0087740 Ga0495668_0087740_1062_1523 153
414 3300046660 Ga0495625_0000271 Ga0495625_0000271_16945_17406 153
415 3300046660 Ga0495625_0011581 Ga0495625_0011581_4885_5346 153
416 3300046660 Ga0495625_0025386 Ga0495625_0025386_3510_3971 153
417 3300046660 Ga0495625_0033287 Ga0495625_0033287_1134_1595 153
418 3300046692 Ga0495671_0141405 Ga0495671_0141405_211_672 153
419 3300046794 Ga0495589_0091238 Ga0495589_0091238_328_789 153
420 3300046810 Ga0495660_0006079 Ga0495660_0006079_6258_6719 153
421 3300046810 Ga0495660_0067514 Ga0495660_0067514_124_585 153
422 3300046810 Ga0495660_0126277 Ga0495660_0126277_680_1141 153
423 3300047320 Ga0495672_0001875 Ga0495672_0001875_8577_9038 153
424 3300047446 Ga0495679_031945 Ga0495679_031945_710_1171 153
425 3300047469 Ga0495673_0000189 Ga0495673_0000189_29237_29698 153
426 3300047469 Ga0495673_0000296 Ga0495673_0000296_17886_18347 153
427 3300047469 Ga0495673_0005796 Ga0495673_0005796_1307_1768 153
428 3300047470 Ga0495681_0080598 Ga0495681_0080598_607_1068 153
429 3300047470 Ga0495681_0186773 Ga0495681_0186773_359_820 153
430 3300047472 Ga0495686_0003688 Ga0495686_0003688_8656_9117 153
431 3300048904 Ga0496101_0090971 Ga0496101_0090971_1041_1502 153
432 3300048909 Ga0496106_0030438 Ga0496106_0030438_2274_2735 153
433 3300048910 Ga0496107_0000037 Ga0496107_0000037_75062_75523 153
434 3300048918 Ga0496115_0005281 Ga0496115_0005281_988_1449 153
435 3300048924 Ga0496121_0028692 Ga0496121_0028692_2788_3249 153
436 3300048924 Ga0496121_0136551 Ga0496121_0136551_971_1432 153
437 3300048925 Ga0496122_0189095 Ga0496122_0189095_324_785 153
438 3300048926 Ga0496123_0227607 Ga0496123_0227607_460_921 153
439 3300049823 Ga0501044_0768810 Ga0501044_0768810_37_510 153
440 3300050493 nmdc:mga0k408_54130_c1 nmdc:mga0k408_54130_c1_396_857 153
441 3300053087 Ga0500643_139230 Ga0500643_139230_105_566 153
442 3300053088 Ga0500644_0000341 Ga0500644_0000341_9247_9708 153
443 3300053102 Ga0500554_006594 Ga0500554_006594_2142_2603 153
444 3300053104 Ga0500556_0000111 Ga0500556_0000111_47577_48038 153
445 3300053108 Ga0500562_009904 Ga0500562_009904_1162_1623 153
446 3300053123 Ga0500614_155478 Ga0500614_155478_69_530 153
447 3300053125 Ga0500618_000186 Ga0500618_000186_14482_14943 153
448 3300053134 Ga0500658_0011117 Ga0500658_0011117_654_1115 153
449 3300053136 Ga0500559_0000324 Ga0500559_0000324_20943_21404 153
450 3300053138 Ga0500564_000144 Ga0500564_000144_4030_4491 153
451 3300053142 Ga0500577_0002627 Ga0500577_0002627_1659_2120 153
452 3300053153 Ga0500616_0051455 Ga0500616_0051455_575_1036 153
453 3300053156 Ga0500622_0000180 Ga0500622_0000180_34062_34523 153
454 3300053158 Ga0500627_0051577 Ga0500627_0051577_342_803 153
455 3300053730 Ga0500645_002551 Ga0500645_002551_3604_4065 153
456 3300055283 Ga0500661_042595 Ga0500661_042595_11_472 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

41

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9247 11 152
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.9048 11 152
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.867 11 152
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.8625 7 150
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.8571 8 153
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9093 6 152 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.886 10 147 1.10.940.10
af_Q2FZ67_2_133_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8852 13 149 1.10.940.10
af_P9WGX3_13_148_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.884 7 149 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8722 6 152 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A2S5LQA4-F1-model_v4 Transcription antitermination factor NusB 0.964 58 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A2E5BLZ8-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9595 9 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A2H3NVV7-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9515 10 150 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A494TKY5-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9494 9 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A436QL07-F1-model_v4 Transcription antitermination factor NusB 0.949 57 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564

Feature Viewer

pLDDT pTM Quality
89.05 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map