F447719

General Info

Members Datasets Scaffolds Average Seq Length
456 257 912 135

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100901224|Ga0070694_1009012242
Length 134
Sequence MYAVAVSDHIMIAHSFTGAIFGPAQQLHGATYGVEVEFRRAELDGDGLVCDIGLALKTLREVLSELNFKNLDELAELRGKNTTTEFMAGEIFRRMKARVAAGAIGPGTADALASMRVALRESPVAWASFEGPLR

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
167 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
168 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
173 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
174 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
175 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
178 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
193 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
198 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
199 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
200 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
205 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.97
Rhizosphere 97.37
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100901224 3300005444 Bacteria 730
2 JGI25406J46586_10000128 3300003203 Bacteria 32971
3 JGI25406J46586_10017731 3300003203 Bacteria 2938
4 Ga0007409J51694_1033621 3300003575 Bacteria 602
5 Ga0006780_1017810 3300003735 Bacteria 666
6 Ga0065715_10470366 3300005293 Bacteria 804
7 Ga0065707_10810089 3300005295 Bacteria 596
8 Ga0070658_10261412 3300005327 Bacteria 1470
9 Ga0070676_10059346 3300005328 Bacteria 2269
10 Ga0070676_10192273 3300005328 Bacteria 1333
11 Ga0070683_100125727 3300005329 Bacteria 2424
12 Ga0070690_100220172 3300005330 Bacteria 1330
13 Ga0070690_100314070 3300005330 Bacteria 1127
14 Ga0070690_100732942 3300005330 Bacteria 762
15 Ga0070677_10069518 3300005333 Bacteria 1477
16 Ga0070677_10319520 3300005333 Bacteria 795
17 Ga0070677_10326714 3300005333 Bacteria 787
18 Ga0068869_100144993 3300005334 Bacteria 1837
19 Ga0070666_10007103 3300005335 Bacteria 6905
20 Ga0070666_11257418 3300005335 Bacteria 552
21 Ga0070680_100064479 3300005336 Bacteria 3002
22 Ga0068868_100050092 3300005338 Bacteria 3279
23 Ga0070660_100599142 3300005339 Bacteria 921
24 Ga0070689_100390721 3300005340 Unclassified 1174
25 Ga0070691_10022831 3300005341 Bacteria 2904
26 Ga0070687_100038841 3300005343 Bacteria 2388
27 Ga0070687_100240955 3300005343 Bacteria 1118
28 Ga0070661_100201416 3300005344 Bacteria 1521
29 Ga0070692_10081752 3300005345 Bacteria 1741
30 Ga0070668_100151396 3300005347 Bacteria 1876
31 Ga0070669_100081459 3300005353 Bacteria 2411
32 Ga0070669_100892139 3300005353 Bacteria 759
33 Ga0070675_100000378 3300005354 Bacteria 30141
34 Ga0070675_100029508 3300005354 Bacteria 4425
35 Ga0070675_100390551 3300005354 Bacteria 1240
36 Ga0070675_100707346 3300005354 Bacteria 918
37 Ga0070671_100224474 3300005355 Bacteria 1594
38 Ga0070671_100329619 3300005355 Bacteria 1301
39 Ga0070671_101108644 3300005355 Bacteria 695
40 Ga0070674_100008461 3300005356 Bacteria 6125
41 Ga0070674_100124271 3300005356 Bacteria 1914
42 Ga0070674_100260208 3300005356 Bacteria 1367
43 Ga0070673_100100988 3300005364 Bacteria 2376
44 Ga0070673_100202685 3300005364 Bacteria 1709
45 Ga0070673_100549455 3300005364 Bacteria 1049
46 Ga0070673_100576090 3300005364 Bacteria 1025
47 Ga0070673_101057387 3300005364 Bacteria 757
48 Ga0070688_101006942 3300005365 Bacteria 662
49 Ga0070667_101891444 3300005367 Bacteria 562
50 Ga0070703_10181188 3300005406 Bacteria 814
51 Ga0070709_10011143 3300005434 Bacteria 5000
52 Ga0070713_100051072 3300005436 Bacteria 3419
53 Ga0070701_10041763 3300005438 Bacteria 2338
54 Ga0070701_10187734 3300005438 Bacteria 1214
55 Ga0070711_100328008 3300005439 Bacteria 1225
56 Ga0070705_100988279 3300005440 Bacteria 682
57 Ga0070705_100999433 3300005440 Bacteria 679
58 Ga0070705_101406159 3300005440 Unclassified 582
59 Ga0070700_100018745 3300005441 Bacteria 3982
60 Ga0070700_100142300 3300005441 Bacteria 1632
61 Ga0070694_100139062 3300005444 Bacteria 1762
62 Ga0070708_100913786 3300005445 Bacteria 824
63 Ga0070708_101145324 3300005445 Bacteria 728
64 Ga0070678_101011808 3300005456 Bacteria 764
65 Ga0070662_100833801 3300005457 Bacteria 785
66 Ga0070681_10101420 3300005458 Unclassified 2824
67 Ga0070681_10318710 3300005458 Bacteria 1464
68 Ga0068867_100741676 3300005459 Bacteria 870
69 Ga0068867_100782782 3300005459 Bacteria 849
70 Ga0070685_10860986 3300005466 Bacteria 672
71 Ga0070685_11453659 3300005466 Bacteria 527
72 Ga0070706_100340059 3300005467 Bacteria 1399
73 Ga0070706_100851483 3300005467 Bacteria 843
74 Ga0070706_101066272 3300005467 Bacteria 744
75 Ga0070698_100261143 3300005471 Bacteria 1664
76 Ga0070698_100521325 3300005471 Bacteria 1127
77 Ga0070698_101864827 3300005471 Bacteria 554
78 Ga0070699_100000486 3300005518 Bacteria 37793
79 Ga0070699_100366250 3300005518 Bacteria 1300
80 Ga0070699_101595777 3300005518 Bacteria 598
81 Ga0070679_100063056 3300005530 Unclassified 3695
82 Ga0070684_100052588 3300005535 Bacteria 3543
83 Ga0070697_100047202 3300005536 Bacteria 3492
84 Ga0070697_100396538 3300005536 Bacteria 1197
85 Ga0070672_100137609 3300005543 Bacteria 2012
86 Ga0070672_100213098 3300005543 Bacteria 1618
87 Ga0070672_100260048 3300005543 Bacteria 1464
88 Ga0070672_100786081 3300005543 Bacteria 837
89 Ga0070672_101078791 3300005543 Unclassified 713
90 Ga0070686_100000267 3300005544 Bacteria 35636
91 Ga0070686_100762550 3300005544 Bacteria 777
92 Ga0070695_100003938 3300005545 Bacteria 8671
93 Ga0070695_100017866 3300005545 Bacteria 4303
94 Ga0070696_100034638 3300005546 Bacteria 3474
95 Ga0070696_100089166 3300005546 Bacteria 2193
96 Ga0070665_100005801 3300005548 Bacteria 12666
97 Ga0070665_100022657 3300005548 Bacteria 6324
98 Ga0070665_100072830 3300005548 Bacteria 3443
99 Ga0070665_101187405 3300005548 Bacteria 774
100 Ga0070665_101544179 3300005548 Bacteria 672
101 Ga0070704_100003575 3300005549 Bacteria 8936
102 Ga0070704_100058647 3300005549 Bacteria 2743
103 Ga0070704_100387518 3300005549 Bacteria 1189
104 Ga0068855_100184407 3300005563 Bacteria 2358
105 Ga0070664_100149928 3300005564 Bacteria 2058
106 Ga0068857_100904863 3300005577 Bacteria 846
107 Ga0068854_100006839 3300005578 Bacteria 7269
108 Ga0068856_100203343 3300005614 Bacteria 1995
109 Ga0070702_100002386 3300005615 Bacteria 8085
110 Ga0068852_100816443 3300005616 Bacteria 947
111 Ga0068859_100319284 3300005617 Bacteria 1647
112 Ga0068859_100440480 3300005617 Bacteria 1399
113 Ga0068864_100892977 3300005618 Bacteria 877
114 Ga0068866_10337663 3300005718 Bacteria 953
115 Ga0068866_10494617 3300005718 Bacteria 808
116 Ga0068861_100004179 3300005719 Bacteria 9678
117 Ga0068861_100040045 3300005719 Bacteria 3502
118 Ga0068861_100264989 3300005719 Bacteria 1473
119 Ga0068861_102413897 3300005719 Bacteria 529
120 Ga0068870_10706232 3300005840 Bacteria 696
121 Ga0068863_101317234 3300005841 Bacteria 729
122 Ga0068858_100378318 3300005842 Bacteria 1358
123 Ga0068858_100475910 3300005842 Bacteria 1205
124 Ga0068860_100180253 3300005843 Bacteria 2042
125 Ga0068862_100022454 3300005844 Bacteria 5279
126 Ga0068862_100681613 3300005844 Bacteria 994
127 Ga0081455_10902345 3300005937 Bacteria 550
128 Ga0081539_10000024 3300005985 Bacteria 354702
129 Ga0081539_10000096 3300005985 Bacteria 204059
130 Ga0081539_10008066 3300005985 Bacteria 9324
131 Ga0097621_100003330 3300006237 Bacteria 11056
132 Ga0097621_100078200 3300006237 Bacteria 2748
133 Ga0068871_100088101 3300006358 Bacteria 2582
134 Ga0068871_100732885 3300006358 Bacteria 907
135 Ga0075428_100134199 3300006844 Bacteria 2692
136 Ga0075428_100364129 3300006844 Bacteria 1551
137 Ga0075430_100014349 3300006846 Bacteria 6752
138 Ga0075433_10174966 3300006852 Bacteria 1910
139 Ga0075433_10567114 3300006852 Bacteria 997
140 Ga0075434_100080766 3300006871 Bacteria 3249
141 Ga0075434_100183975 3300006871 Bacteria 2110
142 Ga0075434_100222815 3300006871 Bacteria 1906
143 Ga0075434_101280827 3300006871 Bacteria 744
144 Ga0075429_100089489 3300006880 Bacteria 2683
145 Ga0068865_100040987 3300006881 Bacteria 3149
146 Ga0068865_100324090 3300006881 Bacteria 1240
147 Ga0068865_100675195 3300006881 Bacteria 880
148 Ga0075436_100023850 3300006914 Bacteria 4204
149 Ga0075436_100031104 3300006914 Bacteria 3674
150 Ga0075436_100583077 3300006914 Bacteria 823
151 Ga0097620_100319291 3300006931 Bacteria 1647
152 Ga0097620_100440482 3300006931 Bacteria 1399
153 Ga0075435_100001595 3300007076 Bacteria 14632
154 Ga0075435_100197629 3300007076 Unclassified 1703
155 Ga0099794_10257537 3300007265 Bacteria 900
156 Ga0105240_10048845 3300009093 Bacteria 5346
157 Ga0105240_10169695 3300009093 Bacteria 2585
158 Ga0105240_10746188 3300009093 Bacteria 1065
159 Ga0105240_11204652 3300009093 Bacteria 802
160 Ga0111539_10036353 3300009094 Bacteria 5956
161 Ga0111539_10040856 3300009094 Bacteria 5581
162 Ga0111539_10550866 3300009094 Bacteria 1343
163 Ga0111539_12187285 3300009094 Bacteria 642
164 Ga0105245_10848706 3300009098 Bacteria 953
165 Ga0105245_12106184 3300009098 Bacteria 618
166 Ga0105245_12138194 3300009098 Bacteria 613
167 Ga0105245_12813144 3300009098 Bacteria 539
168 Ga0105247_10231360 3300009101 Bacteria 1255
169 Ga0114129_10001884 3300009147 Bacteria 28609
170 Ga0114129_10010194 3300009147 Bacteria 13398
171 Ga0114129_10054269 3300009147 Bacteria 5619
172 Ga0114129_10219640 3300009147 Bacteria 2564
173 Ga0114129_10644764 3300009147 Bacteria 1368
174 Ga0114129_11049456 3300009147 Bacteria 1023
175 Ga0114129_11430191 3300009147 Bacteria 852
176 Ga0114129_12352072 3300009147 Bacteria 639
177 Ga0105243_10146028 3300009148 Bacteria 2024
178 Ga0105241_10423283 3300009174 Bacteria 1172
179 Ga0105242_10009684 3300009176 Bacteria 7386
180 Ga0105242_10047089 3300009176 Bacteria 3500
181 Ga0105242_10893981 3300009176 Bacteria 887
182 Ga0105242_12178993 3300009176 Bacteria 599
183 Ga0105248_10054569 3300009177 Bacteria 4482
184 Ga0105248_10135496 3300009177 Bacteria 2778
185 Ga0105248_10347427 3300009177 Bacteria 1670
186 Ga0105248_10723410 3300009177 Bacteria 1123
187 Ga0105248_13113725 3300009177 Bacteria 528
188 Ga0105238_10467331 3300009551 Bacteria 1260
189 Ga0105249_10139557 3300009553 Bacteria 2322
190 Ga0105249_13441080 3300009553 Bacteria 509
191 Ga0105239_11107217 3300010375 Bacteria 912
192 Ga0105246_10957802 3300011119 Bacteria 772
193 Ga0105246_11046272 3300011119 Bacteria 742
194 Ga0157369_11043006 3300013105 Bacteria 837
195 Ga0157374_10743263 3300013296 Bacteria 995
196 Ga0157378_10163116 3300013297 Bacteria 2085
197 Ga0157378_10288649 3300013297 Bacteria 1584
198 Ga0157378_11952335 3300013297 Bacteria 636
199 Ga0163162_10544496 3300013306 Bacteria 1289
200 Ga0163162_11332726 3300013306 Bacteria 816
201 Ga0163162_13089706 3300013306 Bacteria 535
202 Ga0157375_11397521 3300013308 Bacteria 824
203 Ga0157375_11693315 3300013308 Bacteria 749
204 Ga0157375_12281267 3300013308 Bacteria 645
205 Ga0163163_10517288 3300014325 Bacteria 1256
206 Ga0157380_10243960 3300014326 Bacteria 1622
207 Ga0157380_10836467 3300014326 Bacteria 941
208 Ga0157380_11077796 3300014326 Bacteria 841
209 Ga0182008_10116678 3300014497 Bacteria 1325
210 Ga0157376_10083909 3300014969 Bacteria 2742
211 Ga0157376_10518247 3300014969 Bacteria 1175
212 Ga0163161_10498898 3300017792 Bacteria 991
213 Ga0163161_11489579 3300017792 Bacteria 594
214 Ga0207697_10171749 3300025315 Bacteria 948
215 Ga0207697_10282828 3300025315 Bacteria 735
216 Ga0207682_10085295 3300025893 Bacteria 1360
217 Ga0207642_10070236 3300025899 Bacteria 1664
218 Ga0207688_10150873 3300025901 Bacteria 1373
219 Ga0207680_10627162 3300025903 Bacteria 769
220 Ga0207699_10059023 3300025906 Bacteria 2298
221 Ga0207645_10000832 3300025907 Bacteria 25840
222 Ga0207645_10333236 3300025907 Bacteria 1014
223 Ga0207643_10557088 3300025908 Bacteria 736
224 Ga0207707_10268581 3300025912 Bacteria 1479
225 Ga0207707_10470554 3300025912 Bacteria 1074
226 Ga0207695_10036671 3300025913 Bacteria 5297
227 Ga0207695_10170031 3300025913 Bacteria 2105
228 Ga0207663_10264794 3300025916 Bacteria 1271
229 Ga0207660_10615980 3300025917 Bacteria 884
230 Ga0207662_10072581 3300025918 Bacteria 2086
231 Ga0207662_10078418 3300025918 Bacteria 2011
232 Ga0207662_10296163 3300025918 Bacteria 1074
233 Ga0207657_10606824 3300025919 Bacteria 854
234 Ga0207652_11095295 3300025921 Bacteria 697
235 Ga0207646_10210305 3300025922 Bacteria 1757
236 Ga0207681_10025780 3300025923 Bacteria 3785
237 Ga0207681_10928869 3300025923 Bacteria 729
238 Ga0207681_11014125 3300025923 Bacteria 696
239 Ga0207694_10253145 3300025924 Bacteria 1442
240 Ga0207650_10908625 3300025925 Bacteria 748
241 Ga0207659_10002273 3300025926 Bacteria 11435
242 Ga0207659_10061319 3300025926 Bacteria 2710
243 Ga0207659_10229393 3300025926 Bacteria 1497
244 Ga0207659_10702622 3300025926 Bacteria 866
245 Ga0207659_11164273 3300025926 Bacteria 663
246 Ga0207687_10228909 3300025927 Bacteria 1468
247 Ga0207700_10135582 3300025928 Bacteria 2016
248 Ga0207644_10156868 3300025931 Unclassified 1766
249 Ga0207644_10286046 3300025931 Bacteria 1325
250 Ga0207644_10536046 3300025931 Bacteria 968
251 Ga0207706_10135877 3300025933 Bacteria 2163
252 Ga0207706_10257742 3300025933 Bacteria 1523
253 Ga0207706_10831945 3300025933 Bacteria 783
254 Ga0207686_10046367 3300025934 Bacteria 2680
255 Ga0207686_10921988 3300025934 Bacteria 706
256 Ga0207709_10059226 3300025935 Bacteria 2383
257 Ga0207669_10005498 3300025937 Bacteria 5691
258 Ga0207669_11474062 3300025937 Bacteria 580
259 Ga0207704_10279281 3300025938 Bacteria 1269
260 Ga0207704_11523955 3300025938 Bacteria 574
261 Ga0207691_10247583 3300025940 Bacteria 1539
262 Ga0207691_10645486 3300025940 Bacteria 894
263 Ga0207711_10357160 3300025941 Bacteria 1353
264 Ga0207689_10314973 3300025942 Bacteria 1298
265 Ga0207689_10573174 3300025942 Bacteria 949
266 Ga0207661_10036173 3300025944 Unclassified 3853
267 Ga0207661_11871807 3300025944 Bacteria 546
268 Ga0207679_11350301 3300025945 Bacteria 654
269 Ga0207667_10153106 3300025949 Bacteria 2373
270 Ga0207651_10045535 3300025960 Bacteria 2944
271 Ga0207651_10158971 3300025960 Bacteria 1769
272 Ga0207651_10238605 3300025960 Bacteria 1480
273 Ga0207651_10388544 3300025960 Bacteria 1184
274 Ga0207651_11203267 3300025960 Bacteria 680
275 Ga0207651_11983295 3300025960 Bacteria 523
276 Ga0207712_10060686 3300025961 Bacteria 2681
277 Ga0207668_11741704 3300025972 Bacteria 562
278 Ga0207640_10066558 3300025981 Bacteria 2408
279 Ga0207640_10098649 3300025981 Bacteria 2043
280 Ga0207658_10469260 3300025986 Bacteria 1117
281 Ga0207658_11543063 3300025986 Bacteria 607
282 Ga0207677_10196894 3300026023 Bacteria 1598
283 Ga0207703_10600658 3300026035 Bacteria 1041
284 Ga0207703_11362444 3300026035 Bacteria 682
285 Ga0207703_11574971 3300026035 Bacteria 632
286 Ga0207708_10036954 3300026075 Bacteria 3719
287 Ga0207708_10111849 3300026075 Bacteria 2121
288 Ga0207702_10648262 3300026078 Bacteria 1038
289 Ga0207648_10006143 3300026089 Bacteria 11972
290 Ga0207648_10037525 3300026089 Bacteria 4268
291 Ga0207675_100004698 3300026118 Bacteria 13146
292 Ga0207675_100154112 3300026118 Bacteria 2189
293 Ga0207675_100186993 3300026118 Bacteria 1986
294 Ga0207675_100614799 3300026118 Bacteria 1091
295 Ga0207675_101313638 3300026118 Bacteria 744
296 Ga0207683_10010632 3300026121 Bacteria 7849
297 Ga0207683_10510041 3300026121 Bacteria 1111
298 Ga0207683_10673139 3300026121 Bacteria 959
299 Ga0207683_11124417 3300026121 Bacteria 728
300 Ga0207428_10114140 3300027907 Bacteria 2076
301 Ga0207428_10303071 3300027907 Bacteria 1182
302 Ga0268266_10177836 3300028379 Bacteria 1935
303 Ga0268266_10183313 3300028379 Bacteria 1907
304 Ga0268265_10151126 3300028380 Bacteria 1959
305 Ga0268265_12089394 3300028380 Bacteria 573
306 Ga0268264_10280000 3300028381 Bacteria 1562
307 Ga0268264_10372285 3300028381 Bacteria 1366
308 Ga0268264_10544549 3300028381 Bacteria 1137
309 Ga0307511_10301629 3300030521 Bacteria 723
310 Ga0307405_10693922 3300031731 Bacteria 842
311 Ga0307405_11668527 3300031731 Bacteria 564
312 Ga0307413_10086714 3300031824 Bacteria 2025
313 Ga0307407_10842987 3300031903 Bacteria 700
314 Ga0307409_100435257 3300031995 Bacteria 1262
315 Ga0307416_100370324 3300032002 Bacteria 1458
316 Ga0307414_10689465 3300032004 Bacteria 924
317 Ga0373930_0037263 3300034816 Bacteria 1023
318 Ga0373950_0000556 3300034818 Bacteria 4564
319 Ga0373958_0002910 3300034819 Bacteria 2442
320 Ga0373938_0000201 3300034957 Bacteria 8984
321 Ga0373926_0431599 3300035083 Bacteria 522
322 Ga0373929_0000285 3300035085 Bacteria 9419
323 Ga0373934_0124430 3300035086 Bacteria 1050
324 Ga0373940_0001116 3300035088 Bacteria 4678
325 Ga0373949_0000272 3300035090 Bacteria 19116
326 Ga0373951_0001744 3300035091 Bacteria 5677
327 Ga0373952_0002843 3300035092 Bacteria 3128
328 Ga0373923_0094246 3300035111 Bacteria 1313
329 Ga0373932_0000107 3300035112 Bacteria 22737
330 Ga0373936_0144585 3300035113 Bacteria 1028
331 Ga0373939_0000931 3300035114 Bacteria 7268
332 Ga0373941_0004332 3300035115 Bacteria 3270
333 Ga0373945_0024830 3300035116 Unclassified 2079
334 Ga0373957_0150353 3300035120 Bacteria 956
335 Ga0373960_0001615 3300035121 Bacteria 5039
336 Ga0373943_0005078 3300035170 Bacteria 5933
337 Ga0373943_0075499 3300035170 Unclassified 1717
338 Ga0373943_0320725 3300035170 Bacteria 883
339 Ga0373946_0020842 3300035171 Bacteria 2537
340 Ga0373946_0494655 3300035171 Bacteria 627
341 Ga0373955_0019025 3300035172 Bacteria 3425
342 Ga0373955_0141782 3300035172 Bacteria 1410
343 Ga0373961_0000581 3300035241 Bacteria 13683
344 Ga0373924_0001140 3300035410 Bacteria 8548
345 Ga0373924_0371483 3300035410 Bacteria 638
346 Ga0373931_0532748 3300035691 Bacteria 761
347 Ga0373935_0021728 3300035692 Bacteria 3929
348 Ga0373927_0381668 3300035695 Bacteria 929
349 Ga0373933_0434986 3300035724 Bacteria 857
350 Ga0373933_0495924 3300035724 Bacteria 800
351 Ga0373947_0010236 3300035725 Bacteria 5384
352 Ga0373947_0336323 3300035725 Bacteria 1011
353 Ga0373937_0084489 3300036401 Bacteria 2937
354 Ga0373937_0125600 3300036401 Bacteria 2393
355 Ga0373937_0250380 3300036401 Bacteria 1670
356 Ga0373937_0881922 3300036401 Unclassified 843
357 Ga0373925_0030486 3300037068 Bacteria 3959
358 Ga0373925_1258056 3300037068 Bacteria 608
359 Ga0436364_1526095 3300037853 Bacteria 1088
360 Ga0242420_044345 3300038996 Bacteria 856
361 Ga0450913_011380 3300042117 Bacteria 724
362 Ga0439435_0011555 3300042436 Bacteria 2121
363 Ga0439444_0140100 3300042437 Bacteria 578
364 Ga0466972_0458433 3300044658 Bacteria 599
365 Ga0466964_0155904 3300044706 Bacteria 1063
366 Ga0451576_0155281 3300045051 Bacteria 2387
367 Ga0451576_1663028 3300045051 Bacteria 662
368 Ga0495592_0048223 3300046454 Bacteria 3169
369 Ga0495592_0637550 3300046454 Bacteria 647
370 Ga0495651_0472034 3300046462 Bacteria 807
371 Ga0495580_0035494 3300046472 Bacteria 3586
372 Ga0495580_0185580 3300046472 Bacteria 1436
373 Ga0495580_0216133 3300046472 Bacteria 1318
374 Ga0495582_0027039 3300046473 Bacteria 3144
375 Ga0495662_0088027 3300046476 Bacteria 1513
376 Ga0495664_0083803 3300046477 Bacteria 1913
377 Ga0495594_0070696 3300046499 Bacteria 1940
378 Ga0495608_0006866 3300046511 Bacteria 8065
379 Ga0495608_0439283 3300046511 Unclassified 795
380 Ga0495618_0481329 3300046514 Bacteria 750
381 Ga0495628_0054550 3300046516 Bacteria 3150
382 Ga0495630_0093446 3300046517 Bacteria 2273
383 Ga0495630_0664468 3300046517 Bacteria 798
384 Ga0495652_0061034 3300046529 Bacteria 3184
385 Ga0495640_0101636 3300046533 Bacteria 1887
386 Ga0495640_0258293 3300046533 Bacteria 1089
387 Ga0495640_0801463 3300046533 Bacteria 561
388 Ga0495587_0053970 3300046536 Bacteria 2369
389 Ga0495645_0320017 3300046543 Bacteria 1007
390 Ga0495667_0046893 3300046559 Bacteria 2856
391 Ga0495635_0895959 3300046663 Bacteria 568
392 Ga0495659_0372011 3300046664 Bacteria 613
393 Ga0495599_0073057 3300046678 Bacteria 2141
394 Ga0495599_0215962 3300046678 Bacteria 1175
395 Ga0495646_0681610 3300046680 Bacteria 518
396 Ga0495646_0703561 3300046680 Bacteria 508
397 Ga0495658_0143886 3300046683 Bacteria 1460
398 Ga0495658_0443090 3300046683 Bacteria 829
399 Ga0495669_0087019 3300046684 Bacteria 1439
400 Ga0495613_0001353 3300046689 Bacteria 18683
401 Ga0495600_0036053 3300046809 Bacteria 3214
402 Ga0495600_0555929 3300046809 Bacteria 701
403 Ga0495581_0085416 3300047315 Bacteria 1829
404 Ga0495581_0281075 3300047315 Bacteria 973
405 Ga0495604_0065102 3300047317 Bacteria 2776
406 Ga0495680_0209752 3300047322 Bacteria 1395
407 Ga0495680_0331007 3300047322 Bacteria 1064
408 Ga0495675_0470520 3300047444 Unclassified 725
409 Ga0495675_0852364 3300047444 Bacteria 501
410 Ga0495677_0048887 3300047445 Bacteria 1554
411 Ga0495684_0000424 3300047471 Bacteria 34540
412 Ga0495684_0325365 3300047471 Bacteria 1098
413 Ga0495684_0762517 3300047471 Bacteria 636
414 Ga0495602_0652168 3300048088 Bacteria 719
415 Ga0496102_0387805 3300048905 Bacteria 1314
416 Ga0496102_0430526 3300048905 Bacteria 1239
417 Ga0496103_0571190 3300048906 Bacteria 721
418 Ga0496104_0480768 3300048907 Bacteria 1153
419 Ga0496106_0014430 3300048909 Bacteria 5838
420 Ga0496109_0298914 3300048912 Bacteria 1518
421 Ga0496110_0159857 3300048913 Bacteria 2042
422 Ga0496110_1622808 3300048913 Bacteria 557
423 Ga0496115_0333525 3300048918 Bacteria 1239
424 Ga0501031_0754763 3300049568 Bacteria 624
425 Ga0501047_0009651 3300049581 Bacteria 9122
426 Ga0501076_0748263 3300049592 Bacteria 807
427 Ga0501080_0999353 3300049742 Bacteria 726
428 nmdc:mga05p37_1091608_c1 3300050507 Bacteria 837
429 nmdc:mga05p37_1109426_c1 3300050507 Bacteria 827
430 nmdc:mga05p37_11773_c1 3300050507 Bacteria 10426
431 nmdc:mga05p37_312350_c1 3300050507 Bacteria 1863
432 nmdc:mga05p37_385040_c1 3300050507 Unclassified 1642
433 nmdc:mga05p37_647877_c1 3300050507 Bacteria 1183
434 nmdc:mga09592_55382_c1 3300050508 Bacteria 3351
435 nmdc:mga0qj67_26518_c1 3300050509 Bacteria 4486
436 nmdc:mga08y16_11888_c1 3300050511 Bacteria 9143
437 nmdc:mga08y16_1812855_c1 3300050511 Bacteria 563
438 nmdc:mga08y16_430727_c1 3300050511 Bacteria 1347
439 nmdc:mga08y16_79262_c1 3300050511 Bacteria 3423
440 nmdc:mga0n895_1432788_c1 3300050512 Bacteria 659
441 nmdc:mga0n895_525080_c1 3300050512 Bacteria 1191
442 nmdc:mga0rr50_176870_c1 3300050513 Bacteria 1742
443 nmdc:mga0rr50_228682_c1 3300050513 Unclassified 1538
444 nmdc:mga08x19_23348_c1 3300050514 Bacteria 3837
445 nmdc:mga08x19_26099_c1 3300050514 Bacteria 3644
446 nmdc:mga0a205_202502_c1 3300050515 Bacteria 1875
447 nmdc:mga0a205_331285_c1 3300050515 Bacteria 1392
448 nmdc:mga0a205_592903_c1 3300050515 Bacteria 962
449 Ga0495601_0012686 3300053077 Bacteria 5054
450 Ga0495601_0145948 3300053077 Bacteria 1544
451 Ga0495601_0182055 3300053077 Bacteria 1374
452 Ga0495601_0948802 3300053077 Bacteria 542
453 Ga0495595_0130714 3300053084 Bacteria 1227
454 Ga0495619_0002235 3300053085 Bacteria 12802
455 Ga0495619_0037265 3300053085 Bacteria 3167
456 Ga0500658_0062819 3300053134 Bacteria 1549
457 Ga0070694_100901224
458 JGI25406J46586_10000128
459 JGI25406J46586_10017731
460 Ga0007409J51694_1033621
461 Ga0006780_1017810
462 Ga0065715_10470366
463 Ga0065707_10810089
464 Ga0070658_10261412
465 Ga0070676_10059346
466 Ga0070676_10192273
467 Ga0070683_100125727
468 Ga0070690_100220172
469 Ga0070690_100314070
470 Ga0070690_100732942
471 Ga0070677_10069518
472 Ga0070677_10319520
473 Ga0070677_10326714
474 Ga0068869_100144993
475 Ga0070666_10007103
476 Ga0070666_11257418
477 Ga0070680_100064479
478 Ga0068868_100050092
479 Ga0070660_100599142
480 Ga0070689_100390721
481 Ga0070691_10022831
482 Ga0070687_100038841
483 Ga0070687_100240955
484 Ga0070661_100201416
485 Ga0070692_10081752
486 Ga0070668_100151396
487 Ga0070669_100081459
488 Ga0070669_100892139
489 Ga0070675_100000378
490 Ga0070675_100029508
491 Ga0070675_100390551
492 Ga0070675_100707346
493 Ga0070671_100224474
494 Ga0070671_100329619
495 Ga0070671_101108644
496 Ga0070674_100008461
497 Ga0070674_100124271
498 Ga0070674_100260208
499 Ga0070673_100100988
500 Ga0070673_100202685
501 Ga0070673_100549455
502 Ga0070673_100576090
503 Ga0070673_101057387
504 Ga0070688_101006942
505 Ga0070667_101891444
506 Ga0070703_10181188
507 Ga0070709_10011143
508 Ga0070713_100051072
509 Ga0070701_10041763
510 Ga0070701_10187734
511 Ga0070711_100328008
512 Ga0070705_100988279
513 Ga0070705_100999433
514 Ga0070705_101406159
515 Ga0070700_100018745
516 Ga0070700_100142300
517 Ga0070694_100139062
518 Ga0070708_100913786
519 Ga0070708_101145324
520 Ga0070678_101011808
521 Ga0070662_100833801
522 Ga0070681_10101420
523 Ga0070681_10318710
524 Ga0068867_100741676
525 Ga0068867_100782782
526 Ga0070685_10860986
527 Ga0070685_11453659
528 Ga0070706_100340059
529 Ga0070706_100851483
530 Ga0070706_101066272
531 Ga0070698_100261143
532 Ga0070698_100521325
533 Ga0070698_101864827
534 Ga0070699_100000486
535 Ga0070699_100366250
536 Ga0070699_101595777
537 Ga0070679_100063056
538 Ga0070684_100052588
539 Ga0070697_100047202
540 Ga0070697_100396538
541 Ga0070672_100137609
542 Ga0070672_100213098
543 Ga0070672_100260048
544 Ga0070672_100786081
545 Ga0070672_101078791
546 Ga0070686_100000267
547 Ga0070686_100762550
548 Ga0070695_100003938
549 Ga0070695_100017866
550 Ga0070696_100034638
551 Ga0070696_100089166
552 Ga0070665_100005801
553 Ga0070665_100022657
554 Ga0070665_100072830
555 Ga0070665_101187405
556 Ga0070665_101544179
557 Ga0070704_100003575
558 Ga0070704_100058647
559 Ga0070704_100387518
560 Ga0068855_100184407
561 Ga0070664_100149928
562 Ga0068857_100904863
563 Ga0068854_100006839
564 Ga0068856_100203343
565 Ga0070702_100002386
566 Ga0068852_100816443
567 Ga0068859_100319284
568 Ga0068859_100440480
569 Ga0068864_100892977
570 Ga0068866_10337663
571 Ga0068866_10494617
572 Ga0068861_100004179
573 Ga0068861_100040045
574 Ga0068861_100264989
575 Ga0068861_102413897
576 Ga0068870_10706232
577 Ga0068863_101317234
578 Ga0068858_100378318
579 Ga0068858_100475910
580 Ga0068860_100180253
581 Ga0068862_100022454
582 Ga0068862_100681613
583 Ga0081455_10902345
584 Ga0081539_10000024
585 Ga0081539_10000096
586 Ga0081539_10008066
587 Ga0097621_100003330
588 Ga0097621_100078200
589 Ga0068871_100088101
590 Ga0068871_100732885
591 Ga0075428_100134199
592 Ga0075428_100364129
593 Ga0075430_100014349
594 Ga0075433_10174966
595 Ga0075433_10567114
596 Ga0075434_100080766
597 Ga0075434_100183975
598 Ga0075434_100222815
599 Ga0075434_101280827
600 Ga0075429_100089489
601 Ga0068865_100040987
602 Ga0068865_100324090
603 Ga0068865_100675195
604 Ga0075436_100023850
605 Ga0075436_100031104
606 Ga0075436_100583077
607 Ga0097620_100319291
608 Ga0097620_100440482
609 Ga0075435_100001595
610 Ga0075435_100197629
611 Ga0099794_10257537
612 Ga0105240_10048845
613 Ga0105240_10169695
614 Ga0105240_10746188
615 Ga0105240_11204652
616 Ga0111539_10036353
617 Ga0111539_10040856
618 Ga0111539_10550866
619 Ga0111539_12187285
620 Ga0105245_10848706
621 Ga0105245_12106184
622 Ga0105245_12138194
623 Ga0105245_12813144
624 Ga0105247_10231360
625 Ga0114129_10001884
626 Ga0114129_10010194
627 Ga0114129_10054269
628 Ga0114129_10219640
629 Ga0114129_10644764
630 Ga0114129_11049456
631 Ga0114129_11430191
632 Ga0114129_12352072
633 Ga0105243_10146028
634 Ga0105241_10423283
635 Ga0105242_10009684
636 Ga0105242_10047089
637 Ga0105242_10893981
638 Ga0105242_12178993
639 Ga0105248_10054569
640 Ga0105248_10135496
641 Ga0105248_10347427
642 Ga0105248_10723410
643 Ga0105248_13113725
644 Ga0105238_10467331
645 Ga0105249_10139557
646 Ga0105249_13441080
647 Ga0105239_11107217
648 Ga0105246_10957802
649 Ga0105246_11046272
650 Ga0157369_11043006
651 Ga0157374_10743263
652 Ga0157378_10163116
653 Ga0157378_10288649
654 Ga0157378_11952335
655 Ga0163162_10544496
656 Ga0163162_11332726
657 Ga0163162_13089706
658 Ga0157375_11397521
659 Ga0157375_11693315
660 Ga0157375_12281267
661 Ga0163163_10517288
662 Ga0157380_10243960
663 Ga0157380_10836467
664 Ga0157380_11077796
665 Ga0182008_10116678
666 Ga0157376_10083909
667 Ga0157376_10518247
668 Ga0163161_10498898
669 Ga0163161_11489579
670 Ga0207697_10171749
671 Ga0207697_10282828
672 Ga0207682_10085295
673 Ga0207642_10070236
674 Ga0207688_10150873
675 Ga0207680_10627162
676 Ga0207699_10059023
677 Ga0207645_10000832
678 Ga0207645_10333236
679 Ga0207643_10557088
680 Ga0207707_10268581
681 Ga0207707_10470554
682 Ga0207695_10036671
683 Ga0207695_10170031
684 Ga0207663_10264794
685 Ga0207660_10615980
686 Ga0207662_10072581
687 Ga0207662_10078418
688 Ga0207662_10296163
689 Ga0207657_10606824
690 Ga0207652_11095295
691 Ga0207646_10210305
692 Ga0207681_10025780
693 Ga0207681_10928869
694 Ga0207681_11014125
695 Ga0207694_10253145
696 Ga0207650_10908625
697 Ga0207659_10002273
698 Ga0207659_10061319
699 Ga0207659_10229393
700 Ga0207659_10702622
701 Ga0207659_11164273
702 Ga0207687_10228909
703 Ga0207700_10135582
704 Ga0207644_10156868
705 Ga0207644_10286046
706 Ga0207644_10536046
707 Ga0207706_10135877
708 Ga0207706_10257742
709 Ga0207706_10831945
710 Ga0207686_10046367
711 Ga0207686_10921988
712 Ga0207709_10059226
713 Ga0207669_10005498
714 Ga0207669_11474062
715 Ga0207704_10279281
716 Ga0207704_11523955
717 Ga0207691_10247583
718 Ga0207691_10645486
719 Ga0207711_10357160
720 Ga0207689_10314973
721 Ga0207689_10573174
722 Ga0207661_10036173
723 Ga0207661_11871807
724 Ga0207679_11350301
725 Ga0207667_10153106
726 Ga0207651_10045535
727 Ga0207651_10158971
728 Ga0207651_10238605
729 Ga0207651_10388544
730 Ga0207651_11203267
731 Ga0207651_11983295
732 Ga0207712_10060686
733 Ga0207668_11741704
734 Ga0207640_10066558
735 Ga0207640_10098649
736 Ga0207658_10469260
737 Ga0207658_11543063
738 Ga0207677_10196894
739 Ga0207703_10600658
740 Ga0207703_11362444
741 Ga0207703_11574971
742 Ga0207708_10036954
743 Ga0207708_10111849
744 Ga0207702_10648262
745 Ga0207648_10006143
746 Ga0207648_10037525
747 Ga0207675_100004698
748 Ga0207675_100154112
749 Ga0207675_100186993
750 Ga0207675_100614799
751 Ga0207675_101313638
752 Ga0207683_10010632
753 Ga0207683_10510041
754 Ga0207683_10673139
755 Ga0207683_11124417
756 Ga0207428_10114140
757 Ga0207428_10303071
758 Ga0268266_10177836
759 Ga0268266_10183313
760 Ga0268265_10151126
761 Ga0268265_12089394
762 Ga0268264_10280000
763 Ga0268264_10372285
764 Ga0268264_10544549
765 Ga0307511_10301629
766 Ga0307405_10693922
767 Ga0307405_11668527
768 Ga0307413_10086714
769 Ga0307407_10842987
770 Ga0307409_100435257
771 Ga0307416_100370324
772 Ga0307414_10689465
773 Ga0373930_0037263
774 Ga0373950_0000556
775 Ga0373958_0002910
776 Ga0373938_0000201
777 Ga0373926_0431599
778 Ga0373929_0000285
779 Ga0373934_0124430
780 Ga0373940_0001116
781 Ga0373949_0000272
782 Ga0373951_0001744
783 Ga0373952_0002843
784 Ga0373923_0094246
785 Ga0373932_0000107
786 Ga0373936_0144585
787 Ga0373939_0000931
788 Ga0373941_0004332
789 Ga0373945_0024830
790 Ga0373957_0150353
791 Ga0373960_0001615
792 Ga0373943_0005078
793 Ga0373943_0075499
794 Ga0373943_0320725
795 Ga0373946_0020842
796 Ga0373946_0494655
797 Ga0373955_0019025
798 Ga0373955_0141782
799 Ga0373961_0000581
800 Ga0373924_0001140
801 Ga0373924_0371483
802 Ga0373931_0532748
803 Ga0373935_0021728
804 Ga0373927_0381668
805 Ga0373933_0434986
806 Ga0373933_0495924
807 Ga0373947_0010236
808 Ga0373947_0336323
809 Ga0373937_0084489
810 Ga0373937_0125600
811 Ga0373937_0250380
812 Ga0373937_0881922
813 Ga0373925_0030486
814 Ga0373925_1258056
815 Ga0436364_1526095
816 Ga0242420_044345
817 Ga0450913_011380
818 Ga0439435_0011555
819 Ga0439444_0140100
820 Ga0466972_0458433
821 Ga0466964_0155904
822 Ga0451576_0155281
823 Ga0451576_1663028
824 Ga0495592_0048223
825 Ga0495592_0637550
826 Ga0495651_0472034
827 Ga0495580_0035494
828 Ga0495580_0185580
829 Ga0495580_0216133
830 Ga0495582_0027039
831 Ga0495662_0088027
832 Ga0495664_0083803
833 Ga0495594_0070696
834 Ga0495608_0006866
835 Ga0495608_0439283
836 Ga0495618_0481329
837 Ga0495628_0054550
838 Ga0495630_0093446
839 Ga0495630_0664468
840 Ga0495652_0061034
841 Ga0495640_0101636
842 Ga0495640_0258293
843 Ga0495640_0801463
844 Ga0495587_0053970
845 Ga0495645_0320017
846 Ga0495667_0046893
847 Ga0495635_0895959
848 Ga0495659_0372011
849 Ga0495599_0073057
850 Ga0495599_0215962
851 Ga0495646_0681610
852 Ga0495646_0703561
853 Ga0495658_0143886
854 Ga0495658_0443090
855 Ga0495669_0087019
856 Ga0495613_0001353
857 Ga0495600_0036053
858 Ga0495600_0555929
859 Ga0495581_0085416
860 Ga0495581_0281075
861 Ga0495604_0065102
862 Ga0495680_0209752
863 Ga0495680_0331007
864 Ga0495675_0470520
865 Ga0495675_0852364
866 Ga0495677_0048887
867 Ga0495684_0000424
868 Ga0495684_0325365
869 Ga0495684_0762517
870 Ga0495602_0652168
871 Ga0496102_0387805
872 Ga0496102_0430526
873 Ga0496103_0571190
874 Ga0496104_0480768
875 Ga0496106_0014430
876 Ga0496109_0298914
877 Ga0496110_0159857
878 Ga0496110_1622808
879 Ga0496115_0333525
880 Ga0501031_0754763
881 Ga0501047_0009651
882 Ga0501076_0748263
883 Ga0501080_0999353
884 nmdc:mga05p37_1091608_c1
885 nmdc:mga05p37_1109426_c1
886 nmdc:mga05p37_11773_c1
887 nmdc:mga05p37_312350_c1
888 nmdc:mga05p37_385040_c1
889 nmdc:mga05p37_647877_c1
890 nmdc:mga09592_55382_c1
891 nmdc:mga0qj67_26518_c1
892 nmdc:mga08y16_11888_c1
893 nmdc:mga08y16_1812855_c1
894 nmdc:mga08y16_430727_c1
895 nmdc:mga08y16_79262_c1
896 nmdc:mga0n895_1432788_c1
897 nmdc:mga0n895_525080_c1
898 nmdc:mga0rr50_176870_c1
899 nmdc:mga0rr50_228682_c1
900 nmdc:mga08x19_23348_c1
901 nmdc:mga08x19_26099_c1
902 nmdc:mga0a205_202502_c1
903 nmdc:mga0a205_331285_c1
904 nmdc:mga0a205_592903_c1
905 Ga0495601_0012686
906 Ga0495601_0145948
907 Ga0495601_0182055
908 Ga0495601_0948802
909 Ga0495595_0130714
910 Ga0495619_0002235
911 Ga0495619_0037265
912 Ga0500658_0062819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01242

PTPS

6-pyruvoyl tetrahydropterin synthase

3

132

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9933 2 131
3d7j-assembly1.cif.gz_D sco6650, a 6-pyruvoyltetrahydropterin synthase homolog from streptomyces coelicolor 0.9567 2 131
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8773 2 130
2dtt-assembly2.cif.gz_F crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8667 2 130
2dtt-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydrobiopterin synthase from pyrococcus horikoshii ot3 complexed with (1'r,2's)-biopterin 0.8539 2 130
ID Description Score Start End Superfamily
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.9951 2 131 3.30.479.10
3d7jC00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.958 2 131 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8316 1 130 3.30.479.10
4ntmA00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8247 1 130 3.30.479.10
2g64A00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.8209 2 131 3.30.479.10
ID Description Score Start End GO Terms
AF-A0A2N2S8J1-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 1.002 1 119 GO:0046872
GO:0070497
AF-A0A136PI54-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 1.001 1 105 GO:0046872
GO:0070497
AF-A0A7K2MGU2-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9997 1 89 GO:0046872
GO:0070497
AF-C9ZBP0-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9965 2 131 GO:0046872
GO:0070497
AF-A0A4D4JZN4-F1-model_v4 6-carboxy-5,6,7,8-tetrahydropterin synthase (EC 4.1.2.50) (Queuosine biosynthesis protein QueD) 0.9964 2 131 GO:0046872
GO:0070497

Map