F447780
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 456 | 324 | 450 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10434213|Ga0182008_104342131 |
| Length | 108 |
| Sequence | MKNKKPASLIGQIDAVKALANEKRLLILHYLKHPKDHFPPQVDGDLVEDGVCADFIRDKLGISAATTTQHLKVLSHVGLVRGKRVKQWIFYKRCEDVIATLRNELGGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 3 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 94 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 132 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 133 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 134 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 135 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 223 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 225 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 230 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 246 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 247 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 248 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 251 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 256 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 257 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 258 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 292 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 293 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 294 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 295 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 300 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 301 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 320 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 323 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 324 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.68 |
| Metatranscriptomes | 0 |
| Isolates | 1.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.19 |
| Nodule | 0.66 |
| Rhizoplane | 3.07 |
| Rhizosphere | 90.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1018511 | 3300001977 | Bacteria | 984 |
| 2 | JGI24747J21853_1004903 | 3300001978 | Bacteria | 1219 |
| 3 | JGI24737J22298_10020553 | 3300001990 | Bacteria | 2108 |
| 4 | JGI24034J26672_10004583 | 3300002239 | Bacteria | 1962 |
| 5 | JGI24751J29686_10065635 | 3300002459 | Bacteria | 747 |
| 6 | JGI25406J46586_10003612 | 3300003203 | Bacteria | 7255 |
| 7 | JGI25404J52841_10015544 | 3300003659 | Bacteria | 1651 |
| 8 | Ga0055536_1019096 | 3300003781 | Bacteria | 2169 |
| 9 | Ga0065712_10074749 | 3300005290 | Bacteria | 4021 |
| 10 | Ga0065715_10162834 | 3300005293 | Bacteria | 1613 |
| 11 | Ga0065707_10146936 | 3300005295 | Bacteria | 1703 |
| 12 | Ga0070658_10000704 | 3300005327 | Bacteria | 28959 |
| 13 | Ga0070676_10003529 | 3300005328 | Bacteria | 8177 |
| 14 | Ga0070683_100006034 | 3300005329 | Bacteria | 10154 |
| 15 | Ga0070683_100130407 | 3300005329 | Bacteria | 2379 |
| 16 | Ga0070683_101337267 | 3300005329 | Bacteria | 689 |
| 17 | Ga0070690_100000145 | 3300005330 | Bacteria | 35940 |
| 18 | Ga0070670_100002642 | 3300005331 | Bacteria | 14813 |
| 19 | Ga0070670_100907153 | 3300005331 | Bacteria | 799 |
| 20 | Ga0070677_10000538 | 3300005333 | Bacteria | 12949 |
| 21 | Ga0068869_100001295 | 3300005334 | Bacteria | 14813 |
| 22 | Ga0070666_10000345 | 3300005335 | Bacteria | 29079 |
| 23 | Ga0070680_100017602 | 3300005336 | Bacteria | 5636 |
| 24 | Ga0070680_100023230 | 3300005336 | Bacteria | 4944 |
| 25 | Ga0070682_100093640 | 3300005337 | Bacteria | 1970 |
| 26 | Ga0070682_100119683 | 3300005337 | Bacteria | 1766 |
| 27 | Ga0068868_100002286 | 3300005338 | Bacteria | 13246 |
| 28 | Ga0070660_100000203 | 3300005339 | Bacteria | 39748 |
| 29 | Ga0070689_100000159 | 3300005340 | Bacteria | 39820 |
| 30 | Ga0070691_10009473 | 3300005341 | Bacteria | 4445 |
| 31 | Ga0070687_100000002 | 3300005343 | Bacteria | 76542 |
| 32 | Ga0070661_100000134 | 3300005344 | Bacteria | 62179 |
| 33 | Ga0070661_100064009 | 3300005344 | Bacteria | 2702 |
| 34 | Ga0070692_10000209 | 3300005345 | Bacteria | 15844 |
| 35 | Ga0070668_100000039 | 3300005347 | Bacteria | 79523 |
| 36 | Ga0070669_100001041 | 3300005353 | Bacteria | 20259 |
| 37 | Ga0070675_100005323 | 3300005354 | Bacteria | 9833 |
| 38 | Ga0070675_101641665 | 3300005354 | Bacteria | 593 |
| 39 | Ga0070671_100002347 | 3300005355 | Bacteria | 14605 |
| 40 | Ga0070674_100000118 | 3300005356 | Bacteria | 36017 |
| 41 | Ga0070674_101891890 | 3300005356 | Bacteria | 542 |
| 42 | Ga0070673_100001495 | 3300005364 | Bacteria | 13722 |
| 43 | Ga0070688_100000742 | 3300005365 | Bacteria | 16067 |
| 44 | Ga0070659_100000298 | 3300005366 | Bacteria | 38865 |
| 45 | Ga0070659_101031399 | 3300005366 | Bacteria | 723 |
| 46 | Ga0070667_100003858 | 3300005367 | Bacteria | 12733 |
| 47 | Ga0070667_100713736 | 3300005367 | Bacteria | 928 |
| 48 | Ga0070703_10015301 | 3300005406 | Bacteria | 2195 |
| 49 | Ga0070714_100033692 | 3300005435 | Bacteria | 4284 |
| 50 | Ga0070713_100170695 | 3300005436 | Bacteria | 1948 |
| 51 | Ga0070713_100224798 | 3300005436 | Bacteria | 1704 |
| 52 | Ga0070713_101802492 | 3300005436 | Bacteria | 594 |
| 53 | Ga0070710_10121066 | 3300005437 | Bacteria | 1584 |
| 54 | Ga0070701_10000337 | 3300005438 | Bacteria | 15536 |
| 55 | Ga0070711_100027251 | 3300005439 | Bacteria | 3750 |
| 56 | Ga0070705_100000291 | 3300005440 | Bacteria | 29842 |
| 57 | Ga0070700_100008281 | 3300005441 | Bacteria | 5659 |
| 58 | Ga0070663_100000088 | 3300005455 | Bacteria | 41407 |
| 59 | Ga0070678_100001508 | 3300005456 | Bacteria | 12430 |
| 60 | Ga0070678_100229070 | 3300005456 | Bacteria | 1548 |
| 61 | Ga0070662_100001414 | 3300005457 | Bacteria | 14813 |
| 62 | Ga0070681_10022721 | 3300005458 | Bacteria | 6302 |
| 63 | Ga0070681_10278143 | 3300005458 | Bacteria | 1585 |
| 64 | Ga0070681_11772591 | 3300005458 | Bacteria | 544 |
| 65 | Ga0068867_100000195 | 3300005459 | Bacteria | 40012 |
| 66 | Ga0070685_10001050 | 3300005466 | Bacteria | 14813 |
| 67 | Ga0070679_100029878 | 3300005530 | Bacteria | 5377 |
| 68 | Ga0070679_100053170 | 3300005530 | Bacteria | 4032 |
| 69 | Ga0070679_100125241 | 3300005530 | Bacteria | 2552 |
| 70 | Ga0070684_100105722 | 3300005535 | Bacteria | 2519 |
| 71 | Ga0070684_100208900 | 3300005535 | Bacteria | 1779 |
| 72 | Ga0068853_100000492 | 3300005539 | Bacteria | 26983 |
| 73 | Ga0070672_100000278 | 3300005543 | Bacteria | 29079 |
| 74 | Ga0070672_100939721 | 3300005543 | Unclassified | 765 |
| 75 | Ga0070686_100007539 | 3300005544 | Bacteria | 6076 |
| 76 | Ga0070686_100933175 | 3300005544 | Unclassified | 708 |
| 77 | Ga0070695_100345592 | 3300005545 | Bacteria | 1113 |
| 78 | Ga0070696_100103204 | 3300005546 | Bacteria | 2046 |
| 79 | Ga0070693_100052386 | 3300005547 | Bacteria | 2340 |
| 80 | Ga0070693_100301114 | 3300005547 | Bacteria | 1081 |
| 81 | Ga0070665_100041293 | 3300005548 | Bacteria | 4636 |
| 82 | Ga0070665_100110701 | 3300005548 | Bacteria | 2749 |
| 83 | Ga0070704_100033026 | 3300005549 | Bacteria | 3496 |
| 84 | Ga0068855_100000383 | 3300005563 | Bacteria | 54598 |
| 85 | Ga0068855_100362047 | 3300005563 | Bacteria | 1596 |
| 86 | Ga0068855_101374223 | 3300005563 | Unclassified | 729 |
| 87 | Ga0070664_100000502 | 3300005564 | Bacteria | 29641 |
| 88 | Ga0068857_100001343 | 3300005577 | Bacteria | 19384 |
| 89 | Ga0068857_100002329 | 3300005577 | Bacteria | 15453 |
| 90 | Ga0068854_100000362 | 3300005578 | Bacteria | 29079 |
| 91 | Ga0068854_101341315 | 3300005578 | Bacteria | 645 |
| 92 | Ga0068856_100003066 | 3300005614 | Bacteria | 17071 |
| 93 | Ga0070702_100010791 | 3300005615 | Bacteria | 4516 |
| 94 | Ga0068852_100000211 | 3300005616 | Bacteria | 39692 |
| 95 | Ga0068852_100161119 | 3300005616 | Bacteria | 2095 |
| 96 | Ga0068859_100001182 | 3300005617 | Bacteria | 26638 |
| 97 | Ga0068864_100000579 | 3300005618 | Bacteria | 31124 |
| 98 | Ga0068866_10001747 | 3300005718 | Bacteria | 9141 |
| 99 | Ga0068861_100000362 | 3300005719 | Bacteria | 26031 |
| 100 | Ga0068851_10000295 | 3300005834 | Bacteria | 22782 |
| 101 | Ga0068870_10000016 | 3300005840 | Bacteria | 62413 |
| 102 | Ga0068863_100000473 | 3300005841 | Bacteria | 41129 |
| 103 | Ga0068858_100003861 | 3300005842 | Bacteria | 14813 |
| 104 | Ga0068860_100003643 | 3300005843 | Bacteria | 15850 |
| 105 | Ga0068862_100002205 | 3300005844 | Bacteria | 17464 |
| 106 | Ga0068862_100646390 | 3300005844 | Bacteria | 1020 |
| 107 | Ga0081540_1000033 | 3300005983 | Bacteria | 142902 |
| 108 | Ga0081540_1000092 | 3300005983 | Bacteria | 94188 |
| 109 | Ga0081540_1000160 | 3300005983 | Bacteria | 69415 |
| 110 | Ga0081540_1001958 | 3300005983 | Bacteria | 17209 |
| 111 | Ga0081540_1002758 | 3300005983 | Bacteria | 14257 |
| 112 | Ga0081540_1005660 | 3300005983 | Bacteria | 9291 |
| 113 | Ga0081540_1009390 | 3300005983 | Bacteria | 6744 |
| 114 | Ga0081540_1019818 | 3300005983 | Bacteria | 4071 |
| 115 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 116 | Ga0081539_10012681 | 3300005985 | Bacteria | 6457 |
| 117 | Ga0070717_10061726 | 3300006028 | Bacteria | 3107 |
| 118 | Ga0070717_10483027 | 3300006028 | Bacteria | 1119 |
| 119 | Ga0070715_10050907 | 3300006163 | Bacteria | 1780 |
| 120 | Ga0070715_10593543 | 3300006163 | Bacteria | 648 |
| 121 | Ga0070716_100175396 | 3300006173 | Bacteria | 1402 |
| 122 | Ga0070716_101512398 | 3300006173 | Unclassified | 549 |
| 123 | Ga0070712_100207137 | 3300006175 | Bacteria | 1544 |
| 124 | Ga0075367_10865165 | 3300006178 | Unclassified | 576 |
| 125 | Ga0097621_100001946 | 3300006237 | Bacteria | 14083 |
| 126 | Ga0097621_100025809 | 3300006237 | Bacteria | 4601 |
| 127 | Ga0097621_100237347 | 3300006237 | Bacteria | 1593 |
| 128 | Ga0075370_10673850 | 3300006353 | Bacteria | 628 |
| 129 | Ga0068871_100001691 | 3300006358 | Bacteria | 14803 |
| 130 | Ga0075428_100038396 | 3300006844 | Bacteria | 5269 |
| 131 | Ga0075428_100851705 | 3300006844 | Bacteria | 968 |
| 132 | Ga0075430_100049137 | 3300006846 | Bacteria | 3561 |
| 133 | Ga0075431_100034373 | 3300006847 | Bacteria | 5222 |
| 134 | Ga0075434_101146567 | 3300006871 | Bacteria | 790 |
| 135 | Ga0075434_101576963 | 3300006871 | Bacteria | 665 |
| 136 | Ga0068865_100000163 | 3300006881 | Bacteria | 36568 |
| 137 | Ga0097620_100001182 | 3300006931 | Bacteria | 26638 |
| 138 | Ga0097620_103056249 | 3300006931 | Unclassified | 511 |
| 139 | Ga0105251_10217594 | 3300009011 | Bacteria | 860 |
| 140 | Ga0105250_10068448 | 3300009092 | Bacteria | 1433 |
| 141 | Ga0105240_10024022 | 3300009093 | Bacteria | 8051 |
| 142 | Ga0105240_10256293 | 3300009093 | Bacteria | 2020 |
| 143 | Ga0105240_10548490 | 3300009093 | Bacteria | 1279 |
| 144 | Ga0105240_10646560 | 3300009093 | Bacteria | 1159 |
| 145 | Ga0105240_11468464 | 3300009093 | Bacteria | 715 |
| 146 | Ga0105240_11474424 | 3300009093 | Bacteria | 714 |
| 147 | Ga0111539_10231497 | 3300009094 | Bacteria | 2152 |
| 148 | Ga0111539_10552752 | 3300009094 | Bacteria | 1341 |
| 149 | Ga0111539_11190654 | 3300009094 | Bacteria | 885 |
| 150 | Ga0105245_10000381 | 3300009098 | Bacteria | 41175 |
| 151 | Ga0105247_10006611 | 3300009101 | Bacteria | 7167 |
| 152 | Ga0114129_10379643 | 3300009147 | Bacteria | 1867 |
| 153 | Ga0114129_12852431 | 3300009147 | Bacteria | 573 |
| 154 | Ga0105243_10000709 | 3300009148 | Bacteria | 32137 |
| 155 | Ga0105243_12464268 | 3300009148 | Bacteria | 559 |
| 156 | Ga0105241_10007485 | 3300009174 | Bacteria | 8036 |
| 157 | Ga0105241_10243818 | 3300009174 | Bacteria | 1520 |
| 158 | Ga0105241_11344247 | 3300009174 | Bacteria | 682 |
| 159 | Ga0105241_12116479 | 3300009174 | Bacteria | 556 |
| 160 | Ga0105242_10001191 | 3300009176 | Bacteria | 20516 |
| 161 | Ga0105248_10006117 | 3300009177 | Bacteria | 13204 |
| 162 | Ga0105248_12445973 | 3300009177 | Bacteria | 595 |
| 163 | Ga0105237_10000031 | 3300009545 | Bacteria | 197346 |
| 164 | Ga0105237_10621714 | 3300009545 | Bacteria | 1087 |
| 165 | Ga0105237_10936579 | 3300009545 | Bacteria | 873 |
| 166 | Ga0105238_10001175 | 3300009551 | Bacteria | 26315 |
| 167 | Ga0105238_10139155 | 3300009551 | Bacteria | 2405 |
| 168 | Ga0105238_10227065 | 3300009551 | Bacteria | 1844 |
| 169 | Ga0105238_10711989 | 3300009551 | Bacteria | 1016 |
| 170 | Ga0105249_10001717 | 3300009553 | Bacteria | 19161 |
| 171 | Ga0105249_11520521 | 3300009553 | Bacteria | 742 |
| 172 | Ga0105249_12842918 | 3300009553 | Bacteria | 555 |
| 173 | Ga0105239_10000220 | 3300010375 | Bacteria | 84136 |
| 174 | Ga0105239_10048014 | 3300010375 | Bacteria | 4679 |
| 175 | Ga0105239_10676795 | 3300010375 | Bacteria | 1179 |
| 176 | Ga0105239_10946166 | 3300010375 | Bacteria | 989 |
| 177 | Ga0105239_11071644 | 3300010375 | Bacteria | 927 |
| 178 | Ga0105246_10000977 | 3300011119 | Bacteria | 16400 |
| 179 | Ga0157373_10010125 | 3300013100 | Bacteria | 6947 |
| 180 | Ga0157371_10000246 | 3300013102 | Bacteria | 76861 |
| 181 | Ga0157370_10863834 | 3300013104 | Bacteria | 822 |
| 182 | Ga0157369_10000669 | 3300013105 | Bacteria | 44175 |
| 183 | Ga0157369_11135006 | 3300013105 | Bacteria | 798 |
| 184 | Ga0157374_10000295 | 3300013296 | Bacteria | 46020 |
| 185 | Ga0157378_10002394 | 3300013297 | Bacteria | 16664 |
| 186 | Ga0163162_10000200 | 3300013306 | Bacteria | 55467 |
| 187 | Ga0157372_10002464 | 3300013307 | Bacteria | 20056 |
| 188 | Ga0157372_10185167 | 3300013307 | Bacteria | 2411 |
| 189 | Ga0157372_10453760 | 3300013307 | Bacteria | 1494 |
| 190 | Ga0157375_10002554 | 3300013308 | Bacteria | 15800 |
| 191 | Ga0163163_10052410 | 3300014325 | Bacteria | 4025 |
| 192 | Ga0157380_10311327 | 3300014326 | Bacteria | 1455 |
| 193 | Ga0182008_10434213 | 3300014497 | Bacteria | 711 |
| 194 | Ga0157377_10000434 | 3300014745 | Bacteria | 18067 |
| 195 | Ga0157379_10002267 | 3300014968 | Bacteria | 16029 |
| 196 | Ga0157379_12182436 | 3300014968 | Unclassified | 550 |
| 197 | Ga0157376_10001200 | 3300014969 | Bacteria | 17107 |
| 198 | Ga0157376_10021399 | 3300014969 | Bacteria | 5022 |
| 199 | Ga0182007_10004082 | 3300015262 | Bacteria | 6718 |
| 200 | Ga0163161_10033504 | 3300017792 | Bacteria | 3671 |
| 201 | Ga0213873_10004287 | 3300021358 | Bacteria | 2648 |
| 202 | Ga0213874_10065558 | 3300021377 | Bacteria | 1148 |
| 203 | Ga0213876_10013883 | 3300021384 | Bacteria | 4269 |
| 204 | Ga0213876_10014014 | 3300021384 | Bacteria | 4249 |
| 205 | Ga0213871_10086300 | 3300021441 | Bacteria | 905 |
| 206 | Ga0209148_1015299 | 3300025254 | Bacteria | 1342 |
| 207 | Ga0209676_1000019 | 3300025292 | Bacteria | 620012 |
| 208 | Ga0209050_1025127 | 3300025298 | Bacteria | 2036 |
| 209 | Ga0207697_10000838 | 3300025315 | Bacteria | 17402 |
| 210 | Ga0207656_10000926 | 3300025321 | Bacteria | 9559 |
| 211 | Ga0207696_1093141 | 3300025711 | Bacteria | 825 |
| 212 | Ga0207653_10049532 | 3300025885 | Bacteria | 1395 |
| 213 | Ga0207682_10000341 | 3300025893 | Bacteria | 21274 |
| 214 | Ga0207692_10000103 | 3300025898 | Bacteria | 24933 |
| 215 | Ga0207642_10001097 | 3300025899 | Bacteria | 8392 |
| 216 | Ga0207710_10002696 | 3300025900 | Bacteria | 8144 |
| 217 | Ga0207710_10147411 | 3300025900 | Bacteria | 1140 |
| 218 | Ga0207688_10000180 | 3300025901 | Bacteria | 28077 |
| 219 | Ga0207680_10000409 | 3300025903 | Bacteria | 20437 |
| 220 | Ga0207647_10002034 | 3300025904 | Bacteria | 15462 |
| 221 | Ga0207647_10194920 | 3300025904 | Bacteria | 1173 |
| 222 | Ga0207685_10382183 | 3300025905 | Bacteria | 718 |
| 223 | Ga0207699_10026321 | 3300025906 | Bacteria | 3204 |
| 224 | Ga0207645_10002089 | 3300025907 | Bacteria | 15981 |
| 225 | Ga0207643_10000005 | 3300025908 | Bacteria | 182148 |
| 226 | Ga0207705_10001360 | 3300025909 | Bacteria | 19548 |
| 227 | Ga0207654_10010169 | 3300025911 | Bacteria | 4787 |
| 228 | Ga0207654_10184995 | 3300025911 | Bacteria | 1361 |
| 229 | Ga0207707_10000515 | 3300025912 | Bacteria | 39696 |
| 230 | Ga0207707_11018979 | 3300025912 | Bacteria | 679 |
| 231 | Ga0207695_10026891 | 3300025913 | Bacteria | 6414 |
| 232 | Ga0207695_10374351 | 3300025913 | Bacteria | 1310 |
| 233 | Ga0207695_10539757 | 3300025913 | Bacteria | 1048 |
| 234 | Ga0207695_11094760 | 3300025913 | Bacteria | 676 |
| 235 | Ga0207671_10000265 | 3300025914 | Bacteria | 78548 |
| 236 | Ga0207671_10694756 | 3300025914 | Bacteria | 809 |
| 237 | Ga0207671_10987186 | 3300025914 | Unclassified | 664 |
| 238 | Ga0207693_10004906 | 3300025915 | Bacteria | 11244 |
| 239 | Ga0207663_10003171 | 3300025916 | Bacteria | 7998 |
| 240 | Ga0207660_10015490 | 3300025917 | Bacteria | 5033 |
| 241 | Ga0207660_10113965 | 3300025917 | Bacteria | 2039 |
| 242 | Ga0207662_10000323 | 3300025918 | Bacteria | 21713 |
| 243 | Ga0207657_10000029 | 3300025919 | Bacteria | 137747 |
| 244 | Ga0207649_10001081 | 3300025920 | Bacteria | 16588 |
| 245 | Ga0207649_10065047 | 3300025920 | Bacteria | 2307 |
| 246 | Ga0207652_10012880 | 3300025921 | Bacteria | 6764 |
| 247 | Ga0207652_10081161 | 3300025921 | Bacteria | 2836 |
| 248 | Ga0207681_10000063 | 3300025923 | Bacteria | 99129 |
| 249 | Ga0207694_10002389 | 3300025924 | Bacteria | 15358 |
| 250 | Ga0207694_10141946 | 3300025924 | Bacteria | 1932 |
| 251 | Ga0207694_10478978 | 3300025924 | Bacteria | 1041 |
| 252 | Ga0207650_10000232 | 3300025925 | Bacteria | 62024 |
| 253 | Ga0207659_10000261 | 3300025926 | Bacteria | 32209 |
| 254 | Ga0207687_10012169 | 3300025927 | Bacteria | 5628 |
| 255 | Ga0207700_10007676 | 3300025928 | Bacteria | 6622 |
| 256 | Ga0207700_10786118 | 3300025928 | Bacteria | 851 |
| 257 | Ga0207664_10359495 | 3300025929 | Bacteria | 1290 |
| 258 | Ga0207664_10995714 | 3300025929 | Bacteria | 751 |
| 259 | Ga0207644_10001200 | 3300025931 | Bacteria | 16673 |
| 260 | Ga0207690_10001154 | 3300025932 | Bacteria | 16720 |
| 261 | Ga0207706_10000231 | 3300025933 | Bacteria | 60951 |
| 262 | Ga0207686_10000955 | 3300025934 | Bacteria | 17248 |
| 263 | Ga0207709_10018159 | 3300025935 | Bacteria | 3935 |
| 264 | Ga0207670_10000132 | 3300025936 | Bacteria | 49228 |
| 265 | Ga0207669_10000306 | 3300025937 | Bacteria | 22381 |
| 266 | Ga0207704_10000304 | 3300025938 | Bacteria | 23156 |
| 267 | Ga0207665_10021905 | 3300025939 | Bacteria | 4202 |
| 268 | Ga0207665_10211069 | 3300025939 | Bacteria | 1418 |
| 269 | Ga0207665_10489408 | 3300025939 | Bacteria | 949 |
| 270 | Ga0207691_10000068 | 3300025940 | Bacteria | 84243 |
| 271 | Ga0207711_10000068 | 3300025941 | Bacteria | 116544 |
| 272 | Ga0207689_10000375 | 3300025942 | Bacteria | 42073 |
| 273 | Ga0207661_10000871 | 3300025944 | Bacteria | 19830 |
| 274 | Ga0207661_10881788 | 3300025944 | Bacteria | 824 |
| 275 | Ga0207679_10000346 | 3300025945 | Bacteria | 33746 |
| 276 | Ga0207679_10000937 | 3300025945 | Bacteria | 18658 |
| 277 | Ga0207679_11147687 | 3300025945 | Unclassified | 713 |
| 278 | Ga0207667_10001908 | 3300025949 | Bacteria | 26171 |
| 279 | Ga0207667_11021779 | 3300025949 | Bacteria | 813 |
| 280 | Ga0207667_11141065 | 3300025949 | Bacteria | 761 |
| 281 | Ga0207667_11976478 | 3300025949 | Bacteria | 544 |
| 282 | Ga0207651_10000480 | 3300025960 | Bacteria | 16796 |
| 283 | Ga0207651_10254438 | 3300025960 | Bacteria | 1439 |
| 284 | Ga0207712_10000187 | 3300025961 | Bacteria | 64116 |
| 285 | Ga0207712_10840762 | 3300025961 | Bacteria | 809 |
| 286 | Ga0207668_10000710 | 3300025972 | Bacteria | 20346 |
| 287 | Ga0207640_10000399 | 3300025981 | Bacteria | 27562 |
| 288 | Ga0207640_10336706 | 3300025981 | Unclassified | 1207 |
| 289 | Ga0207640_10892732 | 3300025981 | Bacteria | 776 |
| 290 | Ga0207658_10000246 | 3300025986 | Bacteria | 56484 |
| 291 | Ga0207658_11992852 | 3300025986 | Bacteria | 528 |
| 292 | Ga0207677_10000018 | 3300026023 | Bacteria | 139501 |
| 293 | Ga0207703_10002135 | 3300026035 | Bacteria | 17388 |
| 294 | Ga0207639_10001572 | 3300026041 | Bacteria | 15314 |
| 295 | Ga0207678_10000349 | 3300026067 | Bacteria | 41962 |
| 296 | Ga0207678_10537183 | 3300026067 | Bacteria | 1022 |
| 297 | Ga0207708_10002216 | 3300026075 | Bacteria | 14370 |
| 298 | Ga0207702_10001606 | 3300026078 | Bacteria | 22359 |
| 299 | Ga0207641_10001499 | 3300026088 | Bacteria | 22841 |
| 300 | Ga0207648_10003596 | 3300026089 | Bacteria | 16212 |
| 301 | Ga0207676_10000289 | 3300026095 | Bacteria | 43323 |
| 302 | Ga0207674_10004634 | 3300026116 | Bacteria | 16506 |
| 303 | Ga0207674_10005187 | 3300026116 | Bacteria | 15520 |
| 304 | Ga0207675_100000002 | 3300026118 | Bacteria | 325956 |
| 305 | Ga0207683_10000070 | 3300026121 | Bacteria | 78648 |
| 306 | Ga0207683_10442911 | 3300026121 | Bacteria | 1197 |
| 307 | Ga0207698_10000699 | 3300026142 | Bacteria | 19497 |
| 308 | Ga0268266_10000139 | 3300028379 | Bacteria | 140538 |
| 309 | Ga0268266_10045868 | 3300028379 | Bacteria | 3741 |
| 310 | Ga0268265_10000148 | 3300028380 | Bacteria | 86667 |
| 311 | Ga0268264_10000312 | 3300028381 | Bacteria | 78042 |
| 312 | Ga0268264_10633549 | 3300028381 | Bacteria | 1057 |
| 313 | Ga0265338_10135573 | 3300028800 | Bacteria | 1936 |
| 314 | Ga0307408_100643532 | 3300031548 | Bacteria | 947 |
| 315 | Ga0307412_10865857 | 3300031911 | Unclassified | 789 |
| 316 | Ga0307409_101973033 | 3300031995 | Bacteria | 613 |
| 317 | Ga0307415_101521313 | 3300032126 | Bacteria | 641 |
| 318 | Ga0307510_10159987 | 3300033180 | Bacteria | 1851 |
| 319 | Ga0373958_0218448 | 3300034819 | Bacteria | 506 |
| 320 | Ga0373926_0062158 | 3300035083 | Bacteria | 1363 |
| 321 | Ga0373929_0184110 | 3300035085 | Bacteria | 577 |
| 322 | Ga0373934_0019278 | 3300035086 | Bacteria | 2617 |
| 323 | Ga0373944_0326175 | 3300035089 | Bacteria | 580 |
| 324 | Ga0373949_0098557 | 3300035090 | Bacteria | 798 |
| 325 | Ga0373923_0035743 | 3300035111 | Bacteria | 2024 |
| 326 | Ga0373932_0172963 | 3300035112 | Bacteria | 753 |
| 327 | Ga0373936_0032816 | 3300035113 | Bacteria | 2055 |
| 328 | Ga0373939_0473649 | 3300035114 | Bacteria | 531 |
| 329 | Ga0373941_0293948 | 3300035115 | Bacteria | 646 |
| 330 | Ga0373945_0013565 | 3300035116 | Bacteria | 2721 |
| 331 | Ga0373953_0100293 | 3300035117 | Bacteria | 1218 |
| 332 | Ga0373956_0238950 | 3300035119 | Bacteria | 863 |
| 333 | Ga0373960_0459257 | 3300035121 | Bacteria | 500 |
| 334 | Ga0373943_0046899 | 3300035170 | Bacteria | 2110 |
| 335 | Ga0373946_0033274 | 3300035171 | Bacteria | 2074 |
| 336 | Ga0373924_0008447 | 3300035410 | Bacteria | 3743 |
| 337 | Ga0373931_0099972 | 3300035691 | Bacteria | 1630 |
| 338 | Ga0373935_0203057 | 3300035692 | Bacteria | 1370 |
| 339 | Ga0373927_0065995 | 3300035695 | Bacteria | 2340 |
| 340 | Ga0373927_0223450 | 3300035695 | Bacteria | 1237 |
| 341 | Ga0373927_0446015 | 3300035695 | Bacteria | 855 |
| 342 | Ga0373933_0017863 | 3300035724 | Bacteria | 3983 |
| 343 | Ga0373947_0306030 | 3300035725 | Bacteria | 1060 |
| 344 | Ga0373937_0247735 | 3300036401 | Bacteria | 1679 |
| 345 | Ga0373937_2080632 | 3300036401 | Bacteria | 514 |
| 346 | Ga0373925_0038145 | 3300037068 | Bacteria | 3550 |
| 347 | Ga0395900_1675322 | 3300037418 | Bacteria | 547 |
| 348 | Ga0395901_1624662 | 3300038443 | Bacteria | 599 |
| 349 | Ga0436365_0162961 | 3300039437 | Bacteria | 1036 |
| 350 | Ga0436365_1179309 | 3300039437 | Bacteria | 16337 |
| 351 | Ga0436365_1464659 | 3300039437 | Bacteria | 8569 |
| 352 | Ga0436360_0101891 | 3300039438 | Bacteria | 1159 |
| 353 | Ga0436360_1267572 | 3300039438 | Bacteria | 1688 |
| 354 | Ga0436360_1270624 | 3300039438 | Bacteria | 1653 |
| 355 | Ga0436363_0317740 | 3300039450 | Bacteria | 615 |
| 356 | Ga0436363_0369350 | 3300039450 | Bacteria | 1551 |
| 357 | Ga0436363_0570044 | 3300039450 | Bacteria | 4195 |
| 358 | Ga0436362_0267840 | 3300039453 | Bacteria | 586 |
| 359 | Ga0436362_0906680 | 3300039453 | Bacteria | 2781 |
| 360 | Ga0436362_1132497 | 3300039453 | Bacteria | 516 |
| 361 | Ga0439452_134252 | 3300042010 | Bacteria | 524 |
| 362 | Ga0439455_0004201 | 3300042012 | Bacteria | 2834 |
| 363 | Ga0439458_0058555 | 3300042157 | Bacteria | 959 |
| 364 | Ga0439464_0080890 | 3300042439 | Bacteria | 970 |
| 365 | Ga0451577_0065363 | 3300042876 | Bacteria | 3244 |
| 366 | Ga0466969_0327965 | 3300044656 | Bacteria | 693 |
| 367 | Ga0466972_0305134 | 3300044658 | Bacteria | 744 |
| 368 | Ga0466966_0092093 | 3300044684 | Bacteria | 1881 |
| 369 | Ga0466966_0159338 | 3300044684 | Bacteria | 1374 |
| 370 | Ga0466963_0005218 | 3300044694 | Bacteria | 7585 |
| 371 | Ga0453684_0461524 | 3300044712 | Bacteria | 1412 |
| 372 | Ga0466971_0576114 | 3300044719 | Bacteria | 560 |
| 373 | Ga0466970_0003811 | 3300044765 | Bacteria | 7385 |
| 374 | Ga0466957_0014719 | 3300044842 | Bacteria | 4558 |
| 375 | Ga0466957_0167264 | 3300044842 | Bacteria | 1431 |
| 376 | Ga0466959_0139654 | 3300045049 | Bacteria | 1713 |
| 377 | Ga0466959_0505796 | 3300045049 | Bacteria | 816 |
| 378 | Ga0451576_0905492 | 3300045051 | Unclassified | 925 |
| 379 | Ga0466958_0246797 | 3300045836 | Bacteria | 1141 |
| 380 | Ga0466958_0827955 | 3300045836 | Bacteria | 604 |
| 381 | Ga0466967_0024840 | 3300045976 | Bacteria | 4933 |
| 382 | Ga0495580_0050456 | 3300046472 | Bacteria | 2942 |
| 383 | Ga0495582_0176610 | 3300046473 | Bacteria | 1216 |
| 384 | Ga0495639_0035968 | 3300046475 | Bacteria | 2216 |
| 385 | Ga0495664_0018920 | 3300046477 | Bacteria | 3953 |
| 386 | Ga0495584_0367135 | 3300046491 | Bacteria | 731 |
| 387 | Ga0495594_0161393 | 3300046499 | Bacteria | 1274 |
| 388 | Ga0495608_0061189 | 3300046511 | Bacteria | 2477 |
| 389 | Ga0495618_0084457 | 3300046514 | Bacteria | 2028 |
| 390 | Ga0495628_0200212 | 3300046516 | Bacteria | 1505 |
| 391 | Ga0495630_0037810 | 3300046517 | Bacteria | 3609 |
| 392 | Ga0495652_0546952 | 3300046529 | Bacteria | 797 |
| 393 | Ga0495665_0011536 | 3300046531 | Bacteria | 4784 |
| 394 | Ga0495640_0083977 | 3300046533 | Bacteria | 2113 |
| 395 | Ga0495645_0037032 | 3300046543 | Bacteria | 3556 |
| 396 | Ga0495645_0077512 | 3300046543 | Bacteria | 2389 |
| 397 | Ga0495667_0095524 | 3300046559 | Bacteria | 1924 |
| 398 | Ga0495634_0079801 | 3300046642 | Bacteria | 2142 |
| 399 | Ga0495635_0104447 | 3300046663 | Bacteria | 1936 |
| 400 | Ga0495657_0531303 | 3300046675 | Bacteria | 684 |
| 401 | Ga0495599_0152734 | 3300046678 | Bacteria | 1429 |
| 402 | Ga0495646_0072431 | 3300046680 | Bacteria | 2026 |
| 403 | Ga0495646_0195777 | 3300046680 | Bacteria | 1103 |
| 404 | Ga0495647_0274929 | 3300046681 | Bacteria | 754 |
| 405 | Ga0495658_0077190 | 3300046683 | Bacteria | 1947 |
| 406 | Ga0495613_0117714 | 3300046689 | Bacteria | 1910 |
| 407 | Ga0495600_0656112 | 3300046809 | Bacteria | 634 |
| 408 | Ga0495581_0101965 | 3300047315 | Bacteria | 1667 |
| 409 | Ga0495581_0356539 | 3300047315 | Unclassified | 854 |
| 410 | Ga0495604_0251537 | 3300047317 | Bacteria | 1204 |
| 411 | Ga0495674_0104935 | 3300047319 | Bacteria | 2402 |
| 412 | Ga0495684_0040446 | 3300047471 | Bacteria | 3574 |
| 413 | Ga0496100_0217582 | 3300048903 | Bacteria | 1400 |
| 414 | Ga0496102_0001246 | 3300048905 | Bacteria | 22983 |
| 415 | Ga0496103_0434459 | 3300048906 | Bacteria | 842 |
| 416 | Ga0496106_0003910 | 3300048909 | Bacteria | 11122 |
| 417 | Ga0496107_0015186 | 3300048910 | Bacteria | 5395 |
| 418 | Ga0496109_0002793 | 3300048912 | Bacteria | 14621 |
| 419 | Ga0496110_0113159 | 3300048913 | Bacteria | 2440 |
| 420 | Ga0496110_0346771 | 3300048913 | Bacteria | 1353 |
| 421 | Ga0496112_0001943 | 3300048915 | Bacteria | 16329 |
| 422 | Ga0496112_0133829 | 3300048915 | Bacteria | 2450 |
| 423 | Ga0496113_0004846 | 3300048916 | Bacteria | 8331 |
| 424 | Ga0496114_0900391 | 3300048917 | Bacteria | 766 |
| 425 | Ga0496115_0541844 | 3300048918 | Bacteria | 931 |
| 426 | Ga0496115_0817680 | 3300048918 | Bacteria | 724 |
| 427 | Ga0496121_0298489 | 3300048924 | Bacteria | 1094 |
| 428 | Ga0496126_0298742 | 3300048929 | Bacteria | 1329 |
| 429 | Ga0496126_0381533 | 3300048929 | Bacteria | 1147 |
| 430 | Ga0501034_1294721 | 3300049571 | Bacteria | 606 |
| 431 | Ga0501037_0555632 | 3300049573 | Unclassified | 774 |
| 432 | Ga0501077_0191362 | 3300049593 | Bacteria | 1300 |
| 433 | Ga0501079_0659806 | 3300049741 | Bacteria | 823 |
| 434 | Ga0501081_0654848 | 3300049743 | Bacteria | 787 |
| 435 | Ga0501044_0807314 | 3300049823 | Bacteria | 817 |
| 436 | Ga0501044_1598888 | 3300049823 | Bacteria | 517 |
| 437 | nmdc:mga06z11_795404_c1 | 3300050494 | Unclassified | 576 |
| 438 | nmdc:mga07m45_277739_c1 | 3300050496 | Bacteria | 974 |
| 439 | nmdc:mga05p37_324796_c1 | 3300050507 | Bacteria | 1820 |
| 440 | nmdc:mga09592_1300499_c1 | 3300050508 | Bacteria | 598 |
| 441 | nmdc:mga0qj67_123536_c1 | 3300050509 | Bacteria | 2094 |
| 442 | nmdc:mga06r32_506524_c1 | 3300050510 | Bacteria | 1184 |
| 443 | nmdc:mga08y16_315789_c1 | 3300050511 | Bacteria | 1609 |
| 444 | nmdc:mga0n895_541355_c1 | 3300050512 | Bacteria | 1170 |
| 445 | nmdc:mga0n895_626512_c1 | 3300050512 | Bacteria | 1076 |
| 446 | Ga0495601_0070719 | 3300053077 | Bacteria | 2228 |
| 447 | Ga0495612_0015491 | 3300053078 | Bacteria | 3057 |
| 448 | Ga0500647_0073817 | 3300053091 | Bacteria | 1637 |
| 449 | Ga0500559_0028509 | 3300053136 | Bacteria | 2386 |
| 450 | Ga0501082_0684667 | 3300060353 | Bacteria | 897 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039453 | Ga0436362_1132497 | Ga0436362_1132497_18_302 | 93 |
| 2 | iso_pu_bacteria | 2522572158 | 2523104637 | 93 |
| 3 | 3300021441 | Ga0213871_10086300 | Ga0213871_100863002 | 94 |
| 4 | iso_pu_bacteria | 2615840698 | 2616553692 | 94 |
| 5 | iso_pu_bacteria | 8057575449 | 8057578959 | 94 |
| 6 | 3300025912 | Ga0207707_11018979 | Ga0207707_110189791 | 95 |
| 7 | iso_pu_bacteria | 2643221598 | 2644001289 | 95 |
| 8 | iso_pu_bacteria | 8055066027 | 8055069533 | 95 |
| 9 | iso_pu_bacteria | 8056967851 | 8056974157 | 95 |
| 10 | 3300005366 | Ga0070659_101031399 | Ga0070659_1010313991 | 96 |
| 11 | 3300005436 | Ga0070713_100224798 | Ga0070713_1002247982 | 97 |
| 12 | 3300025929 | Ga0207664_10359495 | Ga0207664_103594953 | 97 |
| 13 | 3300028800 | Ga0265338_10135573 | Ga0265338_101355733 | 97 |
| 14 | 3300039438 | Ga0436360_1270624 | Ga0436360_1270624_1258_1554 | 97 |
| 15 | 3300039437 | Ga0436365_0162961 | Ga0436365_0162961_726_1025 | 98 |
| 16 | 3300039453 | Ga0436362_0267840 | Ga0436362_0267840_228_527 | 98 |
| 17 | 3300044658 | Ga0466972_0305134 | Ga0466972_0305134_199_498 | 98 |
| 18 | 3300044684 | Ga0466966_0159338 | Ga0466966_0159338_932_1231 | 98 |
| 19 | 3300044694 | Ga0466963_0005218 | Ga0466963_0005218_655_954 | 98 |
| 20 | 3300044765 | Ga0466970_0003811 | Ga0466970_0003811_497_796 | 98 |
| 21 | 3300044842 | Ga0466957_0014719 | Ga0466957_0014719_447_746 | 98 |
| 22 | 3300045049 | Ga0466959_0139654 | Ga0466959_0139654_601_900 | 98 |
| 23 | 3300045836 | Ga0466958_0246797 | Ga0466958_0246797_102_401 | 98 |
| 24 | 3300045976 | Ga0466967_0024840 | Ga0466967_0024840_208_507 | 98 |
| 25 | 3300003203 | JGI25406J46586_10003612 | JGI25406J46586_100036125 | 99 |
| 26 | 3300003781 | Ga0055536_1019096 | Ga0055536_10190962 | 99 |
| 27 | 3300005295 | Ga0065707_10146936 | Ga0065707_101469362 | 99 |
| 28 | 3300005329 | Ga0070683_101337267 | Ga0070683_1013372672 | 99 |
| 29 | 3300005331 | Ga0070670_100907153 | Ga0070670_1009071531 | 99 |
| 30 | 3300005336 | Ga0070680_100017602 | Ga0070680_1000176025 | 99 |
| 31 | 3300005337 | Ga0070682_100119683 | Ga0070682_1001196832 | 99 |
| 32 | 3300005354 | Ga0070675_101641665 | Ga0070675_1016416651 | 99 |
| 33 | 3300005356 | Ga0070674_101891890 | Ga0070674_1018918901 | 99 |
| 34 | 3300005367 | Ga0070667_100713736 | Ga0070667_1007137362 | 99 |
| 35 | 3300005435 | Ga0070714_100033692 | Ga0070714_1000336922 | 99 |
| 36 | 3300005436 | Ga0070713_100170695 | Ga0070713_1001706952 | 99 |
| 37 | 3300005436 | Ga0070713_101802492 | Ga0070713_1018024921 | 99 |
| 38 | 3300005437 | Ga0070710_10121066 | Ga0070710_101210662 | 99 |
| 39 | 3300005439 | Ga0070711_100027251 | Ga0070711_1000272513 | 99 |
| 40 | 3300005458 | Ga0070681_10022721 | Ga0070681_100227216 | 99 |
| 41 | 3300005458 | Ga0070681_10278143 | Ga0070681_102781431 | 99 |
| 42 | 3300005458 | Ga0070681_11772591 | Ga0070681_117725911 | 99 |
| 43 | 3300005530 | Ga0070679_100029878 | Ga0070679_1000298784 | 99 |
| 44 | 3300005530 | Ga0070679_100125241 | Ga0070679_1001252412 | 99 |
| 45 | 3300005543 | Ga0070672_100939721 | Ga0070672_1009397212 | 99 |
| 46 | 3300005544 | Ga0070686_100933175 | Ga0070686_1009331752 | 99 |
| 47 | 3300005547 | Ga0070693_100301114 | Ga0070693_1003011141 | 99 |
| 48 | 3300005548 | Ga0070665_100110701 | Ga0070665_1001107012 | 99 |
| 49 | 3300005563 | Ga0068855_100362047 | Ga0068855_1003620472 | 99 |
| 50 | 3300005563 | Ga0068855_101374223 | Ga0068855_1013742232 | 99 |
| 51 | 3300005578 | Ga0068854_101341315 | Ga0068854_1013413152 | 99 |
| 52 | 3300005983 | Ga0081540_1000092 | Ga0081540_100009269 | 99 |
| 53 | 3300005983 | Ga0081540_1002758 | Ga0081540_100275813 | 99 |
| 54 | 3300005983 | Ga0081540_1005660 | Ga0081540_10056605 | 99 |
| 55 | 3300005983 | Ga0081540_1009390 | Ga0081540_10093905 | 99 |
| 56 | 3300005983 | Ga0081540_1019818 | Ga0081540_10198184 | 99 |
| 57 | 3300005985 | Ga0081539_10000157 | Ga0081539_1000015728 | 99 |
| 58 | 3300005985 | Ga0081539_10012681 | Ga0081539_100126813 | 99 |
| 59 | 3300006028 | Ga0070717_10061726 | Ga0070717_100617261 | 99 |
| 60 | 3300006028 | Ga0070717_10483027 | Ga0070717_104830272 | 99 |
| 61 | 3300006163 | Ga0070715_10050907 | Ga0070715_100509072 | 99 |
| 62 | 3300006173 | Ga0070716_100175396 | Ga0070716_1001753961 | 99 |
| 63 | 3300006173 | Ga0070716_101512398 | Ga0070716_1015123982 | 99 |
| 64 | 3300006175 | Ga0070712_100207137 | Ga0070712_1002071372 | 99 |
| 65 | 3300006178 | Ga0075367_10865165 | Ga0075367_108651651 | 99 |
| 66 | 3300006237 | Ga0097621_100237347 | Ga0097621_1002373472 | 99 |
| 67 | 3300006353 | Ga0075370_10673850 | Ga0075370_106738502 | 99 |
| 68 | 3300006844 | Ga0075428_100038396 | Ga0075428_1000383962 | 99 |
| 69 | 3300006844 | Ga0075428_100851705 | Ga0075428_1008517052 | 99 |
| 70 | 3300006846 | Ga0075430_100049137 | Ga0075430_1000491373 | 99 |
| 71 | 3300006847 | Ga0075431_100034373 | Ga0075431_1000343735 | 99 |
| 72 | 3300009093 | Ga0105240_10256293 | Ga0105240_102562932 | 99 |
| 73 | 3300009093 | Ga0105240_10548490 | Ga0105240_105484902 | 99 |
| 74 | 3300009093 | Ga0105240_10646560 | Ga0105240_106465602 | 99 |
| 75 | 3300009093 | Ga0105240_11468464 | Ga0105240_114684641 | 99 |
| 76 | 3300009093 | Ga0105240_11474424 | Ga0105240_114744241 | 99 |
| 77 | 3300009094 | Ga0111539_10231497 | Ga0111539_102314972 | 99 |
| 78 | 3300009094 | Ga0111539_11190654 | Ga0111539_111906542 | 99 |
| 79 | 3300009147 | Ga0114129_10379643 | Ga0114129_103796433 | 99 |
| 80 | 3300009147 | Ga0114129_12852431 | Ga0114129_128524312 | 99 |
| 81 | 3300009148 | Ga0105243_12464268 | Ga0105243_124642681 | 99 |
| 82 | 3300009174 | Ga0105241_11344247 | Ga0105241_113442472 | 99 |
| 83 | 3300009177 | Ga0105248_12445973 | Ga0105248_124459731 | 99 |
| 84 | 3300009545 | Ga0105237_10621714 | Ga0105237_106217142 | 99 |
| 85 | 3300009545 | Ga0105237_10936579 | Ga0105237_109365792 | 99 |
| 86 | 3300009551 | Ga0105238_10227065 | Ga0105238_102270652 | 99 |
| 87 | 3300009551 | Ga0105238_10711989 | Ga0105238_107119892 | 99 |
| 88 | 3300009553 | Ga0105249_11520521 | Ga0105249_115205211 | 99 |
| 89 | 3300009553 | Ga0105249_12842918 | Ga0105249_128429182 | 99 |
| 90 | 3300010375 | Ga0105239_10048014 | Ga0105239_100480145 | 99 |
| 91 | 3300010375 | Ga0105239_10946166 | Ga0105239_109461662 | 99 |
| 92 | 3300010375 | Ga0105239_11071644 | Ga0105239_110716442 | 99 |
| 93 | 3300013104 | Ga0157370_10863834 | Ga0157370_108638341 | 99 |
| 94 | 3300013307 | Ga0157372_10185167 | Ga0157372_101851672 | 99 |
| 95 | 3300014968 | Ga0157379_12182436 | Ga0157379_121824362 | 99 |
| 96 | 3300021358 | Ga0213873_10004287 | Ga0213873_100042874 | 99 |
| 97 | 3300021377 | Ga0213874_10065558 | Ga0213874_100655582 | 99 |
| 98 | 3300021384 | Ga0213876_10013883 | Ga0213876_100138832 | 99 |
| 99 | 3300021384 | Ga0213876_10014014 | Ga0213876_100140144 | 99 |
| 100 | 3300025254 | Ga0209148_1015299 | Ga0209148_10152992 | 99 |
| 101 | 3300025292 | Ga0209676_1000019 | Ga0209676_100001959 | 99 |
| 102 | 3300025298 | Ga0209050_1025127 | Ga0209050_10251272 | 99 |
| 103 | 3300025898 | Ga0207692_10000103 | Ga0207692_100001033 | 99 |
| 104 | 3300025900 | Ga0207710_10147411 | Ga0207710_101474112 | 99 |
| 105 | 3300025904 | Ga0207647_10194920 | Ga0207647_101949202 | 99 |
| 106 | 3300025905 | Ga0207685_10382183 | Ga0207685_103821832 | 99 |
| 107 | 3300025906 | Ga0207699_10026321 | Ga0207699_100263213 | 99 |
| 108 | 3300025912 | Ga0207707_10000515 | Ga0207707_100005158 | 99 |
| 109 | 3300025913 | Ga0207695_10374351 | Ga0207695_103743511 | 99 |
| 110 | 3300025913 | Ga0207695_10539757 | Ga0207695_105397571 | 99 |
| 111 | 3300025913 | Ga0207695_11094760 | Ga0207695_110947602 | 99 |
| 112 | 3300025914 | Ga0207671_10694756 | Ga0207671_106947562 | 99 |
| 113 | 3300025914 | Ga0207671_10987186 | Ga0207671_109871862 | 99 |
| 114 | 3300025915 | Ga0207693_10004906 | Ga0207693_100049065 | 99 |
| 115 | 3300025916 | Ga0207663_10003171 | Ga0207663_100031715 | 99 |
| 116 | 3300025917 | Ga0207660_10113965 | Ga0207660_101139653 | 99 |
| 117 | 3300025921 | Ga0207652_10012880 | Ga0207652_100128806 | 99 |
| 118 | 3300025921 | Ga0207652_10081161 | Ga0207652_100811612 | 99 |
| 119 | 3300025924 | Ga0207694_10141946 | Ga0207694_101419462 | 99 |
| 120 | 3300025924 | Ga0207694_10478978 | Ga0207694_104789782 | 99 |
| 121 | 3300025928 | Ga0207700_10007676 | Ga0207700_100076763 | 99 |
| 122 | 3300025928 | Ga0207700_10786118 | Ga0207700_107861181 | 99 |
| 123 | 3300025929 | Ga0207664_10995714 | Ga0207664_109957142 | 99 |
| 124 | 3300025939 | Ga0207665_10021905 | Ga0207665_100219053 | 99 |
| 125 | 3300025939 | Ga0207665_10211069 | Ga0207665_102110692 | 99 |
| 126 | 3300025939 | Ga0207665_10489408 | Ga0207665_104894081 | 99 |
| 127 | 3300025949 | Ga0207667_11021779 | Ga0207667_110217792 | 99 |
| 128 | 3300025949 | Ga0207667_11141065 | Ga0207667_111410651 | 99 |
| 129 | 3300025949 | Ga0207667_11976478 | Ga0207667_119764782 | 99 |
| 130 | 3300025960 | Ga0207651_10254438 | Ga0207651_102544382 | 99 |
| 131 | 3300025961 | Ga0207712_10840762 | Ga0207712_108407622 | 99 |
| 132 | 3300025981 | Ga0207640_10892732 | Ga0207640_108927322 | 99 |
| 133 | 3300025986 | Ga0207658_11992852 | Ga0207658_119928521 | 99 |
| 134 | 3300026067 | Ga0207678_10537183 | Ga0207678_105371832 | 99 |
| 135 | 3300028379 | Ga0268266_10045868 | Ga0268266_100458683 | 99 |
| 136 | 3300028381 | Ga0268264_10633549 | Ga0268264_106335492 | 99 |
| 137 | 3300031548 | Ga0307408_100643532 | Ga0307408_1006435322 | 99 |
| 138 | 3300031911 | Ga0307412_10865857 | Ga0307412_108658572 | 99 |
| 139 | 3300032126 | Ga0307415_101521313 | Ga0307415_1015213131 | 99 |
| 140 | 3300033180 | Ga0307510_10159987 | Ga0307510_101599873 | 99 |
| 141 | 3300035083 | Ga0373926_0062158 | Ga0373926_0062158_966_1268 | 99 |
| 142 | 3300035086 | Ga0373934_0019278 | Ga0373934_0019278_669_971 | 99 |
| 143 | 3300035089 | Ga0373944_0326175 | Ga0373944_0326175_208_510 | 99 |
| 144 | 3300035111 | Ga0373923_0035743 | Ga0373923_0035743_922_1224 | 99 |
| 145 | 3300035112 | Ga0373932_0172963 | Ga0373932_0172963_109_411 | 99 |
| 146 | 3300035113 | Ga0373936_0032816 | Ga0373936_0032816_937_1239 | 99 |
| 147 | 3300035116 | Ga0373945_0013565 | Ga0373945_0013565_602_904 | 99 |
| 148 | 3300035117 | Ga0373953_0100293 | Ga0373953_0100293_121_423 | 99 |
| 149 | 3300035119 | Ga0373956_0238950 | Ga0373956_0238950_219_521 | 99 |
| 150 | 3300035170 | Ga0373943_0046899 | Ga0373943_0046899_568_870 | 99 |
| 151 | 3300035171 | Ga0373946_0033274 | Ga0373946_0033274_1554_1856 | 99 |
| 152 | 3300035410 | Ga0373924_0008447 | Ga0373924_0008447_235_537 | 99 |
| 153 | 3300035692 | Ga0373935_0203057 | Ga0373935_0203057_307_609 | 99 |
| 154 | 3300035695 | Ga0373927_0065995 | Ga0373927_0065995_1277_1579 | 99 |
| 155 | 3300035695 | Ga0373927_0223450 | Ga0373927_0223450_259_561 | 99 |
| 156 | 3300035724 | Ga0373933_0017863 | Ga0373933_0017863_388_690 | 99 |
| 157 | 3300035725 | Ga0373947_0306030 | Ga0373947_0306030_717_1019 | 99 |
| 158 | 3300036401 | Ga0373937_0247735 | Ga0373937_0247735_331_633 | 99 |
| 159 | 3300037068 | Ga0373925_0038145 | Ga0373925_0038145_16_318 | 99 |
| 160 | 3300038443 | Ga0395901_1624662 | Ga0395901_1624662_252_554 | 99 |
| 161 | 3300039437 | Ga0436365_1179309 | Ga0436365_1179309_10970_11272 | 99 |
| 162 | 3300039437 | Ga0436365_1464659 | Ga0436365_1464659_4083_4382 | 99 |
| 163 | 3300039438 | Ga0436360_0101891 | Ga0436360_0101891_86_388 | 99 |
| 164 | 3300039450 | Ga0436363_0317740 | Ga0436363_0317740_149_451 | 99 |
| 165 | 3300039450 | Ga0436363_0369350 | Ga0436363_0369350_1208_1510 | 99 |
| 166 | 3300039453 | Ga0436362_0906680 | Ga0436362_0906680_334_636 | 99 |
| 167 | 3300042010 | Ga0439452_134252 | Ga0439452_134252_154_456 | 99 |
| 168 | 3300044656 | Ga0466969_0327965 | Ga0466969_0327965_348_650 | 99 |
| 169 | 3300044684 | Ga0466966_0092093 | Ga0466966_0092093_331_633 | 99 |
| 170 | 3300044719 | Ga0466971_0576114 | Ga0466971_0576114_62_364 | 99 |
| 171 | 3300044842 | Ga0466957_0167264 | Ga0466957_0167264_130_432 | 99 |
| 172 | 3300045049 | Ga0466959_0505796 | Ga0466959_0505796_266_568 | 99 |
| 173 | 3300045836 | Ga0466958_0827955 | Ga0466958_0827955_175_477 | 99 |
| 174 | 3300046472 | Ga0495580_0050456 | Ga0495580_0050456_1049_1351 | 99 |
| 175 | 3300046473 | Ga0495582_0176610 | Ga0495582_0176610_188_490 | 99 |
| 176 | 3300046475 | Ga0495639_0035968 | Ga0495639_0035968_1832_2134 | 99 |
| 177 | 3300046477 | Ga0495664_0018920 | Ga0495664_0018920_3434_3736 | 99 |
| 178 | 3300046491 | Ga0495584_0367135 | Ga0495584_0367135_264_563 | 99 |
| 179 | 3300046499 | Ga0495594_0161393 | Ga0495594_0161393_955_1257 | 99 |
| 180 | 3300046511 | Ga0495608_0061189 | Ga0495608_0061189_590_892 | 99 |
| 181 | 3300046514 | Ga0495618_0084457 | Ga0495618_0084457_602_904 | 99 |
| 182 | 3300046516 | Ga0495628_0200212 | Ga0495628_0200212_915_1217 | 99 |
| 183 | 3300046517 | Ga0495630_0037810 | Ga0495630_0037810_3211_3513 | 99 |
| 184 | 3300046529 | Ga0495652_0546952 | Ga0495652_0546952_183_485 | 99 |
| 185 | 3300046531 | Ga0495665_0011536 | Ga0495665_0011536_1416_1718 | 99 |
| 186 | 3300046533 | Ga0495640_0083977 | Ga0495640_0083977_314_616 | 99 |
| 187 | 3300046543 | Ga0495645_0037032 | Ga0495645_0037032_2973_3275 | 99 |
| 188 | 3300046543 | Ga0495645_0077512 | Ga0495645_0077512_398_700 | 99 |
| 189 | 3300046559 | Ga0495667_0095524 | Ga0495667_0095524_1262_1564 | 99 |
| 190 | 3300046642 | Ga0495634_0079801 | Ga0495634_0079801_395_697 | 99 |
| 191 | 3300046663 | Ga0495635_0104447 | Ga0495635_0104447_390_692 | 99 |
| 192 | 3300046675 | Ga0495657_0531303 | Ga0495657_0531303_266_568 | 99 |
| 193 | 3300046678 | Ga0495599_0152734 | Ga0495599_0152734_995_1297 | 99 |
| 194 | 3300046680 | Ga0495646_0072431 | Ga0495646_0072431_1042_1344 | 99 |
| 195 | 3300046680 | Ga0495646_0195777 | Ga0495646_0195777_71_373 | 99 |
| 196 | 3300046681 | Ga0495647_0274929 | Ga0495647_0274929_356_658 | 99 |
| 197 | 3300046683 | Ga0495658_0077190 | Ga0495658_0077190_731_1033 | 99 |
| 198 | 3300046689 | Ga0495613_0117714 | Ga0495613_0117714_906_1208 | 99 |
| 199 | 3300046809 | Ga0495600_0656112 | Ga0495600_0656112_18_320 | 99 |
| 200 | 3300047315 | Ga0495581_0101965 | Ga0495581_0101965_1245_1547 | 99 |
| 201 | 3300047317 | Ga0495604_0251537 | Ga0495604_0251537_70_372 | 99 |
| 202 | 3300047319 | Ga0495674_0104935 | Ga0495674_0104935_1716_2018 | 99 |
| 203 | 3300047471 | Ga0495684_0040446 | Ga0495684_0040446_1203_1505 | 99 |
| 204 | 3300048913 | Ga0496110_0346771 | Ga0496110_0346771_75_377 | 99 |
| 205 | 3300048915 | Ga0496112_0133829 | Ga0496112_0133829_1335_1637 | 99 |
| 206 | 3300048918 | Ga0496115_0541844 | Ga0496115_0541844_58_360 | 99 |
| 207 | 3300048924 | Ga0496121_0298489 | Ga0496121_0298489_89_391 | 99 |
| 208 | 3300048929 | Ga0496126_0298742 | Ga0496126_0298742_418_720 | 99 |
| 209 | 3300048929 | Ga0496126_0381533 | Ga0496126_0381533_758_1060 | 99 |
| 210 | 3300049571 | Ga0501034_1294721 | Ga0501034_1294721_282_584 | 99 |
| 211 | 3300049573 | Ga0501037_0555632 | Ga0501037_0555632_69_371 | 99 |
| 212 | 3300049823 | Ga0501044_0807314 | Ga0501044_0807314_475_777 | 99 |
| 213 | 3300049823 | Ga0501044_1598888 | Ga0501044_1598888_56_355 | 99 |
| 214 | 3300050494 | nmdc:mga06z11_795404_c1 | nmdc:mga06z11_795404_c1_66_368 | 99 |
| 215 | 3300050496 | nmdc:mga07m45_277739_c1 | nmdc:mga07m45_277739_c1_597_899 | 99 |
| 216 | 3300050507 | nmdc:mga05p37_324796_c1 | nmdc:mga05p37_324796_c1_1391_1693 | 99 |
| 217 | 3300050508 | nmdc:mga09592_1300499_c1 | nmdc:mga09592_1300499_c1_22_324 | 99 |
| 218 | 3300050509 | nmdc:mga0qj67_123536_c1 | nmdc:mga0qj67_123536_c1_132_434 | 99 |
| 219 | 3300050510 | nmdc:mga06r32_506524_c1 | nmdc:mga06r32_506524_c1_104_406 | 99 |
| 220 | 3300050511 | nmdc:mga08y16_315789_c1 | nmdc:mga08y16_315789_c1_1153_1455 | 99 |
| 221 | 3300053077 | Ga0495601_0070719 | Ga0495601_0070719_1587_1889 | 99 |
| 222 | 3300053078 | Ga0495612_0015491 | Ga0495612_0015491_1714_2016 | 99 |
| 223 | 3300053091 | Ga0500647_0073817 | Ga0500647_0073817_568_870 | 99 |
| 224 | 3300053136 | Ga0500559_0028509 | Ga0500559_0028509_352_654 | 99 |
| 225 | 3300005616 | Ga0068852_100161119 | Ga0068852_1001611193 | 100 |
| 226 | 3300009174 | Ga0105241_12116479 | Ga0105241_121164792 | 100 |
| 227 | 3300009551 | Ga0105238_10139155 | Ga0105238_101391553 | 100 |
| 228 | 3300010375 | Ga0105239_10676795 | Ga0105239_106767952 | 100 |
| 229 | 3300013105 | Ga0157369_11135006 | Ga0157369_111350061 | 100 |
| 230 | 3300013307 | Ga0157372_10453760 | Ga0157372_104537602 | 100 |
| 231 | 3300025981 | Ga0207640_10336706 | Ga0207640_103367063 | 100 |
| 232 | 3300031995 | Ga0307409_101973033 | Ga0307409_1019730331 | 100 |
| 233 | 3300037418 | Ga0395900_1675322 | Ga0395900_1675322_205_516 | 102 |
| 234 | 3300039438 | Ga0436360_1267572 | Ga0436360_1267572_975_1286 | 102 |
| 235 | 3300025711 | Ga0207696_1093141 | Ga0207696_10931412 | 104 |
| 236 | 3300001977 | JGI24746J21847_1018511 | JGI24746J21847_10185112 | 105 |
| 237 | 3300001978 | JGI24747J21853_1004903 | JGI24747J21853_10049033 | 105 |
| 238 | 3300001990 | JGI24737J22298_10020553 | JGI24737J22298_100205533 | 105 |
| 239 | 3300002239 | JGI24034J26672_10004583 | JGI24034J26672_100045832 | 105 |
| 240 | 3300002459 | JGI24751J29686_10065635 | JGI24751J29686_100656351 | 105 |
| 241 | 3300003659 | JGI25404J52841_10015544 | JGI25404J52841_100155443 | 105 |
| 242 | 3300005290 | Ga0065712_10074749 | Ga0065712_100747494 | 105 |
| 243 | 3300005293 | Ga0065715_10162834 | Ga0065715_101628343 | 105 |
| 244 | 3300005327 | Ga0070658_10000704 | Ga0070658_100007045 | 105 |
| 245 | 3300005328 | Ga0070676_10003529 | Ga0070676_100035296 | 105 |
| 246 | 3300005329 | Ga0070683_100006034 | Ga0070683_10000603416 | 105 |
| 247 | 3300005329 | Ga0070683_100130407 | Ga0070683_1001304074 | 105 |
| 248 | 3300005330 | Ga0070690_100000145 | Ga0070690_1000001455 | 105 |
| 249 | 3300005331 | Ga0070670_100002642 | Ga0070670_10000264213 | 105 |
| 250 | 3300005333 | Ga0070677_10000538 | Ga0070677_100005382 | 105 |
| 251 | 3300005334 | Ga0068869_100001295 | Ga0068869_10000129513 | 105 |
| 252 | 3300005335 | Ga0070666_10000345 | Ga0070666_1000034513 | 105 |
| 253 | 3300005336 | Ga0070680_100023230 | Ga0070680_1000232305 | 105 |
| 254 | 3300005337 | Ga0070682_100093640 | Ga0070682_1000936404 | 105 |
| 255 | 3300005338 | Ga0068868_100002286 | Ga0068868_1000022864 | 105 |
| 256 | 3300005339 | Ga0070660_100000203 | Ga0070660_10000020341 | 105 |
| 257 | 3300005340 | Ga0070689_100000159 | Ga0070689_1000001596 | 105 |
| 258 | 3300005341 | Ga0070691_10009473 | Ga0070691_100094732 | 105 |
| 259 | 3300005343 | Ga0070687_100000002 | Ga0070687_10000000266 | 105 |
| 260 | 3300005344 | Ga0070661_100000134 | Ga0070661_10000013466 | 105 |
| 261 | 3300005344 | Ga0070661_100064009 | Ga0070661_1000640094 | 105 |
| 262 | 3300005345 | Ga0070692_10000209 | Ga0070692_100002095 | 105 |
| 263 | 3300005347 | Ga0070668_100000039 | Ga0070668_1000000396 | 105 |
| 264 | 3300005353 | Ga0070669_100001041 | Ga0070669_10000104115 | 105 |
| 265 | 3300005354 | Ga0070675_100005323 | Ga0070675_1000053237 | 105 |
| 266 | 3300005355 | Ga0070671_100002347 | Ga0070671_1000023475 | 105 |
| 267 | 3300005356 | Ga0070674_100000118 | Ga0070674_1000001183 | 105 |
| 268 | 3300005364 | Ga0070673_100001495 | Ga0070673_10000149513 | 105 |
| 269 | 3300005365 | Ga0070688_100000742 | Ga0070688_1000007425 | 105 |
| 270 | 3300005366 | Ga0070659_100000298 | Ga0070659_10000029840 | 105 |
| 271 | 3300005367 | Ga0070667_100003858 | Ga0070667_1000038585 | 105 |
| 272 | 3300005406 | Ga0070703_10015301 | Ga0070703_100153013 | 105 |
| 273 | 3300005438 | Ga0070701_10000337 | Ga0070701_100003374 | 105 |
| 274 | 3300005440 | Ga0070705_100000291 | Ga0070705_10000029110 | 105 |
| 275 | 3300005441 | Ga0070700_100008281 | Ga0070700_1000082814 | 105 |
| 276 | 3300005455 | Ga0070663_100000088 | Ga0070663_1000000885 | 105 |
| 277 | 3300005456 | Ga0070678_100001508 | Ga0070678_10000150813 | 105 |
| 278 | 3300005456 | Ga0070678_100229070 | Ga0070678_1002290701 | 105 |
| 279 | 3300005457 | Ga0070662_100001414 | Ga0070662_1000014146 | 105 |
| 280 | 3300005459 | Ga0068867_100000195 | Ga0068867_10000019541 | 105 |
| 281 | 3300005466 | Ga0070685_10001050 | Ga0070685_100010506 | 105 |
| 282 | 3300005530 | Ga0070679_100053170 | Ga0070679_1000531703 | 105 |
| 283 | 3300005535 | Ga0070684_100105722 | Ga0070684_1001057223 | 105 |
| 284 | 3300005535 | Ga0070684_100208900 | Ga0070684_1002089003 | 105 |
| 285 | 3300005539 | Ga0068853_100000492 | Ga0068853_10000049216 | 105 |
| 286 | 3300005543 | Ga0070672_100000278 | Ga0070672_10000027813 | 105 |
| 287 | 3300005544 | Ga0070686_100007539 | Ga0070686_1000075394 | 105 |
| 288 | 3300005545 | Ga0070695_100345592 | Ga0070695_1003455922 | 105 |
| 289 | 3300005546 | Ga0070696_100103204 | Ga0070696_1001032042 | 105 |
| 290 | 3300005547 | Ga0070693_100052386 | Ga0070693_1000523862 | 105 |
| 291 | 3300005548 | Ga0070665_100041293 | Ga0070665_1000412932 | 105 |
| 292 | 3300005549 | Ga0070704_100033026 | Ga0070704_1000330264 | 105 |
| 293 | 3300005563 | Ga0068855_100000383 | Ga0068855_10000038323 | 105 |
| 294 | 3300005564 | Ga0070664_100000502 | Ga0070664_10000050229 | 105 |
| 295 | 3300005577 | Ga0068857_100001343 | Ga0068857_1000013436 | 105 |
| 296 | 3300005577 | Ga0068857_100002329 | Ga0068857_1000023294 | 105 |
| 297 | 3300005578 | Ga0068854_100000362 | Ga0068854_10000036213 | 105 |
| 298 | 3300005614 | Ga0068856_100003066 | Ga0068856_1000030667 | 105 |
| 299 | 3300005615 | Ga0070702_100010791 | Ga0070702_1000107913 | 105 |
| 300 | 3300005616 | Ga0068852_100000211 | Ga0068852_10000021140 | 105 |
| 301 | 3300005617 | Ga0068859_100001182 | Ga0068859_10000118226 | 105 |
| 302 | 3300005618 | Ga0068864_100000579 | Ga0068864_1000005795 | 105 |
| 303 | 3300005718 | Ga0068866_10001747 | Ga0068866_100017476 | 105 |
| 304 | 3300005719 | Ga0068861_100000362 | Ga0068861_1000003625 | 105 |
| 305 | 3300005834 | Ga0068851_10000295 | Ga0068851_100002956 | 105 |
| 306 | 3300005840 | Ga0068870_10000016 | Ga0068870_1000001618 | 105 |
| 307 | 3300005841 | Ga0068863_100000473 | Ga0068863_10000047327 | 105 |
| 308 | 3300005842 | Ga0068858_100003861 | Ga0068858_10000386113 | 105 |
| 309 | 3300005843 | Ga0068860_100003643 | Ga0068860_10000364313 | 105 |
| 310 | 3300005844 | Ga0068862_100002205 | Ga0068862_1000022055 | 105 |
| 311 | 3300005844 | Ga0068862_100646390 | Ga0068862_1006463902 | 105 |
| 312 | 3300005983 | Ga0081540_1000033 | Ga0081540_100003380 | 105 |
| 313 | 3300005983 | Ga0081540_1000160 | Ga0081540_100016039 | 105 |
| 314 | 3300005983 | Ga0081540_1001958 | Ga0081540_100195815 | 105 |
| 315 | 3300006163 | Ga0070715_10593543 | Ga0070715_105935432 | 105 |
| 316 | 3300006237 | Ga0097621_100001946 | Ga0097621_1000019467 | 105 |
| 317 | 3300006237 | Ga0097621_100025809 | Ga0097621_1000258093 | 105 |
| 318 | 3300006358 | Ga0068871_100001691 | Ga0068871_1000016916 | 105 |
| 319 | 3300006871 | Ga0075434_101146567 | Ga0075434_1011465672 | 105 |
| 320 | 3300006871 | Ga0075434_101576963 | Ga0075434_1015769632 | 105 |
| 321 | 3300006881 | Ga0068865_100000163 | Ga0068865_1000001635 | 105 |
| 322 | 3300006931 | Ga0097620_100001182 | Ga0097620_1000011826 | 105 |
| 323 | 3300006931 | Ga0097620_103056249 | Ga0097620_1030562491 | 105 |
| 324 | 3300009011 | Ga0105251_10217594 | Ga0105251_102175942 | 105 |
| 325 | 3300009092 | Ga0105250_10068448 | Ga0105250_100684481 | 105 |
| 326 | 3300009093 | Ga0105240_10024022 | Ga0105240_100240227 | 105 |
| 327 | 3300009094 | Ga0111539_10552752 | Ga0111539_105527521 | 105 |
| 328 | 3300009098 | Ga0105245_10000381 | Ga0105245_100003815 | 105 |
| 329 | 3300009101 | Ga0105247_10006611 | Ga0105247_100066118 | 105 |
| 330 | 3300009148 | Ga0105243_10000709 | Ga0105243_1000070933 | 105 |
| 331 | 3300009174 | Ga0105241_10007485 | Ga0105241_100074855 | 105 |
| 332 | 3300009174 | Ga0105241_10243818 | Ga0105241_102438183 | 105 |
| 333 | 3300009176 | Ga0105242_10001191 | Ga0105242_1000119112 | 105 |
| 334 | 3300009177 | Ga0105248_10006117 | Ga0105248_1000611711 | 105 |
| 335 | 3300009545 | Ga0105237_10000031 | Ga0105237_1000003180 | 105 |
| 336 | 3300009551 | Ga0105238_10001175 | Ga0105238_1000117526 | 105 |
| 337 | 3300009553 | Ga0105249_10001717 | Ga0105249_100017178 | 105 |
| 338 | 3300010375 | Ga0105239_10000220 | Ga0105239_1000022083 | 105 |
| 339 | 3300011119 | Ga0105246_10000977 | Ga0105246_1000097716 | 105 |
| 340 | 3300013100 | Ga0157373_10010125 | Ga0157373_100101258 | 105 |
| 341 | 3300013102 | Ga0157371_10000246 | Ga0157371_1000024680 | 105 |
| 342 | 3300013105 | Ga0157369_10000669 | Ga0157369_1000066912 | 105 |
| 343 | 3300013296 | Ga0157374_10000295 | Ga0157374_100002955 | 105 |
| 344 | 3300013297 | Ga0157378_10002394 | Ga0157378_100023945 | 105 |
| 345 | 3300013306 | Ga0163162_10000200 | Ga0163162_1000020012 | 105 |
| 346 | 3300013307 | Ga0157372_10002464 | Ga0157372_1000246418 | 105 |
| 347 | 3300013308 | Ga0157375_10002554 | Ga0157375_1000255416 | 105 |
| 348 | 3300014325 | Ga0163163_10052410 | Ga0163163_100524103 | 105 |
| 349 | 3300014326 | Ga0157380_10311327 | Ga0157380_103113272 | 105 |
| 350 | 3300014497 | Ga0182008_10434213 | Ga0182008_104342131 | 105 |
| 351 | 3300014745 | Ga0157377_10000434 | Ga0157377_1000043418 | 105 |
| 352 | 3300014968 | Ga0157379_10002267 | Ga0157379_100022674 | 105 |
| 353 | 3300014969 | Ga0157376_10001200 | Ga0157376_1000120017 | 105 |
| 354 | 3300014969 | Ga0157376_10021399 | Ga0157376_100213994 | 105 |
| 355 | 3300015262 | Ga0182007_10004082 | Ga0182007_100040825 | 105 |
| 356 | 3300017792 | Ga0163161_10033504 | Ga0163161_100335042 | 105 |
| 357 | 3300025315 | Ga0207697_10000838 | Ga0207697_100008385 | 105 |
| 358 | 3300025321 | Ga0207656_10000926 | Ga0207656_100009268 | 105 |
| 359 | 3300025885 | Ga0207653_10049532 | Ga0207653_100495323 | 105 |
| 360 | 3300025893 | Ga0207682_10000341 | Ga0207682_1000034124 | 105 |
| 361 | 3300025899 | Ga0207642_10001097 | Ga0207642_100010975 | 105 |
| 362 | 3300025900 | Ga0207710_10002696 | Ga0207710_100026964 | 105 |
| 363 | 3300025901 | Ga0207688_10000180 | Ga0207688_100001804 | 105 |
| 364 | 3300025903 | Ga0207680_10000409 | Ga0207680_1000040916 | 105 |
| 365 | 3300025904 | Ga0207647_10002034 | Ga0207647_1000203414 | 105 |
| 366 | 3300025907 | Ga0207645_10002089 | Ga0207645_100020894 | 105 |
| 367 | 3300025908 | Ga0207643_10000005 | Ga0207643_10000005109 | 105 |
| 368 | 3300025909 | Ga0207705_10001360 | Ga0207705_1000136018 | 105 |
| 369 | 3300025911 | Ga0207654_10010169 | Ga0207654_100101694 | 105 |
| 370 | 3300025911 | Ga0207654_10184995 | Ga0207654_101849953 | 105 |
| 371 | 3300025913 | Ga0207695_10026891 | Ga0207695_100268915 | 105 |
| 372 | 3300025914 | Ga0207671_10000265 | Ga0207671_1000026514 | 105 |
| 373 | 3300025917 | Ga0207660_10015490 | Ga0207660_100154904 | 105 |
| 374 | 3300025918 | Ga0207662_10000323 | Ga0207662_1000032313 | 105 |
| 375 | 3300025919 | Ga0207657_10000029 | Ga0207657_100000294 | 105 |
| 376 | 3300025920 | Ga0207649_10001081 | Ga0207649_1000108116 | 105 |
| 377 | 3300025920 | Ga0207649_10065047 | Ga0207649_100650471 | 105 |
| 378 | 3300025923 | Ga0207681_10000063 | Ga0207681_1000006339 | 105 |
| 379 | 3300025924 | Ga0207694_10002389 | Ga0207694_100023893 | 105 |
| 380 | 3300025925 | Ga0207650_10000232 | Ga0207650_1000023265 | 105 |
| 381 | 3300025926 | Ga0207659_10000261 | Ga0207659_1000026116 | 105 |
| 382 | 3300025927 | Ga0207687_10012169 | Ga0207687_100121694 | 105 |
| 383 | 3300025931 | Ga0207644_10001200 | Ga0207644_1000120016 | 105 |
| 384 | 3300025932 | Ga0207690_10001154 | Ga0207690_100011545 | 105 |
| 385 | 3300025933 | Ga0207706_10000231 | Ga0207706_1000023164 | 105 |
| 386 | 3300025934 | Ga0207686_10000955 | Ga0207686_100009555 | 105 |
| 387 | 3300025935 | Ga0207709_10018159 | Ga0207709_100181594 | 105 |
| 388 | 3300025936 | Ga0207670_10000132 | Ga0207670_1000013240 | 105 |
| 389 | 3300025937 | Ga0207669_10000306 | Ga0207669_1000030610 | 105 |
| 390 | 3300025938 | Ga0207704_10000304 | Ga0207704_1000030414 | 105 |
| 391 | 3300025940 | Ga0207691_10000068 | Ga0207691_1000006880 | 105 |
| 392 | 3300025941 | Ga0207711_10000068 | Ga0207711_1000006872 | 105 |
| 393 | 3300025942 | Ga0207689_10000375 | Ga0207689_100003758 | 105 |
| 394 | 3300025944 | Ga0207661_10000871 | Ga0207661_1000087111 | 105 |
| 395 | 3300025944 | Ga0207661_10881788 | Ga0207661_108817881 | 105 |
| 396 | 3300025945 | Ga0207679_10000346 | Ga0207679_1000034635 | 105 |
| 397 | 3300025945 | Ga0207679_10000937 | Ga0207679_100009376 | 105 |
| 398 | 3300025945 | Ga0207679_11147687 | Ga0207679_111476871 | 105 |
| 399 | 3300025949 | Ga0207667_10001908 | Ga0207667_1000190826 | 105 |
| 400 | 3300025960 | Ga0207651_10000480 | Ga0207651_1000048016 | 105 |
| 401 | 3300025961 | Ga0207712_10000187 | Ga0207712_100001878 | 105 |
| 402 | 3300025972 | Ga0207668_10000710 | Ga0207668_1000071016 | 105 |
| 403 | 3300025981 | Ga0207640_10000399 | Ga0207640_1000039927 | 105 |
| 404 | 3300025986 | Ga0207658_10000246 | Ga0207658_100002465 | 105 |
| 405 | 3300026023 | Ga0207677_10000018 | Ga0207677_1000001880 | 105 |
| 406 | 3300026035 | Ga0207703_10002135 | Ga0207703_1000213516 | 105 |
| 407 | 3300026041 | Ga0207639_10001572 | Ga0207639_100015725 | 105 |
| 408 | 3300026067 | Ga0207678_10000349 | Ga0207678_100003495 | 105 |
| 409 | 3300026075 | Ga0207708_10002216 | Ga0207708_100022165 | 105 |
| 410 | 3300026078 | Ga0207702_10001606 | Ga0207702_1000160614 | 105 |
| 411 | 3300026088 | Ga0207641_10001499 | Ga0207641_1000149916 | 105 |
| 412 | 3300026089 | Ga0207648_10003596 | Ga0207648_100035964 | 105 |
| 413 | 3300026095 | Ga0207676_10000289 | Ga0207676_1000028921 | 105 |
| 414 | 3300026116 | Ga0207674_10004634 | Ga0207674_100046345 | 105 |
| 415 | 3300026116 | Ga0207674_10005187 | Ga0207674_100051874 | 105 |
| 416 | 3300026118 | Ga0207675_100000002 | Ga0207675_100000002103 | 105 |
| 417 | 3300026121 | Ga0207683_10000070 | Ga0207683_100000705 | 105 |
| 418 | 3300026121 | Ga0207683_10442911 | Ga0207683_104429111 | 105 |
| 419 | 3300026142 | Ga0207698_10000699 | Ga0207698_1000069921 | 105 |
| 420 | 3300028379 | Ga0268266_10000139 | Ga0268266_10000139123 | 105 |
| 421 | 3300028380 | Ga0268265_10000148 | Ga0268265_1000014838 | 105 |
| 422 | 3300028381 | Ga0268264_10000312 | Ga0268264_100003124 | 105 |
| 423 | 3300034819 | Ga0373958_0218448 | Ga0373958_0218448_59_388 | 105 |
| 424 | 3300035085 | Ga0373929_0184110 | Ga0373929_0184110_35_364 | 105 |
| 425 | 3300035090 | Ga0373949_0098557 | Ga0373949_0098557_99_428 | 105 |
| 426 | 3300035114 | Ga0373939_0473649 | Ga0373939_0473649_49_402 | 105 |
| 427 | 3300035115 | Ga0373941_0293948 | Ga0373941_0293948_220_537 | 105 |
| 428 | 3300035121 | Ga0373960_0459257 | Ga0373960_0459257_113_442 | 105 |
| 429 | 3300035691 | Ga0373931_0099972 | Ga0373931_0099972_125_454 | 105 |
| 430 | 3300035695 | Ga0373927_0446015 | Ga0373927_0446015_46_396 | 105 |
| 431 | 3300036401 | Ga0373937_2080632 | Ga0373937_2080632_23_373 | 105 |
| 432 | 3300039450 | Ga0436363_0570044 | Ga0436363_0570044_2295_2624 | 105 |
| 433 | 3300042012 | Ga0439455_0004201 | Ga0439455_0004201_1715_2053 | 105 |
| 434 | 3300042157 | Ga0439458_0058555 | Ga0439458_0058555_200_538 | 105 |
| 435 | 3300042439 | Ga0439464_0080890 | Ga0439464_0080890_209_547 | 105 |
| 436 | 3300042876 | Ga0451577_0065363 | Ga0451577_0065363_2249_2596 | 105 |
| 437 | 3300044712 | Ga0453684_0461524 | Ga0453684_0461524_631_978 | 105 |
| 438 | 3300045051 | Ga0451576_0905492 | Ga0451576_0905492_294_641 | 105 |
| 439 | 3300047315 | Ga0495581_0356539 | Ga0495581_0356539_423_773 | 105 |
| 440 | 3300048903 | Ga0496100_0217582 | Ga0496100_0217582_339_656 | 105 |
| 441 | 3300048905 | Ga0496102_0001246 | Ga0496102_0001246_9076_9393 | 105 |
| 442 | 3300048906 | Ga0496103_0434459 | Ga0496103_0434459_339_656 | 105 |
| 443 | 3300048909 | Ga0496106_0003910 | Ga0496106_0003910_9680_9997 | 105 |
| 444 | 3300048910 | Ga0496107_0015186 | Ga0496107_0015186_1904_2221 | 105 |
| 445 | 3300048912 | Ga0496109_0002793 | Ga0496109_0002793_7337_7654 | 105 |
| 446 | 3300048913 | Ga0496110_0113159 | Ga0496110_0113159_1700_2017 | 105 |
| 447 | 3300048915 | Ga0496112_0001943 | Ga0496112_0001943_3274_3591 | 105 |
| 448 | 3300048916 | Ga0496113_0004846 | Ga0496113_0004846_4768_5085 | 105 |
| 449 | 3300048917 | Ga0496114_0900391 | Ga0496114_0900391_132_449 | 105 |
| 450 | 3300048918 | Ga0496115_0817680 | Ga0496115_0817680_292_609 | 105 |
| 451 | 3300049593 | Ga0501077_0191362 | Ga0501077_0191362_737_1078 | 105 |
| 452 | 3300049741 | Ga0501079_0659806 | Ga0501079_0659806_263_604 | 105 |
| 453 | 3300049743 | Ga0501081_0654848 | Ga0501081_0654848_213_554 | 105 |
| 454 | 3300050512 | nmdc:mga0n895_541355_c1 | nmdc:mga0n895_541355_c1_729_1076 | 105 |
| 455 | 3300050512 | nmdc:mga0n895_626512_c1 | nmdc:mga0n895_626512_c1_576_896 | 105 |
| 456 | 3300060353 | Ga0501082_0684667 | Ga0501082_0684667_392_733 | 105 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6gho-assembly1.cif.gz_B | crystal structure of spx in complex with yjbh | 0.9368 | 48 | 92 |
| 6ghb-assembly2.cif.gz_D | crystal structure of spx in complex with yjbh (oxidized) | 0.932 | 48 | 91 |
| 6ghb-assembly1.cif.gz_B | crystal structure of spx in complex with yjbh (oxidized) | 0.9296 | 48 | 92 |
| 7p6f-assembly1.cif.gz_BBB | 1.93 a resolution x-ray crystal structure of the transcriptional regulator srnr from streptomyces griseus | 0.9228 | 4 | 104 |
| 5zuo-assembly1.cif.gz_A | crystal structure of bz junction in diverse sequence | 0.907 | 50 | 91 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DZU8_467_618_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9546 | 48 | 90 | 3.30.230.130 |
| af_I6Y1A7_25_116_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9173 | 8 | 102 | 1.10.10.10 |
| 4hx4A01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9082 | 50 | 78 | 1.10.10.10 |
| 5zuoA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.907 | 50 | 91 | 1.10.10.10 |
| af_A0A1D6GVA1_621_768_3.30.230.130 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 | 0.9038 | 49 | 92 | 3.30.230.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534P4A4-F1-model_v4 | Helix-turn-helix transcriptional regulator | 0.9986 | 23 | 104 |
GO:0003700
|
| AF-A0A3N0E5U6-F1-model_v4 | ArsR family transcriptional regulator | 0.9982 | 10 | 104 |
GO:0003700
|
| AF-A0A4P6JIX9-F1-model_v4 | ArsR family transcriptional regulator | 0.9965 | 11 | 104 |
GO:0003700
|
| AF-A0A5Q0GU78-F1-model_v4 | ArsR family transcriptional regulator | 0.9954 | 11 | 102 |
GO:0003700
|
| AF-A0A1V3S061-F1-model_v4 | Transcriptional regulator | 0.9931 | 6 | 104 |
GO:0003700
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar