F447780

General Info

Members Datasets Scaffolds Average Seq Length
456 324 450 103

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10434213|Ga0182008_104342131
Length 108
Sequence MKNKKPASLIGQIDAVKALANEKRLLILHYLKHPKDHFPPQVDGDLVEDGVCADFIRDKLGISAATTTQHLKVLSHVGLVRGKRVKQWIFYKRCEDVIATLRNELGGL

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
3 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
132 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
133 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
134 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
217 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
218 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
219 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
223 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
224 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
225 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
226 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
227 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
228 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
229 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
230 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
231 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
236 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
246 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
247 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
248 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
256 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
257 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
258 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
280 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
281 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
287 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
292 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
293 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
294 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
300 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
320 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
323 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
324 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0.66
Rhizoplane 3.07
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1018511 3300001977 Bacteria 984
2 JGI24747J21853_1004903 3300001978 Bacteria 1219
3 JGI24737J22298_10020553 3300001990 Bacteria 2108
4 JGI24034J26672_10004583 3300002239 Bacteria 1962
5 JGI24751J29686_10065635 3300002459 Bacteria 747
6 JGI25406J46586_10003612 3300003203 Bacteria 7255
7 JGI25404J52841_10015544 3300003659 Bacteria 1651
8 Ga0055536_1019096 3300003781 Bacteria 2169
9 Ga0065712_10074749 3300005290 Bacteria 4021
10 Ga0065715_10162834 3300005293 Bacteria 1613
11 Ga0065707_10146936 3300005295 Bacteria 1703
12 Ga0070658_10000704 3300005327 Bacteria 28959
13 Ga0070676_10003529 3300005328 Bacteria 8177
14 Ga0070683_100006034 3300005329 Bacteria 10154
15 Ga0070683_100130407 3300005329 Bacteria 2379
16 Ga0070683_101337267 3300005329 Bacteria 689
17 Ga0070690_100000145 3300005330 Bacteria 35940
18 Ga0070670_100002642 3300005331 Bacteria 14813
19 Ga0070670_100907153 3300005331 Bacteria 799
20 Ga0070677_10000538 3300005333 Bacteria 12949
21 Ga0068869_100001295 3300005334 Bacteria 14813
22 Ga0070666_10000345 3300005335 Bacteria 29079
23 Ga0070680_100017602 3300005336 Bacteria 5636
24 Ga0070680_100023230 3300005336 Bacteria 4944
25 Ga0070682_100093640 3300005337 Bacteria 1970
26 Ga0070682_100119683 3300005337 Bacteria 1766
27 Ga0068868_100002286 3300005338 Bacteria 13246
28 Ga0070660_100000203 3300005339 Bacteria 39748
29 Ga0070689_100000159 3300005340 Bacteria 39820
30 Ga0070691_10009473 3300005341 Bacteria 4445
31 Ga0070687_100000002 3300005343 Bacteria 76542
32 Ga0070661_100000134 3300005344 Bacteria 62179
33 Ga0070661_100064009 3300005344 Bacteria 2702
34 Ga0070692_10000209 3300005345 Bacteria 15844
35 Ga0070668_100000039 3300005347 Bacteria 79523
36 Ga0070669_100001041 3300005353 Bacteria 20259
37 Ga0070675_100005323 3300005354 Bacteria 9833
38 Ga0070675_101641665 3300005354 Bacteria 593
39 Ga0070671_100002347 3300005355 Bacteria 14605
40 Ga0070674_100000118 3300005356 Bacteria 36017
41 Ga0070674_101891890 3300005356 Bacteria 542
42 Ga0070673_100001495 3300005364 Bacteria 13722
43 Ga0070688_100000742 3300005365 Bacteria 16067
44 Ga0070659_100000298 3300005366 Bacteria 38865
45 Ga0070659_101031399 3300005366 Bacteria 723
46 Ga0070667_100003858 3300005367 Bacteria 12733
47 Ga0070667_100713736 3300005367 Bacteria 928
48 Ga0070703_10015301 3300005406 Bacteria 2195
49 Ga0070714_100033692 3300005435 Bacteria 4284
50 Ga0070713_100170695 3300005436 Bacteria 1948
51 Ga0070713_100224798 3300005436 Bacteria 1704
52 Ga0070713_101802492 3300005436 Bacteria 594
53 Ga0070710_10121066 3300005437 Bacteria 1584
54 Ga0070701_10000337 3300005438 Bacteria 15536
55 Ga0070711_100027251 3300005439 Bacteria 3750
56 Ga0070705_100000291 3300005440 Bacteria 29842
57 Ga0070700_100008281 3300005441 Bacteria 5659
58 Ga0070663_100000088 3300005455 Bacteria 41407
59 Ga0070678_100001508 3300005456 Bacteria 12430
60 Ga0070678_100229070 3300005456 Bacteria 1548
61 Ga0070662_100001414 3300005457 Bacteria 14813
62 Ga0070681_10022721 3300005458 Bacteria 6302
63 Ga0070681_10278143 3300005458 Bacteria 1585
64 Ga0070681_11772591 3300005458 Bacteria 544
65 Ga0068867_100000195 3300005459 Bacteria 40012
66 Ga0070685_10001050 3300005466 Bacteria 14813
67 Ga0070679_100029878 3300005530 Bacteria 5377
68 Ga0070679_100053170 3300005530 Bacteria 4032
69 Ga0070679_100125241 3300005530 Bacteria 2552
70 Ga0070684_100105722 3300005535 Bacteria 2519
71 Ga0070684_100208900 3300005535 Bacteria 1779
72 Ga0068853_100000492 3300005539 Bacteria 26983
73 Ga0070672_100000278 3300005543 Bacteria 29079
74 Ga0070672_100939721 3300005543 Unclassified 765
75 Ga0070686_100007539 3300005544 Bacteria 6076
76 Ga0070686_100933175 3300005544 Unclassified 708
77 Ga0070695_100345592 3300005545 Bacteria 1113
78 Ga0070696_100103204 3300005546 Bacteria 2046
79 Ga0070693_100052386 3300005547 Bacteria 2340
80 Ga0070693_100301114 3300005547 Bacteria 1081
81 Ga0070665_100041293 3300005548 Bacteria 4636
82 Ga0070665_100110701 3300005548 Bacteria 2749
83 Ga0070704_100033026 3300005549 Bacteria 3496
84 Ga0068855_100000383 3300005563 Bacteria 54598
85 Ga0068855_100362047 3300005563 Bacteria 1596
86 Ga0068855_101374223 3300005563 Unclassified 729
87 Ga0070664_100000502 3300005564 Bacteria 29641
88 Ga0068857_100001343 3300005577 Bacteria 19384
89 Ga0068857_100002329 3300005577 Bacteria 15453
90 Ga0068854_100000362 3300005578 Bacteria 29079
91 Ga0068854_101341315 3300005578 Bacteria 645
92 Ga0068856_100003066 3300005614 Bacteria 17071
93 Ga0070702_100010791 3300005615 Bacteria 4516
94 Ga0068852_100000211 3300005616 Bacteria 39692
95 Ga0068852_100161119 3300005616 Bacteria 2095
96 Ga0068859_100001182 3300005617 Bacteria 26638
97 Ga0068864_100000579 3300005618 Bacteria 31124
98 Ga0068866_10001747 3300005718 Bacteria 9141
99 Ga0068861_100000362 3300005719 Bacteria 26031
100 Ga0068851_10000295 3300005834 Bacteria 22782
101 Ga0068870_10000016 3300005840 Bacteria 62413
102 Ga0068863_100000473 3300005841 Bacteria 41129
103 Ga0068858_100003861 3300005842 Bacteria 14813
104 Ga0068860_100003643 3300005843 Bacteria 15850
105 Ga0068862_100002205 3300005844 Bacteria 17464
106 Ga0068862_100646390 3300005844 Bacteria 1020
107 Ga0081540_1000033 3300005983 Bacteria 142902
108 Ga0081540_1000092 3300005983 Bacteria 94188
109 Ga0081540_1000160 3300005983 Bacteria 69415
110 Ga0081540_1001958 3300005983 Bacteria 17209
111 Ga0081540_1002758 3300005983 Bacteria 14257
112 Ga0081540_1005660 3300005983 Bacteria 9291
113 Ga0081540_1009390 3300005983 Bacteria 6744
114 Ga0081540_1019818 3300005983 Bacteria 4071
115 Ga0081539_10000157 3300005985 Bacteria 158278
116 Ga0081539_10012681 3300005985 Bacteria 6457
117 Ga0070717_10061726 3300006028 Bacteria 3107
118 Ga0070717_10483027 3300006028 Bacteria 1119
119 Ga0070715_10050907 3300006163 Bacteria 1780
120 Ga0070715_10593543 3300006163 Bacteria 648
121 Ga0070716_100175396 3300006173 Bacteria 1402
122 Ga0070716_101512398 3300006173 Unclassified 549
123 Ga0070712_100207137 3300006175 Bacteria 1544
124 Ga0075367_10865165 3300006178 Unclassified 576
125 Ga0097621_100001946 3300006237 Bacteria 14083
126 Ga0097621_100025809 3300006237 Bacteria 4601
127 Ga0097621_100237347 3300006237 Bacteria 1593
128 Ga0075370_10673850 3300006353 Bacteria 628
129 Ga0068871_100001691 3300006358 Bacteria 14803
130 Ga0075428_100038396 3300006844 Bacteria 5269
131 Ga0075428_100851705 3300006844 Bacteria 968
132 Ga0075430_100049137 3300006846 Bacteria 3561
133 Ga0075431_100034373 3300006847 Bacteria 5222
134 Ga0075434_101146567 3300006871 Bacteria 790
135 Ga0075434_101576963 3300006871 Bacteria 665
136 Ga0068865_100000163 3300006881 Bacteria 36568
137 Ga0097620_100001182 3300006931 Bacteria 26638
138 Ga0097620_103056249 3300006931 Unclassified 511
139 Ga0105251_10217594 3300009011 Bacteria 860
140 Ga0105250_10068448 3300009092 Bacteria 1433
141 Ga0105240_10024022 3300009093 Bacteria 8051
142 Ga0105240_10256293 3300009093 Bacteria 2020
143 Ga0105240_10548490 3300009093 Bacteria 1279
144 Ga0105240_10646560 3300009093 Bacteria 1159
145 Ga0105240_11468464 3300009093 Bacteria 715
146 Ga0105240_11474424 3300009093 Bacteria 714
147 Ga0111539_10231497 3300009094 Bacteria 2152
148 Ga0111539_10552752 3300009094 Bacteria 1341
149 Ga0111539_11190654 3300009094 Bacteria 885
150 Ga0105245_10000381 3300009098 Bacteria 41175
151 Ga0105247_10006611 3300009101 Bacteria 7167
152 Ga0114129_10379643 3300009147 Bacteria 1867
153 Ga0114129_12852431 3300009147 Bacteria 573
154 Ga0105243_10000709 3300009148 Bacteria 32137
155 Ga0105243_12464268 3300009148 Bacteria 559
156 Ga0105241_10007485 3300009174 Bacteria 8036
157 Ga0105241_10243818 3300009174 Bacteria 1520
158 Ga0105241_11344247 3300009174 Bacteria 682
159 Ga0105241_12116479 3300009174 Bacteria 556
160 Ga0105242_10001191 3300009176 Bacteria 20516
161 Ga0105248_10006117 3300009177 Bacteria 13204
162 Ga0105248_12445973 3300009177 Bacteria 595
163 Ga0105237_10000031 3300009545 Bacteria 197346
164 Ga0105237_10621714 3300009545 Bacteria 1087
165 Ga0105237_10936579 3300009545 Bacteria 873
166 Ga0105238_10001175 3300009551 Bacteria 26315
167 Ga0105238_10139155 3300009551 Bacteria 2405
168 Ga0105238_10227065 3300009551 Bacteria 1844
169 Ga0105238_10711989 3300009551 Bacteria 1016
170 Ga0105249_10001717 3300009553 Bacteria 19161
171 Ga0105249_11520521 3300009553 Bacteria 742
172 Ga0105249_12842918 3300009553 Bacteria 555
173 Ga0105239_10000220 3300010375 Bacteria 84136
174 Ga0105239_10048014 3300010375 Bacteria 4679
175 Ga0105239_10676795 3300010375 Bacteria 1179
176 Ga0105239_10946166 3300010375 Bacteria 989
177 Ga0105239_11071644 3300010375 Bacteria 927
178 Ga0105246_10000977 3300011119 Bacteria 16400
179 Ga0157373_10010125 3300013100 Bacteria 6947
180 Ga0157371_10000246 3300013102 Bacteria 76861
181 Ga0157370_10863834 3300013104 Bacteria 822
182 Ga0157369_10000669 3300013105 Bacteria 44175
183 Ga0157369_11135006 3300013105 Bacteria 798
184 Ga0157374_10000295 3300013296 Bacteria 46020
185 Ga0157378_10002394 3300013297 Bacteria 16664
186 Ga0163162_10000200 3300013306 Bacteria 55467
187 Ga0157372_10002464 3300013307 Bacteria 20056
188 Ga0157372_10185167 3300013307 Bacteria 2411
189 Ga0157372_10453760 3300013307 Bacteria 1494
190 Ga0157375_10002554 3300013308 Bacteria 15800
191 Ga0163163_10052410 3300014325 Bacteria 4025
192 Ga0157380_10311327 3300014326 Bacteria 1455
193 Ga0182008_10434213 3300014497 Bacteria 711
194 Ga0157377_10000434 3300014745 Bacteria 18067
195 Ga0157379_10002267 3300014968 Bacteria 16029
196 Ga0157379_12182436 3300014968 Unclassified 550
197 Ga0157376_10001200 3300014969 Bacteria 17107
198 Ga0157376_10021399 3300014969 Bacteria 5022
199 Ga0182007_10004082 3300015262 Bacteria 6718
200 Ga0163161_10033504 3300017792 Bacteria 3671
201 Ga0213873_10004287 3300021358 Bacteria 2648
202 Ga0213874_10065558 3300021377 Bacteria 1148
203 Ga0213876_10013883 3300021384 Bacteria 4269
204 Ga0213876_10014014 3300021384 Bacteria 4249
205 Ga0213871_10086300 3300021441 Bacteria 905
206 Ga0209148_1015299 3300025254 Bacteria 1342
207 Ga0209676_1000019 3300025292 Bacteria 620012
208 Ga0209050_1025127 3300025298 Bacteria 2036
209 Ga0207697_10000838 3300025315 Bacteria 17402
210 Ga0207656_10000926 3300025321 Bacteria 9559
211 Ga0207696_1093141 3300025711 Bacteria 825
212 Ga0207653_10049532 3300025885 Bacteria 1395
213 Ga0207682_10000341 3300025893 Bacteria 21274
214 Ga0207692_10000103 3300025898 Bacteria 24933
215 Ga0207642_10001097 3300025899 Bacteria 8392
216 Ga0207710_10002696 3300025900 Bacteria 8144
217 Ga0207710_10147411 3300025900 Bacteria 1140
218 Ga0207688_10000180 3300025901 Bacteria 28077
219 Ga0207680_10000409 3300025903 Bacteria 20437
220 Ga0207647_10002034 3300025904 Bacteria 15462
221 Ga0207647_10194920 3300025904 Bacteria 1173
222 Ga0207685_10382183 3300025905 Bacteria 718
223 Ga0207699_10026321 3300025906 Bacteria 3204
224 Ga0207645_10002089 3300025907 Bacteria 15981
225 Ga0207643_10000005 3300025908 Bacteria 182148
226 Ga0207705_10001360 3300025909 Bacteria 19548
227 Ga0207654_10010169 3300025911 Bacteria 4787
228 Ga0207654_10184995 3300025911 Bacteria 1361
229 Ga0207707_10000515 3300025912 Bacteria 39696
230 Ga0207707_11018979 3300025912 Bacteria 679
231 Ga0207695_10026891 3300025913 Bacteria 6414
232 Ga0207695_10374351 3300025913 Bacteria 1310
233 Ga0207695_10539757 3300025913 Bacteria 1048
234 Ga0207695_11094760 3300025913 Bacteria 676
235 Ga0207671_10000265 3300025914 Bacteria 78548
236 Ga0207671_10694756 3300025914 Bacteria 809
237 Ga0207671_10987186 3300025914 Unclassified 664
238 Ga0207693_10004906 3300025915 Bacteria 11244
239 Ga0207663_10003171 3300025916 Bacteria 7998
240 Ga0207660_10015490 3300025917 Bacteria 5033
241 Ga0207660_10113965 3300025917 Bacteria 2039
242 Ga0207662_10000323 3300025918 Bacteria 21713
243 Ga0207657_10000029 3300025919 Bacteria 137747
244 Ga0207649_10001081 3300025920 Bacteria 16588
245 Ga0207649_10065047 3300025920 Bacteria 2307
246 Ga0207652_10012880 3300025921 Bacteria 6764
247 Ga0207652_10081161 3300025921 Bacteria 2836
248 Ga0207681_10000063 3300025923 Bacteria 99129
249 Ga0207694_10002389 3300025924 Bacteria 15358
250 Ga0207694_10141946 3300025924 Bacteria 1932
251 Ga0207694_10478978 3300025924 Bacteria 1041
252 Ga0207650_10000232 3300025925 Bacteria 62024
253 Ga0207659_10000261 3300025926 Bacteria 32209
254 Ga0207687_10012169 3300025927 Bacteria 5628
255 Ga0207700_10007676 3300025928 Bacteria 6622
256 Ga0207700_10786118 3300025928 Bacteria 851
257 Ga0207664_10359495 3300025929 Bacteria 1290
258 Ga0207664_10995714 3300025929 Bacteria 751
259 Ga0207644_10001200 3300025931 Bacteria 16673
260 Ga0207690_10001154 3300025932 Bacteria 16720
261 Ga0207706_10000231 3300025933 Bacteria 60951
262 Ga0207686_10000955 3300025934 Bacteria 17248
263 Ga0207709_10018159 3300025935 Bacteria 3935
264 Ga0207670_10000132 3300025936 Bacteria 49228
265 Ga0207669_10000306 3300025937 Bacteria 22381
266 Ga0207704_10000304 3300025938 Bacteria 23156
267 Ga0207665_10021905 3300025939 Bacteria 4202
268 Ga0207665_10211069 3300025939 Bacteria 1418
269 Ga0207665_10489408 3300025939 Bacteria 949
270 Ga0207691_10000068 3300025940 Bacteria 84243
271 Ga0207711_10000068 3300025941 Bacteria 116544
272 Ga0207689_10000375 3300025942 Bacteria 42073
273 Ga0207661_10000871 3300025944 Bacteria 19830
274 Ga0207661_10881788 3300025944 Bacteria 824
275 Ga0207679_10000346 3300025945 Bacteria 33746
276 Ga0207679_10000937 3300025945 Bacteria 18658
277 Ga0207679_11147687 3300025945 Unclassified 713
278 Ga0207667_10001908 3300025949 Bacteria 26171
279 Ga0207667_11021779 3300025949 Bacteria 813
280 Ga0207667_11141065 3300025949 Bacteria 761
281 Ga0207667_11976478 3300025949 Bacteria 544
282 Ga0207651_10000480 3300025960 Bacteria 16796
283 Ga0207651_10254438 3300025960 Bacteria 1439
284 Ga0207712_10000187 3300025961 Bacteria 64116
285 Ga0207712_10840762 3300025961 Bacteria 809
286 Ga0207668_10000710 3300025972 Bacteria 20346
287 Ga0207640_10000399 3300025981 Bacteria 27562
288 Ga0207640_10336706 3300025981 Unclassified 1207
289 Ga0207640_10892732 3300025981 Bacteria 776
290 Ga0207658_10000246 3300025986 Bacteria 56484
291 Ga0207658_11992852 3300025986 Bacteria 528
292 Ga0207677_10000018 3300026023 Bacteria 139501
293 Ga0207703_10002135 3300026035 Bacteria 17388
294 Ga0207639_10001572 3300026041 Bacteria 15314
295 Ga0207678_10000349 3300026067 Bacteria 41962
296 Ga0207678_10537183 3300026067 Bacteria 1022
297 Ga0207708_10002216 3300026075 Bacteria 14370
298 Ga0207702_10001606 3300026078 Bacteria 22359
299 Ga0207641_10001499 3300026088 Bacteria 22841
300 Ga0207648_10003596 3300026089 Bacteria 16212
301 Ga0207676_10000289 3300026095 Bacteria 43323
302 Ga0207674_10004634 3300026116 Bacteria 16506
303 Ga0207674_10005187 3300026116 Bacteria 15520
304 Ga0207675_100000002 3300026118 Bacteria 325956
305 Ga0207683_10000070 3300026121 Bacteria 78648
306 Ga0207683_10442911 3300026121 Bacteria 1197
307 Ga0207698_10000699 3300026142 Bacteria 19497
308 Ga0268266_10000139 3300028379 Bacteria 140538
309 Ga0268266_10045868 3300028379 Bacteria 3741
310 Ga0268265_10000148 3300028380 Bacteria 86667
311 Ga0268264_10000312 3300028381 Bacteria 78042
312 Ga0268264_10633549 3300028381 Bacteria 1057
313 Ga0265338_10135573 3300028800 Bacteria 1936
314 Ga0307408_100643532 3300031548 Bacteria 947
315 Ga0307412_10865857 3300031911 Unclassified 789
316 Ga0307409_101973033 3300031995 Bacteria 613
317 Ga0307415_101521313 3300032126 Bacteria 641
318 Ga0307510_10159987 3300033180 Bacteria 1851
319 Ga0373958_0218448 3300034819 Bacteria 506
320 Ga0373926_0062158 3300035083 Bacteria 1363
321 Ga0373929_0184110 3300035085 Bacteria 577
322 Ga0373934_0019278 3300035086 Bacteria 2617
323 Ga0373944_0326175 3300035089 Bacteria 580
324 Ga0373949_0098557 3300035090 Bacteria 798
325 Ga0373923_0035743 3300035111 Bacteria 2024
326 Ga0373932_0172963 3300035112 Bacteria 753
327 Ga0373936_0032816 3300035113 Bacteria 2055
328 Ga0373939_0473649 3300035114 Bacteria 531
329 Ga0373941_0293948 3300035115 Bacteria 646
330 Ga0373945_0013565 3300035116 Bacteria 2721
331 Ga0373953_0100293 3300035117 Bacteria 1218
332 Ga0373956_0238950 3300035119 Bacteria 863
333 Ga0373960_0459257 3300035121 Bacteria 500
334 Ga0373943_0046899 3300035170 Bacteria 2110
335 Ga0373946_0033274 3300035171 Bacteria 2074
336 Ga0373924_0008447 3300035410 Bacteria 3743
337 Ga0373931_0099972 3300035691 Bacteria 1630
338 Ga0373935_0203057 3300035692 Bacteria 1370
339 Ga0373927_0065995 3300035695 Bacteria 2340
340 Ga0373927_0223450 3300035695 Bacteria 1237
341 Ga0373927_0446015 3300035695 Bacteria 855
342 Ga0373933_0017863 3300035724 Bacteria 3983
343 Ga0373947_0306030 3300035725 Bacteria 1060
344 Ga0373937_0247735 3300036401 Bacteria 1679
345 Ga0373937_2080632 3300036401 Bacteria 514
346 Ga0373925_0038145 3300037068 Bacteria 3550
347 Ga0395900_1675322 3300037418 Bacteria 547
348 Ga0395901_1624662 3300038443 Bacteria 599
349 Ga0436365_0162961 3300039437 Bacteria 1036
350 Ga0436365_1179309 3300039437 Bacteria 16337
351 Ga0436365_1464659 3300039437 Bacteria 8569
352 Ga0436360_0101891 3300039438 Bacteria 1159
353 Ga0436360_1267572 3300039438 Bacteria 1688
354 Ga0436360_1270624 3300039438 Bacteria 1653
355 Ga0436363_0317740 3300039450 Bacteria 615
356 Ga0436363_0369350 3300039450 Bacteria 1551
357 Ga0436363_0570044 3300039450 Bacteria 4195
358 Ga0436362_0267840 3300039453 Bacteria 586
359 Ga0436362_0906680 3300039453 Bacteria 2781
360 Ga0436362_1132497 3300039453 Bacteria 516
361 Ga0439452_134252 3300042010 Bacteria 524
362 Ga0439455_0004201 3300042012 Bacteria 2834
363 Ga0439458_0058555 3300042157 Bacteria 959
364 Ga0439464_0080890 3300042439 Bacteria 970
365 Ga0451577_0065363 3300042876 Bacteria 3244
366 Ga0466969_0327965 3300044656 Bacteria 693
367 Ga0466972_0305134 3300044658 Bacteria 744
368 Ga0466966_0092093 3300044684 Bacteria 1881
369 Ga0466966_0159338 3300044684 Bacteria 1374
370 Ga0466963_0005218 3300044694 Bacteria 7585
371 Ga0453684_0461524 3300044712 Bacteria 1412
372 Ga0466971_0576114 3300044719 Bacteria 560
373 Ga0466970_0003811 3300044765 Bacteria 7385
374 Ga0466957_0014719 3300044842 Bacteria 4558
375 Ga0466957_0167264 3300044842 Bacteria 1431
376 Ga0466959_0139654 3300045049 Bacteria 1713
377 Ga0466959_0505796 3300045049 Bacteria 816
378 Ga0451576_0905492 3300045051 Unclassified 925
379 Ga0466958_0246797 3300045836 Bacteria 1141
380 Ga0466958_0827955 3300045836 Bacteria 604
381 Ga0466967_0024840 3300045976 Bacteria 4933
382 Ga0495580_0050456 3300046472 Bacteria 2942
383 Ga0495582_0176610 3300046473 Bacteria 1216
384 Ga0495639_0035968 3300046475 Bacteria 2216
385 Ga0495664_0018920 3300046477 Bacteria 3953
386 Ga0495584_0367135 3300046491 Bacteria 731
387 Ga0495594_0161393 3300046499 Bacteria 1274
388 Ga0495608_0061189 3300046511 Bacteria 2477
389 Ga0495618_0084457 3300046514 Bacteria 2028
390 Ga0495628_0200212 3300046516 Bacteria 1505
391 Ga0495630_0037810 3300046517 Bacteria 3609
392 Ga0495652_0546952 3300046529 Bacteria 797
393 Ga0495665_0011536 3300046531 Bacteria 4784
394 Ga0495640_0083977 3300046533 Bacteria 2113
395 Ga0495645_0037032 3300046543 Bacteria 3556
396 Ga0495645_0077512 3300046543 Bacteria 2389
397 Ga0495667_0095524 3300046559 Bacteria 1924
398 Ga0495634_0079801 3300046642 Bacteria 2142
399 Ga0495635_0104447 3300046663 Bacteria 1936
400 Ga0495657_0531303 3300046675 Bacteria 684
401 Ga0495599_0152734 3300046678 Bacteria 1429
402 Ga0495646_0072431 3300046680 Bacteria 2026
403 Ga0495646_0195777 3300046680 Bacteria 1103
404 Ga0495647_0274929 3300046681 Bacteria 754
405 Ga0495658_0077190 3300046683 Bacteria 1947
406 Ga0495613_0117714 3300046689 Bacteria 1910
407 Ga0495600_0656112 3300046809 Bacteria 634
408 Ga0495581_0101965 3300047315 Bacteria 1667
409 Ga0495581_0356539 3300047315 Unclassified 854
410 Ga0495604_0251537 3300047317 Bacteria 1204
411 Ga0495674_0104935 3300047319 Bacteria 2402
412 Ga0495684_0040446 3300047471 Bacteria 3574
413 Ga0496100_0217582 3300048903 Bacteria 1400
414 Ga0496102_0001246 3300048905 Bacteria 22983
415 Ga0496103_0434459 3300048906 Bacteria 842
416 Ga0496106_0003910 3300048909 Bacteria 11122
417 Ga0496107_0015186 3300048910 Bacteria 5395
418 Ga0496109_0002793 3300048912 Bacteria 14621
419 Ga0496110_0113159 3300048913 Bacteria 2440
420 Ga0496110_0346771 3300048913 Bacteria 1353
421 Ga0496112_0001943 3300048915 Bacteria 16329
422 Ga0496112_0133829 3300048915 Bacteria 2450
423 Ga0496113_0004846 3300048916 Bacteria 8331
424 Ga0496114_0900391 3300048917 Bacteria 766
425 Ga0496115_0541844 3300048918 Bacteria 931
426 Ga0496115_0817680 3300048918 Bacteria 724
427 Ga0496121_0298489 3300048924 Bacteria 1094
428 Ga0496126_0298742 3300048929 Bacteria 1329
429 Ga0496126_0381533 3300048929 Bacteria 1147
430 Ga0501034_1294721 3300049571 Bacteria 606
431 Ga0501037_0555632 3300049573 Unclassified 774
432 Ga0501077_0191362 3300049593 Bacteria 1300
433 Ga0501079_0659806 3300049741 Bacteria 823
434 Ga0501081_0654848 3300049743 Bacteria 787
435 Ga0501044_0807314 3300049823 Bacteria 817
436 Ga0501044_1598888 3300049823 Bacteria 517
437 nmdc:mga06z11_795404_c1 3300050494 Unclassified 576
438 nmdc:mga07m45_277739_c1 3300050496 Bacteria 974
439 nmdc:mga05p37_324796_c1 3300050507 Bacteria 1820
440 nmdc:mga09592_1300499_c1 3300050508 Bacteria 598
441 nmdc:mga0qj67_123536_c1 3300050509 Bacteria 2094
442 nmdc:mga06r32_506524_c1 3300050510 Bacteria 1184
443 nmdc:mga08y16_315789_c1 3300050511 Bacteria 1609
444 nmdc:mga0n895_541355_c1 3300050512 Bacteria 1170
445 nmdc:mga0n895_626512_c1 3300050512 Bacteria 1076
446 Ga0495601_0070719 3300053077 Bacteria 2228
447 Ga0495612_0015491 3300053078 Bacteria 3057
448 Ga0500647_0073817 3300053091 Bacteria 1637
449 Ga0500559_0028509 3300053136 Bacteria 2386
450 Ga0501082_0684667 3300060353 Bacteria 897

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_1132497 Ga0436362_1132497_18_302 93
2 iso_pu_bacteria 2522572158 2523104637 93
3 3300021441 Ga0213871_10086300 Ga0213871_100863002 94
4 iso_pu_bacteria 2615840698 2616553692 94
5 iso_pu_bacteria 8057575449 8057578959 94
6 3300025912 Ga0207707_11018979 Ga0207707_110189791 95
7 iso_pu_bacteria 2643221598 2644001289 95
8 iso_pu_bacteria 8055066027 8055069533 95
9 iso_pu_bacteria 8056967851 8056974157 95
10 3300005366 Ga0070659_101031399 Ga0070659_1010313991 96
11 3300005436 Ga0070713_100224798 Ga0070713_1002247982 97
12 3300025929 Ga0207664_10359495 Ga0207664_103594953 97
13 3300028800 Ga0265338_10135573 Ga0265338_101355733 97
14 3300039438 Ga0436360_1270624 Ga0436360_1270624_1258_1554 97
15 3300039437 Ga0436365_0162961 Ga0436365_0162961_726_1025 98
16 3300039453 Ga0436362_0267840 Ga0436362_0267840_228_527 98
17 3300044658 Ga0466972_0305134 Ga0466972_0305134_199_498 98
18 3300044684 Ga0466966_0159338 Ga0466966_0159338_932_1231 98
19 3300044694 Ga0466963_0005218 Ga0466963_0005218_655_954 98
20 3300044765 Ga0466970_0003811 Ga0466970_0003811_497_796 98
21 3300044842 Ga0466957_0014719 Ga0466957_0014719_447_746 98
22 3300045049 Ga0466959_0139654 Ga0466959_0139654_601_900 98
23 3300045836 Ga0466958_0246797 Ga0466958_0246797_102_401 98
24 3300045976 Ga0466967_0024840 Ga0466967_0024840_208_507 98
25 3300003203 JGI25406J46586_10003612 JGI25406J46586_100036125 99
26 3300003781 Ga0055536_1019096 Ga0055536_10190962 99
27 3300005295 Ga0065707_10146936 Ga0065707_101469362 99
28 3300005329 Ga0070683_101337267 Ga0070683_1013372672 99
29 3300005331 Ga0070670_100907153 Ga0070670_1009071531 99
30 3300005336 Ga0070680_100017602 Ga0070680_1000176025 99
31 3300005337 Ga0070682_100119683 Ga0070682_1001196832 99
32 3300005354 Ga0070675_101641665 Ga0070675_1016416651 99
33 3300005356 Ga0070674_101891890 Ga0070674_1018918901 99
34 3300005367 Ga0070667_100713736 Ga0070667_1007137362 99
35 3300005435 Ga0070714_100033692 Ga0070714_1000336922 99
36 3300005436 Ga0070713_100170695 Ga0070713_1001706952 99
37 3300005436 Ga0070713_101802492 Ga0070713_1018024921 99
38 3300005437 Ga0070710_10121066 Ga0070710_101210662 99
39 3300005439 Ga0070711_100027251 Ga0070711_1000272513 99
40 3300005458 Ga0070681_10022721 Ga0070681_100227216 99
41 3300005458 Ga0070681_10278143 Ga0070681_102781431 99
42 3300005458 Ga0070681_11772591 Ga0070681_117725911 99
43 3300005530 Ga0070679_100029878 Ga0070679_1000298784 99
44 3300005530 Ga0070679_100125241 Ga0070679_1001252412 99
45 3300005543 Ga0070672_100939721 Ga0070672_1009397212 99
46 3300005544 Ga0070686_100933175 Ga0070686_1009331752 99
47 3300005547 Ga0070693_100301114 Ga0070693_1003011141 99
48 3300005548 Ga0070665_100110701 Ga0070665_1001107012 99
49 3300005563 Ga0068855_100362047 Ga0068855_1003620472 99
50 3300005563 Ga0068855_101374223 Ga0068855_1013742232 99
51 3300005578 Ga0068854_101341315 Ga0068854_1013413152 99
52 3300005983 Ga0081540_1000092 Ga0081540_100009269 99
53 3300005983 Ga0081540_1002758 Ga0081540_100275813 99
54 3300005983 Ga0081540_1005660 Ga0081540_10056605 99
55 3300005983 Ga0081540_1009390 Ga0081540_10093905 99
56 3300005983 Ga0081540_1019818 Ga0081540_10198184 99
57 3300005985 Ga0081539_10000157 Ga0081539_1000015728 99
58 3300005985 Ga0081539_10012681 Ga0081539_100126813 99
59 3300006028 Ga0070717_10061726 Ga0070717_100617261 99
60 3300006028 Ga0070717_10483027 Ga0070717_104830272 99
61 3300006163 Ga0070715_10050907 Ga0070715_100509072 99
62 3300006173 Ga0070716_100175396 Ga0070716_1001753961 99
63 3300006173 Ga0070716_101512398 Ga0070716_1015123982 99
64 3300006175 Ga0070712_100207137 Ga0070712_1002071372 99
65 3300006178 Ga0075367_10865165 Ga0075367_108651651 99
66 3300006237 Ga0097621_100237347 Ga0097621_1002373472 99
67 3300006353 Ga0075370_10673850 Ga0075370_106738502 99
68 3300006844 Ga0075428_100038396 Ga0075428_1000383962 99
69 3300006844 Ga0075428_100851705 Ga0075428_1008517052 99
70 3300006846 Ga0075430_100049137 Ga0075430_1000491373 99
71 3300006847 Ga0075431_100034373 Ga0075431_1000343735 99
72 3300009093 Ga0105240_10256293 Ga0105240_102562932 99
73 3300009093 Ga0105240_10548490 Ga0105240_105484902 99
74 3300009093 Ga0105240_10646560 Ga0105240_106465602 99
75 3300009093 Ga0105240_11468464 Ga0105240_114684641 99
76 3300009093 Ga0105240_11474424 Ga0105240_114744241 99
77 3300009094 Ga0111539_10231497 Ga0111539_102314972 99
78 3300009094 Ga0111539_11190654 Ga0111539_111906542 99
79 3300009147 Ga0114129_10379643 Ga0114129_103796433 99
80 3300009147 Ga0114129_12852431 Ga0114129_128524312 99
81 3300009148 Ga0105243_12464268 Ga0105243_124642681 99
82 3300009174 Ga0105241_11344247 Ga0105241_113442472 99
83 3300009177 Ga0105248_12445973 Ga0105248_124459731 99
84 3300009545 Ga0105237_10621714 Ga0105237_106217142 99
85 3300009545 Ga0105237_10936579 Ga0105237_109365792 99
86 3300009551 Ga0105238_10227065 Ga0105238_102270652 99
87 3300009551 Ga0105238_10711989 Ga0105238_107119892 99
88 3300009553 Ga0105249_11520521 Ga0105249_115205211 99
89 3300009553 Ga0105249_12842918 Ga0105249_128429182 99
90 3300010375 Ga0105239_10048014 Ga0105239_100480145 99
91 3300010375 Ga0105239_10946166 Ga0105239_109461662 99
92 3300010375 Ga0105239_11071644 Ga0105239_110716442 99
93 3300013104 Ga0157370_10863834 Ga0157370_108638341 99
94 3300013307 Ga0157372_10185167 Ga0157372_101851672 99
95 3300014968 Ga0157379_12182436 Ga0157379_121824362 99
96 3300021358 Ga0213873_10004287 Ga0213873_100042874 99
97 3300021377 Ga0213874_10065558 Ga0213874_100655582 99
98 3300021384 Ga0213876_10013883 Ga0213876_100138832 99
99 3300021384 Ga0213876_10014014 Ga0213876_100140144 99
100 3300025254 Ga0209148_1015299 Ga0209148_10152992 99
101 3300025292 Ga0209676_1000019 Ga0209676_100001959 99
102 3300025298 Ga0209050_1025127 Ga0209050_10251272 99
103 3300025898 Ga0207692_10000103 Ga0207692_100001033 99
104 3300025900 Ga0207710_10147411 Ga0207710_101474112 99
105 3300025904 Ga0207647_10194920 Ga0207647_101949202 99
106 3300025905 Ga0207685_10382183 Ga0207685_103821832 99
107 3300025906 Ga0207699_10026321 Ga0207699_100263213 99
108 3300025912 Ga0207707_10000515 Ga0207707_100005158 99
109 3300025913 Ga0207695_10374351 Ga0207695_103743511 99
110 3300025913 Ga0207695_10539757 Ga0207695_105397571 99
111 3300025913 Ga0207695_11094760 Ga0207695_110947602 99
112 3300025914 Ga0207671_10694756 Ga0207671_106947562 99
113 3300025914 Ga0207671_10987186 Ga0207671_109871862 99
114 3300025915 Ga0207693_10004906 Ga0207693_100049065 99
115 3300025916 Ga0207663_10003171 Ga0207663_100031715 99
116 3300025917 Ga0207660_10113965 Ga0207660_101139653 99
117 3300025921 Ga0207652_10012880 Ga0207652_100128806 99
118 3300025921 Ga0207652_10081161 Ga0207652_100811612 99
119 3300025924 Ga0207694_10141946 Ga0207694_101419462 99
120 3300025924 Ga0207694_10478978 Ga0207694_104789782 99
121 3300025928 Ga0207700_10007676 Ga0207700_100076763 99
122 3300025928 Ga0207700_10786118 Ga0207700_107861181 99
123 3300025929 Ga0207664_10995714 Ga0207664_109957142 99
124 3300025939 Ga0207665_10021905 Ga0207665_100219053 99
125 3300025939 Ga0207665_10211069 Ga0207665_102110692 99
126 3300025939 Ga0207665_10489408 Ga0207665_104894081 99
127 3300025949 Ga0207667_11021779 Ga0207667_110217792 99
128 3300025949 Ga0207667_11141065 Ga0207667_111410651 99
129 3300025949 Ga0207667_11976478 Ga0207667_119764782 99
130 3300025960 Ga0207651_10254438 Ga0207651_102544382 99
131 3300025961 Ga0207712_10840762 Ga0207712_108407622 99
132 3300025981 Ga0207640_10892732 Ga0207640_108927322 99
133 3300025986 Ga0207658_11992852 Ga0207658_119928521 99
134 3300026067 Ga0207678_10537183 Ga0207678_105371832 99
135 3300028379 Ga0268266_10045868 Ga0268266_100458683 99
136 3300028381 Ga0268264_10633549 Ga0268264_106335492 99
137 3300031548 Ga0307408_100643532 Ga0307408_1006435322 99
138 3300031911 Ga0307412_10865857 Ga0307412_108658572 99
139 3300032126 Ga0307415_101521313 Ga0307415_1015213131 99
140 3300033180 Ga0307510_10159987 Ga0307510_101599873 99
141 3300035083 Ga0373926_0062158 Ga0373926_0062158_966_1268 99
142 3300035086 Ga0373934_0019278 Ga0373934_0019278_669_971 99
143 3300035089 Ga0373944_0326175 Ga0373944_0326175_208_510 99
144 3300035111 Ga0373923_0035743 Ga0373923_0035743_922_1224 99
145 3300035112 Ga0373932_0172963 Ga0373932_0172963_109_411 99
146 3300035113 Ga0373936_0032816 Ga0373936_0032816_937_1239 99
147 3300035116 Ga0373945_0013565 Ga0373945_0013565_602_904 99
148 3300035117 Ga0373953_0100293 Ga0373953_0100293_121_423 99
149 3300035119 Ga0373956_0238950 Ga0373956_0238950_219_521 99
150 3300035170 Ga0373943_0046899 Ga0373943_0046899_568_870 99
151 3300035171 Ga0373946_0033274 Ga0373946_0033274_1554_1856 99
152 3300035410 Ga0373924_0008447 Ga0373924_0008447_235_537 99
153 3300035692 Ga0373935_0203057 Ga0373935_0203057_307_609 99
154 3300035695 Ga0373927_0065995 Ga0373927_0065995_1277_1579 99
155 3300035695 Ga0373927_0223450 Ga0373927_0223450_259_561 99
156 3300035724 Ga0373933_0017863 Ga0373933_0017863_388_690 99
157 3300035725 Ga0373947_0306030 Ga0373947_0306030_717_1019 99
158 3300036401 Ga0373937_0247735 Ga0373937_0247735_331_633 99
159 3300037068 Ga0373925_0038145 Ga0373925_0038145_16_318 99
160 3300038443 Ga0395901_1624662 Ga0395901_1624662_252_554 99
161 3300039437 Ga0436365_1179309 Ga0436365_1179309_10970_11272 99
162 3300039437 Ga0436365_1464659 Ga0436365_1464659_4083_4382 99
163 3300039438 Ga0436360_0101891 Ga0436360_0101891_86_388 99
164 3300039450 Ga0436363_0317740 Ga0436363_0317740_149_451 99
165 3300039450 Ga0436363_0369350 Ga0436363_0369350_1208_1510 99
166 3300039453 Ga0436362_0906680 Ga0436362_0906680_334_636 99
167 3300042010 Ga0439452_134252 Ga0439452_134252_154_456 99
168 3300044656 Ga0466969_0327965 Ga0466969_0327965_348_650 99
169 3300044684 Ga0466966_0092093 Ga0466966_0092093_331_633 99
170 3300044719 Ga0466971_0576114 Ga0466971_0576114_62_364 99
171 3300044842 Ga0466957_0167264 Ga0466957_0167264_130_432 99
172 3300045049 Ga0466959_0505796 Ga0466959_0505796_266_568 99
173 3300045836 Ga0466958_0827955 Ga0466958_0827955_175_477 99
174 3300046472 Ga0495580_0050456 Ga0495580_0050456_1049_1351 99
175 3300046473 Ga0495582_0176610 Ga0495582_0176610_188_490 99
176 3300046475 Ga0495639_0035968 Ga0495639_0035968_1832_2134 99
177 3300046477 Ga0495664_0018920 Ga0495664_0018920_3434_3736 99
178 3300046491 Ga0495584_0367135 Ga0495584_0367135_264_563 99
179 3300046499 Ga0495594_0161393 Ga0495594_0161393_955_1257 99
180 3300046511 Ga0495608_0061189 Ga0495608_0061189_590_892 99
181 3300046514 Ga0495618_0084457 Ga0495618_0084457_602_904 99
182 3300046516 Ga0495628_0200212 Ga0495628_0200212_915_1217 99
183 3300046517 Ga0495630_0037810 Ga0495630_0037810_3211_3513 99
184 3300046529 Ga0495652_0546952 Ga0495652_0546952_183_485 99
185 3300046531 Ga0495665_0011536 Ga0495665_0011536_1416_1718 99
186 3300046533 Ga0495640_0083977 Ga0495640_0083977_314_616 99
187 3300046543 Ga0495645_0037032 Ga0495645_0037032_2973_3275 99
188 3300046543 Ga0495645_0077512 Ga0495645_0077512_398_700 99
189 3300046559 Ga0495667_0095524 Ga0495667_0095524_1262_1564 99
190 3300046642 Ga0495634_0079801 Ga0495634_0079801_395_697 99
191 3300046663 Ga0495635_0104447 Ga0495635_0104447_390_692 99
192 3300046675 Ga0495657_0531303 Ga0495657_0531303_266_568 99
193 3300046678 Ga0495599_0152734 Ga0495599_0152734_995_1297 99
194 3300046680 Ga0495646_0072431 Ga0495646_0072431_1042_1344 99
195 3300046680 Ga0495646_0195777 Ga0495646_0195777_71_373 99
196 3300046681 Ga0495647_0274929 Ga0495647_0274929_356_658 99
197 3300046683 Ga0495658_0077190 Ga0495658_0077190_731_1033 99
198 3300046689 Ga0495613_0117714 Ga0495613_0117714_906_1208 99
199 3300046809 Ga0495600_0656112 Ga0495600_0656112_18_320 99
200 3300047315 Ga0495581_0101965 Ga0495581_0101965_1245_1547 99
201 3300047317 Ga0495604_0251537 Ga0495604_0251537_70_372 99
202 3300047319 Ga0495674_0104935 Ga0495674_0104935_1716_2018 99
203 3300047471 Ga0495684_0040446 Ga0495684_0040446_1203_1505 99
204 3300048913 Ga0496110_0346771 Ga0496110_0346771_75_377 99
205 3300048915 Ga0496112_0133829 Ga0496112_0133829_1335_1637 99
206 3300048918 Ga0496115_0541844 Ga0496115_0541844_58_360 99
207 3300048924 Ga0496121_0298489 Ga0496121_0298489_89_391 99
208 3300048929 Ga0496126_0298742 Ga0496126_0298742_418_720 99
209 3300048929 Ga0496126_0381533 Ga0496126_0381533_758_1060 99
210 3300049571 Ga0501034_1294721 Ga0501034_1294721_282_584 99
211 3300049573 Ga0501037_0555632 Ga0501037_0555632_69_371 99
212 3300049823 Ga0501044_0807314 Ga0501044_0807314_475_777 99
213 3300049823 Ga0501044_1598888 Ga0501044_1598888_56_355 99
214 3300050494 nmdc:mga06z11_795404_c1 nmdc:mga06z11_795404_c1_66_368 99
215 3300050496 nmdc:mga07m45_277739_c1 nmdc:mga07m45_277739_c1_597_899 99
216 3300050507 nmdc:mga05p37_324796_c1 nmdc:mga05p37_324796_c1_1391_1693 99
217 3300050508 nmdc:mga09592_1300499_c1 nmdc:mga09592_1300499_c1_22_324 99
218 3300050509 nmdc:mga0qj67_123536_c1 nmdc:mga0qj67_123536_c1_132_434 99
219 3300050510 nmdc:mga06r32_506524_c1 nmdc:mga06r32_506524_c1_104_406 99
220 3300050511 nmdc:mga08y16_315789_c1 nmdc:mga08y16_315789_c1_1153_1455 99
221 3300053077 Ga0495601_0070719 Ga0495601_0070719_1587_1889 99
222 3300053078 Ga0495612_0015491 Ga0495612_0015491_1714_2016 99
223 3300053091 Ga0500647_0073817 Ga0500647_0073817_568_870 99
224 3300053136 Ga0500559_0028509 Ga0500559_0028509_352_654 99
225 3300005616 Ga0068852_100161119 Ga0068852_1001611193 100
226 3300009174 Ga0105241_12116479 Ga0105241_121164792 100
227 3300009551 Ga0105238_10139155 Ga0105238_101391553 100
228 3300010375 Ga0105239_10676795 Ga0105239_106767952 100
229 3300013105 Ga0157369_11135006 Ga0157369_111350061 100
230 3300013307 Ga0157372_10453760 Ga0157372_104537602 100
231 3300025981 Ga0207640_10336706 Ga0207640_103367063 100
232 3300031995 Ga0307409_101973033 Ga0307409_1019730331 100
233 3300037418 Ga0395900_1675322 Ga0395900_1675322_205_516 102
234 3300039438 Ga0436360_1267572 Ga0436360_1267572_975_1286 102
235 3300025711 Ga0207696_1093141 Ga0207696_10931412 104
236 3300001977 JGI24746J21847_1018511 JGI24746J21847_10185112 105
237 3300001978 JGI24747J21853_1004903 JGI24747J21853_10049033 105
238 3300001990 JGI24737J22298_10020553 JGI24737J22298_100205533 105
239 3300002239 JGI24034J26672_10004583 JGI24034J26672_100045832 105
240 3300002459 JGI24751J29686_10065635 JGI24751J29686_100656351 105
241 3300003659 JGI25404J52841_10015544 JGI25404J52841_100155443 105
242 3300005290 Ga0065712_10074749 Ga0065712_100747494 105
243 3300005293 Ga0065715_10162834 Ga0065715_101628343 105
244 3300005327 Ga0070658_10000704 Ga0070658_100007045 105
245 3300005328 Ga0070676_10003529 Ga0070676_100035296 105
246 3300005329 Ga0070683_100006034 Ga0070683_10000603416 105
247 3300005329 Ga0070683_100130407 Ga0070683_1001304074 105
248 3300005330 Ga0070690_100000145 Ga0070690_1000001455 105
249 3300005331 Ga0070670_100002642 Ga0070670_10000264213 105
250 3300005333 Ga0070677_10000538 Ga0070677_100005382 105
251 3300005334 Ga0068869_100001295 Ga0068869_10000129513 105
252 3300005335 Ga0070666_10000345 Ga0070666_1000034513 105
253 3300005336 Ga0070680_100023230 Ga0070680_1000232305 105
254 3300005337 Ga0070682_100093640 Ga0070682_1000936404 105
255 3300005338 Ga0068868_100002286 Ga0068868_1000022864 105
256 3300005339 Ga0070660_100000203 Ga0070660_10000020341 105
257 3300005340 Ga0070689_100000159 Ga0070689_1000001596 105
258 3300005341 Ga0070691_10009473 Ga0070691_100094732 105
259 3300005343 Ga0070687_100000002 Ga0070687_10000000266 105
260 3300005344 Ga0070661_100000134 Ga0070661_10000013466 105
261 3300005344 Ga0070661_100064009 Ga0070661_1000640094 105
262 3300005345 Ga0070692_10000209 Ga0070692_100002095 105
263 3300005347 Ga0070668_100000039 Ga0070668_1000000396 105
264 3300005353 Ga0070669_100001041 Ga0070669_10000104115 105
265 3300005354 Ga0070675_100005323 Ga0070675_1000053237 105
266 3300005355 Ga0070671_100002347 Ga0070671_1000023475 105
267 3300005356 Ga0070674_100000118 Ga0070674_1000001183 105
268 3300005364 Ga0070673_100001495 Ga0070673_10000149513 105
269 3300005365 Ga0070688_100000742 Ga0070688_1000007425 105
270 3300005366 Ga0070659_100000298 Ga0070659_10000029840 105
271 3300005367 Ga0070667_100003858 Ga0070667_1000038585 105
272 3300005406 Ga0070703_10015301 Ga0070703_100153013 105
273 3300005438 Ga0070701_10000337 Ga0070701_100003374 105
274 3300005440 Ga0070705_100000291 Ga0070705_10000029110 105
275 3300005441 Ga0070700_100008281 Ga0070700_1000082814 105
276 3300005455 Ga0070663_100000088 Ga0070663_1000000885 105
277 3300005456 Ga0070678_100001508 Ga0070678_10000150813 105
278 3300005456 Ga0070678_100229070 Ga0070678_1002290701 105
279 3300005457 Ga0070662_100001414 Ga0070662_1000014146 105
280 3300005459 Ga0068867_100000195 Ga0068867_10000019541 105
281 3300005466 Ga0070685_10001050 Ga0070685_100010506 105
282 3300005530 Ga0070679_100053170 Ga0070679_1000531703 105
283 3300005535 Ga0070684_100105722 Ga0070684_1001057223 105
284 3300005535 Ga0070684_100208900 Ga0070684_1002089003 105
285 3300005539 Ga0068853_100000492 Ga0068853_10000049216 105
286 3300005543 Ga0070672_100000278 Ga0070672_10000027813 105
287 3300005544 Ga0070686_100007539 Ga0070686_1000075394 105
288 3300005545 Ga0070695_100345592 Ga0070695_1003455922 105
289 3300005546 Ga0070696_100103204 Ga0070696_1001032042 105
290 3300005547 Ga0070693_100052386 Ga0070693_1000523862 105
291 3300005548 Ga0070665_100041293 Ga0070665_1000412932 105
292 3300005549 Ga0070704_100033026 Ga0070704_1000330264 105
293 3300005563 Ga0068855_100000383 Ga0068855_10000038323 105
294 3300005564 Ga0070664_100000502 Ga0070664_10000050229 105
295 3300005577 Ga0068857_100001343 Ga0068857_1000013436 105
296 3300005577 Ga0068857_100002329 Ga0068857_1000023294 105
297 3300005578 Ga0068854_100000362 Ga0068854_10000036213 105
298 3300005614 Ga0068856_100003066 Ga0068856_1000030667 105
299 3300005615 Ga0070702_100010791 Ga0070702_1000107913 105
300 3300005616 Ga0068852_100000211 Ga0068852_10000021140 105
301 3300005617 Ga0068859_100001182 Ga0068859_10000118226 105
302 3300005618 Ga0068864_100000579 Ga0068864_1000005795 105
303 3300005718 Ga0068866_10001747 Ga0068866_100017476 105
304 3300005719 Ga0068861_100000362 Ga0068861_1000003625 105
305 3300005834 Ga0068851_10000295 Ga0068851_100002956 105
306 3300005840 Ga0068870_10000016 Ga0068870_1000001618 105
307 3300005841 Ga0068863_100000473 Ga0068863_10000047327 105
308 3300005842 Ga0068858_100003861 Ga0068858_10000386113 105
309 3300005843 Ga0068860_100003643 Ga0068860_10000364313 105
310 3300005844 Ga0068862_100002205 Ga0068862_1000022055 105
311 3300005844 Ga0068862_100646390 Ga0068862_1006463902 105
312 3300005983 Ga0081540_1000033 Ga0081540_100003380 105
313 3300005983 Ga0081540_1000160 Ga0081540_100016039 105
314 3300005983 Ga0081540_1001958 Ga0081540_100195815 105
315 3300006163 Ga0070715_10593543 Ga0070715_105935432 105
316 3300006237 Ga0097621_100001946 Ga0097621_1000019467 105
317 3300006237 Ga0097621_100025809 Ga0097621_1000258093 105
318 3300006358 Ga0068871_100001691 Ga0068871_1000016916 105
319 3300006871 Ga0075434_101146567 Ga0075434_1011465672 105
320 3300006871 Ga0075434_101576963 Ga0075434_1015769632 105
321 3300006881 Ga0068865_100000163 Ga0068865_1000001635 105
322 3300006931 Ga0097620_100001182 Ga0097620_1000011826 105
323 3300006931 Ga0097620_103056249 Ga0097620_1030562491 105
324 3300009011 Ga0105251_10217594 Ga0105251_102175942 105
325 3300009092 Ga0105250_10068448 Ga0105250_100684481 105
326 3300009093 Ga0105240_10024022 Ga0105240_100240227 105
327 3300009094 Ga0111539_10552752 Ga0111539_105527521 105
328 3300009098 Ga0105245_10000381 Ga0105245_100003815 105
329 3300009101 Ga0105247_10006611 Ga0105247_100066118 105
330 3300009148 Ga0105243_10000709 Ga0105243_1000070933 105
331 3300009174 Ga0105241_10007485 Ga0105241_100074855 105
332 3300009174 Ga0105241_10243818 Ga0105241_102438183 105
333 3300009176 Ga0105242_10001191 Ga0105242_1000119112 105
334 3300009177 Ga0105248_10006117 Ga0105248_1000611711 105
335 3300009545 Ga0105237_10000031 Ga0105237_1000003180 105
336 3300009551 Ga0105238_10001175 Ga0105238_1000117526 105
337 3300009553 Ga0105249_10001717 Ga0105249_100017178 105
338 3300010375 Ga0105239_10000220 Ga0105239_1000022083 105
339 3300011119 Ga0105246_10000977 Ga0105246_1000097716 105
340 3300013100 Ga0157373_10010125 Ga0157373_100101258 105
341 3300013102 Ga0157371_10000246 Ga0157371_1000024680 105
342 3300013105 Ga0157369_10000669 Ga0157369_1000066912 105
343 3300013296 Ga0157374_10000295 Ga0157374_100002955 105
344 3300013297 Ga0157378_10002394 Ga0157378_100023945 105
345 3300013306 Ga0163162_10000200 Ga0163162_1000020012 105
346 3300013307 Ga0157372_10002464 Ga0157372_1000246418 105
347 3300013308 Ga0157375_10002554 Ga0157375_1000255416 105
348 3300014325 Ga0163163_10052410 Ga0163163_100524103 105
349 3300014326 Ga0157380_10311327 Ga0157380_103113272 105
350 3300014497 Ga0182008_10434213 Ga0182008_104342131 105
351 3300014745 Ga0157377_10000434 Ga0157377_1000043418 105
352 3300014968 Ga0157379_10002267 Ga0157379_100022674 105
353 3300014969 Ga0157376_10001200 Ga0157376_1000120017 105
354 3300014969 Ga0157376_10021399 Ga0157376_100213994 105
355 3300015262 Ga0182007_10004082 Ga0182007_100040825 105
356 3300017792 Ga0163161_10033504 Ga0163161_100335042 105
357 3300025315 Ga0207697_10000838 Ga0207697_100008385 105
358 3300025321 Ga0207656_10000926 Ga0207656_100009268 105
359 3300025885 Ga0207653_10049532 Ga0207653_100495323 105
360 3300025893 Ga0207682_10000341 Ga0207682_1000034124 105
361 3300025899 Ga0207642_10001097 Ga0207642_100010975 105
362 3300025900 Ga0207710_10002696 Ga0207710_100026964 105
363 3300025901 Ga0207688_10000180 Ga0207688_100001804 105
364 3300025903 Ga0207680_10000409 Ga0207680_1000040916 105
365 3300025904 Ga0207647_10002034 Ga0207647_1000203414 105
366 3300025907 Ga0207645_10002089 Ga0207645_100020894 105
367 3300025908 Ga0207643_10000005 Ga0207643_10000005109 105
368 3300025909 Ga0207705_10001360 Ga0207705_1000136018 105
369 3300025911 Ga0207654_10010169 Ga0207654_100101694 105
370 3300025911 Ga0207654_10184995 Ga0207654_101849953 105
371 3300025913 Ga0207695_10026891 Ga0207695_100268915 105
372 3300025914 Ga0207671_10000265 Ga0207671_1000026514 105
373 3300025917 Ga0207660_10015490 Ga0207660_100154904 105
374 3300025918 Ga0207662_10000323 Ga0207662_1000032313 105
375 3300025919 Ga0207657_10000029 Ga0207657_100000294 105
376 3300025920 Ga0207649_10001081 Ga0207649_1000108116 105
377 3300025920 Ga0207649_10065047 Ga0207649_100650471 105
378 3300025923 Ga0207681_10000063 Ga0207681_1000006339 105
379 3300025924 Ga0207694_10002389 Ga0207694_100023893 105
380 3300025925 Ga0207650_10000232 Ga0207650_1000023265 105
381 3300025926 Ga0207659_10000261 Ga0207659_1000026116 105
382 3300025927 Ga0207687_10012169 Ga0207687_100121694 105
383 3300025931 Ga0207644_10001200 Ga0207644_1000120016 105
384 3300025932 Ga0207690_10001154 Ga0207690_100011545 105
385 3300025933 Ga0207706_10000231 Ga0207706_1000023164 105
386 3300025934 Ga0207686_10000955 Ga0207686_100009555 105
387 3300025935 Ga0207709_10018159 Ga0207709_100181594 105
388 3300025936 Ga0207670_10000132 Ga0207670_1000013240 105
389 3300025937 Ga0207669_10000306 Ga0207669_1000030610 105
390 3300025938 Ga0207704_10000304 Ga0207704_1000030414 105
391 3300025940 Ga0207691_10000068 Ga0207691_1000006880 105
392 3300025941 Ga0207711_10000068 Ga0207711_1000006872 105
393 3300025942 Ga0207689_10000375 Ga0207689_100003758 105
394 3300025944 Ga0207661_10000871 Ga0207661_1000087111 105
395 3300025944 Ga0207661_10881788 Ga0207661_108817881 105
396 3300025945 Ga0207679_10000346 Ga0207679_1000034635 105
397 3300025945 Ga0207679_10000937 Ga0207679_100009376 105
398 3300025945 Ga0207679_11147687 Ga0207679_111476871 105
399 3300025949 Ga0207667_10001908 Ga0207667_1000190826 105
400 3300025960 Ga0207651_10000480 Ga0207651_1000048016 105
401 3300025961 Ga0207712_10000187 Ga0207712_100001878 105
402 3300025972 Ga0207668_10000710 Ga0207668_1000071016 105
403 3300025981 Ga0207640_10000399 Ga0207640_1000039927 105
404 3300025986 Ga0207658_10000246 Ga0207658_100002465 105
405 3300026023 Ga0207677_10000018 Ga0207677_1000001880 105
406 3300026035 Ga0207703_10002135 Ga0207703_1000213516 105
407 3300026041 Ga0207639_10001572 Ga0207639_100015725 105
408 3300026067 Ga0207678_10000349 Ga0207678_100003495 105
409 3300026075 Ga0207708_10002216 Ga0207708_100022165 105
410 3300026078 Ga0207702_10001606 Ga0207702_1000160614 105
411 3300026088 Ga0207641_10001499 Ga0207641_1000149916 105
412 3300026089 Ga0207648_10003596 Ga0207648_100035964 105
413 3300026095 Ga0207676_10000289 Ga0207676_1000028921 105
414 3300026116 Ga0207674_10004634 Ga0207674_100046345 105
415 3300026116 Ga0207674_10005187 Ga0207674_100051874 105
416 3300026118 Ga0207675_100000002 Ga0207675_100000002103 105
417 3300026121 Ga0207683_10000070 Ga0207683_100000705 105
418 3300026121 Ga0207683_10442911 Ga0207683_104429111 105
419 3300026142 Ga0207698_10000699 Ga0207698_1000069921 105
420 3300028379 Ga0268266_10000139 Ga0268266_10000139123 105
421 3300028380 Ga0268265_10000148 Ga0268265_1000014838 105
422 3300028381 Ga0268264_10000312 Ga0268264_100003124 105
423 3300034819 Ga0373958_0218448 Ga0373958_0218448_59_388 105
424 3300035085 Ga0373929_0184110 Ga0373929_0184110_35_364 105
425 3300035090 Ga0373949_0098557 Ga0373949_0098557_99_428 105
426 3300035114 Ga0373939_0473649 Ga0373939_0473649_49_402 105
427 3300035115 Ga0373941_0293948 Ga0373941_0293948_220_537 105
428 3300035121 Ga0373960_0459257 Ga0373960_0459257_113_442 105
429 3300035691 Ga0373931_0099972 Ga0373931_0099972_125_454 105
430 3300035695 Ga0373927_0446015 Ga0373927_0446015_46_396 105
431 3300036401 Ga0373937_2080632 Ga0373937_2080632_23_373 105
432 3300039450 Ga0436363_0570044 Ga0436363_0570044_2295_2624 105
433 3300042012 Ga0439455_0004201 Ga0439455_0004201_1715_2053 105
434 3300042157 Ga0439458_0058555 Ga0439458_0058555_200_538 105
435 3300042439 Ga0439464_0080890 Ga0439464_0080890_209_547 105
436 3300042876 Ga0451577_0065363 Ga0451577_0065363_2249_2596 105
437 3300044712 Ga0453684_0461524 Ga0453684_0461524_631_978 105
438 3300045051 Ga0451576_0905492 Ga0451576_0905492_294_641 105
439 3300047315 Ga0495581_0356539 Ga0495581_0356539_423_773 105
440 3300048903 Ga0496100_0217582 Ga0496100_0217582_339_656 105
441 3300048905 Ga0496102_0001246 Ga0496102_0001246_9076_9393 105
442 3300048906 Ga0496103_0434459 Ga0496103_0434459_339_656 105
443 3300048909 Ga0496106_0003910 Ga0496106_0003910_9680_9997 105
444 3300048910 Ga0496107_0015186 Ga0496107_0015186_1904_2221 105
445 3300048912 Ga0496109_0002793 Ga0496109_0002793_7337_7654 105
446 3300048913 Ga0496110_0113159 Ga0496110_0113159_1700_2017 105
447 3300048915 Ga0496112_0001943 Ga0496112_0001943_3274_3591 105
448 3300048916 Ga0496113_0004846 Ga0496113_0004846_4768_5085 105
449 3300048917 Ga0496114_0900391 Ga0496114_0900391_132_449 105
450 3300048918 Ga0496115_0817680 Ga0496115_0817680_292_609 105
451 3300049593 Ga0501077_0191362 Ga0501077_0191362_737_1078 105
452 3300049741 Ga0501079_0659806 Ga0501079_0659806_263_604 105
453 3300049743 Ga0501081_0654848 Ga0501081_0654848_213_554 105
454 3300050512 nmdc:mga0n895_541355_c1 nmdc:mga0n895_541355_c1_729_1076 105
455 3300050512 nmdc:mga0n895_626512_c1 nmdc:mga0n895_626512_c1_576_896 105
456 3300060353 Ga0501082_0684667 Ga0501082_0684667_392_733 105

Structural Annotation

Top 5 Hits

ID Description Score Start End
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.9368 48 92
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.932 48 91
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.9296 48 92
7p6f-assembly1.cif.gz_BBB 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus 0.9228 4 104
5zuo-assembly1.cif.gz_A crystal structure of bz junction in diverse sequence 0.907 50 91
ID Description Score Start End Superfamily
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9546 48 90 3.30.230.130
af_I6Y1A7_25_116_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9173 8 102 1.10.10.10
4hx4A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9082 50 78 1.10.10.10
5zuoA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.907 50 91 1.10.10.10
af_A0A1D6GVA1_621_768_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9038 49 92 3.30.230.130
ID Description Score Start End GO Terms
AF-A0A534P4A4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9986 23 104 GO:0003700
AF-A0A3N0E5U6-F1-model_v4 ArsR family transcriptional regulator 0.9982 10 104 GO:0003700
AF-A0A4P6JIX9-F1-model_v4 ArsR family transcriptional regulator 0.9965 11 104 GO:0003700
AF-A0A5Q0GU78-F1-model_v4 ArsR family transcriptional regulator 0.9954 11 102 GO:0003700
AF-A0A1V3S061-F1-model_v4 Transcriptional regulator 0.9931 6 104 GO:0003700

Feature Viewer

pLDDT pTM Quality
94.2 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map