F447710

General Info

Members Datasets Scaffolds Average Seq Length
456 208 912 230

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100001105|Ga0070689_1000011054
Length 242
Sequence MLVRTATKAMPSKRYKKALEMVDTRKAYPLKAAVEILVKFPKAKFNETVDLAFRLGVDPKQSDQMVRGTVPLPHGSGKTVRVLVFAKPGPAAEAAKSAGAEFVGFDDMIKKCTDGWTDFDVAIATPEAMGEVRKLGKVLGPRGLMPNPKTGTVTDDTTKAVKEVKAGRVEFKIDKAGNIHVPVGKASFPTSQIEENARAVIEAVAKARPHSVKGTYIESCAISATMSPPVRLDIREFAATTH

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
85 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
91 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
94 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
95 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
96 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
114 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
118 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
127 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
139 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
177 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 3.73
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.75
Nodule 0
Rhizoplane 0.88
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 2.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100001105 3300005340 Bacteria 16956
2 Ga0058861_12055730 3300004800 Bacteria 2164
3 Ga0070658_10038544 3300005327 Bacteria 3853
4 Ga0070658_10846499 3300005327 Bacteria 795
5 Ga0070676_10494941 3300005328 Bacteria 867
6 Ga0070690_100002343 3300005330 Bacteria 10186
7 Ga0070690_100152237 3300005330 Bacteria 1579
8 Ga0070670_100142016 3300005331 Bacteria 2076
9 Ga0070670_100234322 3300005331 Bacteria 1598
10 Ga0068868_100348883 3300005338 Bacteria 1267
11 Ga0070689_100023540 3300005340 Bacteria 4611
12 Ga0070689_100459060 3300005340 Unclassified 1085
13 Ga0070689_100563151 3300005340 Bacteria 983
14 Ga0070689_100625917 3300005340 Bacteria 934
15 Ga0070687_100168920 3300005343 Bacteria 1300
16 Ga0070668_100143988 3300005347 Bacteria 1922
17 Ga0070675_100126864 3300005354 Bacteria 2171
18 Ga0070675_100815190 3300005354 Bacteria 853
19 Ga0070688_100030103 3300005365 Bacteria 3256
20 Ga0070688_100083409 3300005365 Bacteria 2074
21 Ga0070688_100658076 3300005365 Unclassified 807
22 Ga0070667_100357454 3300005367 Bacteria 1323
23 Ga0070713_100262319 3300005436 Bacteria 1579
24 Ga0070713_100326864 3300005436 Bacteria 1417
25 Ga0070701_10002782 3300005438 Bacteria 6798
26 Ga0070701_10351199 3300005438 Bacteria 921
27 Ga0070711_100009588 3300005439 Bacteria 5968
28 Ga0070705_100084927 3300005440 Bacteria 1955
29 Ga0070700_100546365 3300005441 Bacteria 899
30 Ga0070708_100220131 3300005445 Bacteria 1780
31 Ga0070681_10117944 3300005458 Bacteria 2590
32 Ga0070681_10239429 3300005458 Bacteria 1728
33 Ga0070685_10039195 3300005466 Bacteria 2690
34 Ga0070679_100205627 3300005530 Bacteria 1933
35 Ga0070679_100399816 3300005530 Bacteria 1320
36 Ga0070686_100005306 3300005544 Bacteria 7125
37 Ga0070686_100541676 3300005544 Bacteria 909
38 Ga0070704_100031808 3300005549 Bacteria 3552
39 Ga0068855_100098533 3300005563 Bacteria 3367
40 Ga0068855_100205062 3300005563 Bacteria 2218
41 Ga0068855_100247431 3300005563 Bacteria 1990
42 Ga0068855_100303284 3300005563 Bacteria 1768
43 Ga0068857_100000314 3300005577 Bacteria 33509
44 Ga0068857_100091911 3300005577 Bacteria 2717
45 Ga0068857_100510374 3300005577 Bacteria 1129
46 Ga0068856_100000641 3300005614 Bacteria 38028
47 Ga0068856_100071629 3300005614 Bacteria 3431
48 Ga0068856_100154035 3300005614 Bacteria 2308
49 Ga0068859_100089231 3300005617 Bacteria 3133
50 Ga0068859_100329771 3300005617 Bacteria 1620
51 Ga0068864_100039557 3300005618 Bacteria 4031
52 Ga0068864_100136345 3300005618 Bacteria 2210
53 Ga0068864_100395663 3300005618 Bacteria 1312
54 Ga0068864_100967162 3300005618 Bacteria 843
55 Ga0068863_100002752 3300005841 Bacteria 17408
56 Ga0068863_100112083 3300005841 Bacteria 2598
57 Ga0068863_100544140 3300005841 Bacteria 1146
58 Ga0068863_100554125 3300005841 Bacteria 1135
59 Ga0068858_100328122 3300005842 Bacteria 1463
60 Ga0068858_100496451 3300005842 Bacteria 1179
61 Ga0068858_100966158 3300005842 Unclassified 834
62 Ga0070717_10953892 3300006028 Bacteria 781
63 Ga0075363_100159653 3300006048 Bacteria 1276
64 Ga0070715_10291600 3300006163 Bacteria 869
65 Ga0070712_100550418 3300006175 Bacteria 972
66 Ga0075366_10140343 3300006195 Bacteria 1461
67 Ga0097621_100100323 3300006237 Bacteria 2435
68 Ga0097621_100143197 3300006237 Unclassified 2044
69 Ga0097621_100264768 3300006237 Bacteria 1509
70 Ga0097621_100406797 3300006237 Bacteria 1219
71 Ga0068871_100005071 3300006358 Bacteria 9199
72 Ga0068871_100245356 3300006358 Bacteria 1558
73 Ga0075428_100012485 3300006844 Bacteria 9447
74 Ga0075428_100145194 3300006844 Bacteria 2579
75 Ga0075428_100511307 3300006844 Bacteria 1285
76 Ga0075431_100045285 3300006847 Bacteria 4535
77 Ga0075429_100163751 3300006880 Bacteria 1948
78 Ga0075436_100224566 3300006914 Bacteria 1333
79 Ga0097620_100089233 3300006931 Bacteria 3133
80 Ga0097620_100329756 3300006931 Bacteria 1620
81 Ga0105240_10002950 3300009093 Bacteria 26829
82 Ga0105240_10061220 3300009093 Bacteria 4691
83 Ga0105240_10112418 3300009093 Bacteria 3292
84 Ga0105240_10630149 3300009093 Bacteria 1177
85 Ga0111539_10012384 3300009094 Bacteria 10694
86 Ga0111539_10096763 3300009094 Bacteria 3467
87 Ga0111539_10157066 3300009094 Bacteria 2661
88 Ga0111539_10199111 3300009094 Bacteria 2336
89 Ga0111539_10360705 3300009094 Bacteria 1692
90 Ga0111539_10362553 3300009094 Bacteria 1687
91 Ga0105241_10625625 3300009174 Bacteria 975
92 Ga0105248_10361523 3300009177 Bacteria 1634
93 Ga0105248_10728979 3300009177 Bacteria 1118
94 Ga0105238_10035176 3300009551 Bacteria 5094
95 Ga0105238_10064489 3300009551 Bacteria 3663
96 Ga0105238_10278104 3300009551 Bacteria 1655
97 Ga0105249_10197216 3300009553 Bacteria 1968
98 Ga0105249_10386969 3300009553 Bacteria 1426
99 Ga0157371_10224899 3300013102 Bacteria 1348
100 Ga0157370_10328423 3300013104 Unclassified 1410
101 Ga0157374_10237474 3300013296 Bacteria 1792
102 Ga0157374_10773453 3300013296 Bacteria 975
103 Ga0163162_10313887 3300013306 Bacteria 1700
104 Ga0163162_10326750 3300013306 Bacteria 1666
105 Ga0157372_10242435 3300013307 Bacteria 2091
106 Ga0157372_10420636 3300013307 Bacteria 1557
107 Ga0157375_10000016 3300013308 Bacteria 295002
108 Ga0157375_10790890 3300013308 Bacteria 1098
109 Ga0163163_10000130 3300014325 Bacteria 77745
110 Ga0163163_10284621 3300014325 Bacteria 1705
111 Ga0163163_10487555 3300014325 Bacteria 1294
112 Ga0206352_10324391 3300020078 Bacteria 1382
113 Ga0206352_11309314 3300020078 Bacteria 1063
114 Ga0209050_1000212 3300025298 Bacteria 129523
115 Ga0207685_10164284 3300025905 Bacteria 1016
116 Ga0207705_10588053 3300025909 Unclassified 865
117 Ga0207707_10309811 3300025912 Bacteria 1364
118 Ga0207695_10043377 3300025913 Bacteria 4794
119 Ga0207695_10050094 3300025913 Bacteria 4396
120 Ga0207695_10205050 3300025913 Bacteria 1885
121 Ga0207695_10418482 3300025913 Bacteria 1224
122 Ga0207663_10009428 3300025916 Bacteria 5155
123 Ga0207657_10127159 3300025919 Bacteria 2092
124 Ga0207652_10308906 3300025921 Bacteria 1427
125 Ga0207694_10020359 3300025924 Bacteria 5018
126 Ga0207694_10030076 3300025924 Bacteria 4147
127 Ga0207694_10348563 3300025924 Bacteria 1225
128 Ga0207650_10076590 3300025925 Bacteria 2527
129 Ga0207659_10160768 3300025926 Bacteria 1763
130 Ga0207659_10451415 3300025926 Bacteria 1083
131 Ga0207700_10197682 3300025928 Bacteria 1693
132 Ga0207664_10014961 3300025929 Bacteria 5618
133 Ga0207670_10002276 3300025936 Bacteria 10056
134 Ga0207670_10027186 3300025936 Bacteria 3614
135 Ga0207670_10027396 3300025936 Bacteria 3602
136 Ga0207670_10040222 3300025936 Bacteria 3068
137 Ga0207670_10306299 3300025936 Bacteria 1245
138 Ga0207670_10514149 3300025936 Bacteria 974
139 Ga0207691_10450973 3300025940 Bacteria 1095
140 Ga0207711_10225843 3300025941 Bacteria 1714
141 Ga0207667_10097416 3300025949 Bacteria 3036
142 Ga0207667_10117627 3300025949 Bacteria 2739
143 Ga0207667_10157547 3300025949 Bacteria 2336
144 Ga0207651_10285519 3300025960 Bacteria 1366
145 Ga0207703_10030262 3300026035 Bacteria 4278
146 Ga0207703_10349680 3300026035 Bacteria 1360
147 Ga0207708_10078302 3300026075 Bacteria 2538
148 Ga0207702_10002532 3300026078 Bacteria 17191
149 Ga0207702_10201626 3300026078 Bacteria 1844
150 Ga0207702_10615108 3300026078 Bacteria 1067
151 Ga0207641_10256580 3300026088 Bacteria 1635
152 Ga0207641_10680976 3300026088 Bacteria 1012
153 Ga0207648_10217040 3300026089 Bacteria 1699
154 Ga0207674_10014586 3300026116 Bacteria 8672
155 Ga0207674_10111751 3300026116 Bacteria 2706
156 Ga0207674_10143260 3300026116 Bacteria 2349
157 Ga0207698_10221931 3300026142 Bacteria 1709
158 Ga0207428_10235704 3300027907 Bacteria 1368
159 Ga0268265_10148866 3300028380 Bacteria 1972
160 Ga0268265_10520920 3300028380 Bacteria 1124
161 Ga0265337_1000229 3300028556 Bacteria 30122
162 Ga0265337_1000970 3300028556 Bacteria 15043
163 Ga0265337_1002027 3300028556 Bacteria 9617
164 Ga0265337_1027333 3300028556 Bacteria 1720
165 Ga0265337_1066757 3300028556 Bacteria 991
166 Ga0265326_10003823 3300028558 Bacteria 4900
167 Ga0265326_10010042 3300028558 Bacteria 2819
168 Ga0265326_10057634 3300028558 Bacteria 1099
169 Ga0265319_1000019 3300028563 Bacteria 154537
170 Ga0265319_1008100 3300028563 Bacteria 4640
171 Ga0265334_10068431 3300028573 Bacteria 1326
172 Ga0265334_10085184 3300028573 Bacteria 1160
173 Ga0265334_10100953 3300028573 Bacteria 1044
174 Ga0265318_10027779 3300028577 Bacteria 2220
175 Ga0265323_10000417 3300028653 Bacteria 24407
176 Ga0265323_10008406 3300028653 Bacteria 4255
177 Ga0265323_10020972 3300028653 Bacteria 2508
178 Ga0265323_10051176 3300028653 Bacteria 1466
179 Ga0265322_10011183 3300028654 Bacteria 2604
180 Ga0265336_10017444 3300028666 Bacteria 2338
181 Ga0265336_10020180 3300028666 Bacteria 2142
182 Ga0265336_10021674 3300028666 Bacteria 2053
183 Ga0265338_10000030 3300028800 Bacteria 260974
184 Ga0265338_10000780 3300028800 Bacteria 54179
185 Ga0265338_10000987 3300028800 Bacteria 47972
186 Ga0265338_10004601 3300028800 Bacteria 18557
187 Ga0265338_10006533 3300028800 Bacteria 14823
188 Ga0265338_10008265 3300028800 Bacteria 12668
189 Ga0265338_10012654 3300028800 Bacteria 9604
190 Ga0265338_10013914 3300028800 Bacteria 9029
191 Ga0265338_10013920 3300028800 Bacteria 9025
192 Ga0265338_10015221 3300028800 Bacteria 8475
193 Ga0265338_10020800 3300028800 Bacteria 6880
194 Ga0265338_10022019 3300028800 Bacteria 6622
195 Ga0265338_10022274 3300028800 Bacteria 6566
196 Ga0265338_10033305 3300028800 Bacteria 5003
197 Ga0265338_10052895 3300028800 Bacteria 3638
198 Ga0265338_10056827 3300028800 Bacteria 3466
199 Ga0265338_10156876 3300028800 Bacteria 1762
200 Ga0265338_10176641 3300028800 Bacteria 1632
201 Ga0265338_10179185 3300028800 Bacteria 1617
202 Ga0265338_10207234 3300028800 Bacteria 1474
203 Ga0265338_10207408 3300028800 Unclassified 1473
204 Ga0265338_10219591 3300028800 Bacteria 1421
205 Ga0265338_10270964 3300028800 Bacteria 1244
206 Ga0265338_10355418 3300028800 Bacteria 1052
207 Ga0265324_10001435 3300029957 Bacteria 13660
208 Ga0265324_10001945 3300029957 Bacteria 11071
209 Ga0265324_10007514 3300029957 Bacteria 4409
210 Ga0265324_10014532 3300029957 Bacteria 2911
211 Ga0265324_10060873 3300029957 Bacteria 1290
212 Ga0265324_10063069 3300029957 Bacteria 1265
213 Ga0265330_10013828 3300031235 Bacteria 3755
214 Ga0265330_10248420 3300031235 Bacteria 750
215 Ga0265332_10092285 3300031238 Bacteria 1280
216 Ga0265328_10021918 3300031239 Bacteria 2435
217 Ga0265320_10000792 3300031240 Bacteria 24069
218 Ga0265320_10011788 3300031240 Bacteria 5126
219 Ga0265320_10033671 3300031240 Bacteria 2613
220 Ga0265320_10049581 3300031240 Bacteria 2043
221 Ga0265320_10141783 3300031240 Bacteria 1088
222 Ga0265320_10206555 3300031240 Bacteria 876
223 Ga0265325_10048433 3300031241 Bacteria 2197
224 Ga0265325_10059088 3300031241 Bacteria 1950
225 Ga0265325_10094253 3300031241 Bacteria 1472
226 Ga0265329_10003820 3300031242 Bacteria 6463
227 Ga0265340_10001882 3300031247 Bacteria 11951
228 Ga0265340_10034214 3300031247 Bacteria 2528
229 Ga0265340_10140928 3300031247 Bacteria 1103
230 Ga0265340_10173340 3300031247 Bacteria 977
231 Ga0265339_10005066 3300031249 Bacteria 8848
232 Ga0265339_10018742 3300031249 Bacteria 4076
233 Ga0265331_10032119 3300031250 Bacteria 2604
234 Ga0265331_10132573 3300031250 Bacteria 1136
235 Ga0265327_10000005 3300031251 Bacteria 790146
236 Ga0265327_10002732 3300031251 Bacteria 17978
237 Ga0265327_10012586 3300031251 Bacteria 5694
238 Ga0265327_10033624 3300031251 Bacteria 2855
239 Ga0265327_10072287 3300031251 Bacteria 1723
240 Ga0265316_10001873 3300031344 Bacteria 22101
241 Ga0265316_10030917 3300031344 Bacteria 4383
242 Ga0265316_10031247 3300031344 Bacteria 4357
243 Ga0265316_10141589 3300031344 Bacteria 1806
244 Ga0265316_10159068 3300031344 Bacteria 1689
245 Ga0265316_10238190 3300031344 Bacteria 1338
246 Ga0265316_10550044 3300031344 Bacteria 822
247 Ga0307408_100453410 3300031548 Bacteria 1113
248 Ga0265313_10000967 3300031595 Bacteria 28455
249 Ga0265313_10013640 3300031595 Bacteria 4860
250 Ga0265314_10000087 3300031711 Bacteria 138681
251 Ga0265314_10059631 3300031711 Bacteria 2609
252 Ga0265314_10070841 3300031711 Bacteria 2335
253 Ga0265314_10319898 3300031711 Bacteria 863
254 Ga0265342_10068440 3300031712 Bacteria 2075
255 Ga0265342_10186684 3300031712 Bacteria 1133
256 Ga0307412_10165749 3300031911 Bacteria 1647
257 Ga0307414_10057144 3300032004 Bacteria 2741
258 Ga0316583_10061926 3300032133 Bacteria 1311
259 Ga0373938_0031526 3300034957 Bacteria 1137
260 Ga0373926_0015216 3300035083 Bacteria 2622
261 Ga0373929_0000280 3300035085 Bacteria 9481
262 Ga0373940_0128346 3300035088 Bacteria 792
263 Ga0373944_0000297 3300035089 Bacteria 11044
264 Ga0373949_0000949 3300035090 Bacteria 8991
265 Ga0373949_0056397 3300035090 Bacteria 1002
266 Ga0373951_0030370 3300035091 Bacteria 1272
267 Ga0373932_0000009 3300035112 Bacteria 156439
268 Ga0373936_0118062 3300035113 Unclassified 1131
269 Ga0373945_0134238 3300035116 Unclassified 994
270 Ga0373954_0001471 3300035118 Bacteria 9581
271 Ga0373954_0002140 3300035118 Bacteria 8202
272 Ga0373956_0271161 3300035119 Bacteria 807
273 Ga0373960_0049790 3300035121 Bacteria 1240
274 Ga0373946_0052471 3300035171 Bacteria 1710
275 Ga0373962_0000011 3300035242 Bacteria 52540
276 Ga0316574_0036220 3300035398 Bacteria 3020
277 Ga0316574_0228176 3300035398 Bacteria 1192
278 Ga0316574_0362288 3300035398 Bacteria 916
279 Ga0373931_0000030 3300035691 Bacteria 116251
280 Ga0373931_0215378 3300035691 Bacteria 1154
281 Ga0373931_0335574 3300035691 Unclassified 943
282 Ga0373935_0064365 3300035692 Bacteria 2351
283 Ga0373935_0115509 3300035692 Bacteria 1787
284 Ga0373935_0201180 3300035692 Bacteria 1376
285 Ga0373927_0007553 3300035695 Bacteria 7356
286 Ga0373927_0078363 3300035695 Bacteria 2140
287 Ga0373927_0255472 3300035695 Bacteria 1152
288 Ga0373933_0114497 3300035724 Bacteria 1685
289 Ga0373947_0001855 3300035725 Bacteria 12884
290 Ga0373947_0223153 3300035725 Bacteria 1239
291 Ga0373937_0212650 3300036401 Bacteria 1820
292 Ga0373937_0663370 3300036401 Bacteria 989
293 Ga0265778_001151 3300036457 Bacteria 2335
294 Ga0316582_0071725 3300036647 Bacteria 2244
295 Ga0316584_0252080 3300036712 Bacteria 1289
296 Ga0373925_0000423 3300037068 Bacteria 42927
297 Ga0373925_0005094 3300037068 Bacteria 9839
298 Ga0373925_0067045 3300037068 Bacteria 2706
299 Ga0373925_0217505 3300037068 Bacteria 1524
300 Ga0451798_0271669 3300041458 Bacteria 1629
301 Ga0451577_0006545 3300042876 Bacteria 11589
302 Ga0451577_0020815 3300042876 Bacteria 6013
303 Ga0451577_0042234 3300042876 Bacteria 4090
304 Ga0451577_0136316 3300042876 Bacteria 2204
305 Ga0451577_0141816 3300042876 Bacteria 2160
306 Ga0451577_0166999 3300042876 Bacteria 1983
307 Ga0451577_0175940 3300042876 Bacteria 1929
308 Ga0451577_0257709 3300042876 Bacteria 1579
309 Ga0451577_0269296 3300042876 Bacteria 1543
310 Ga0453684_0000516 3300044712 Bacteria 147788
311 Ga0453684_0003298 3300044712 Bacteria 36801
312 Ga0453684_0005150 3300044712 Bacteria 26304
313 Ga0453684_0018899 3300044712 Bacteria 10541
314 Ga0453684_0022847 3300044712 Bacteria 9258
315 Ga0453684_0146841 3300044712 Bacteria 2808
316 Ga0453684_0258266 3300044712 Bacteria 1997
317 Ga0453684_0298352 3300044712 Bacteria 1832
318 Ga0453684_0354038 3300044712 Bacteria 1655
319 Ga0453684_0407705 3300044712 Bacteria 1521
320 Ga0453684_0417833 3300044712 Bacteria 1499
321 Ga0466957_0646211 3300044842 Bacteria 743
322 Ga0451576_0015000 3300045051 Bacteria 8608
323 Ga0451576_0096656 3300045051 Bacteria 3072
324 Ga0451576_0106982 3300045051 Bacteria 2910
325 Ga0451576_0133627 3300045051 Bacteria 2587
326 Ga0451576_0196668 3300045051 Bacteria 2106
327 Ga0451576_0217304 3300045051 Bacteria 1996
328 Ga0451576_0331094 3300045051 Bacteria 1594
329 Ga0451576_0397661 3300045051 Bacteria 1445
330 Ga0451576_0551165 3300045051 Bacteria 1211
331 Ga0451576_0571935 3300045051 Bacteria 1187
332 Ga0451576_0602774 3300045051 Bacteria 1154
333 Ga0451576_0683770 3300045051 Bacteria 1078
334 Ga0451576_1125794 3300045051 Bacteria 821
335 Ga0495592_0000015 3300046454 Bacteria 145683
336 Ga0495592_0018446 3300046454 Bacteria 5307
337 Ga0495592_0117059 3300046454 Bacteria 1880
338 Ga0495641_0019823 3300046461 Bacteria 3429
339 Ga0495582_0039765 3300046473 Bacteria 2589
340 Ga0495582_0355942 3300046473 Bacteria 843
341 Ga0495662_0004542 3300046476 Bacteria 6961
342 Ga0495664_0055490 3300046477 Bacteria 2357
343 Ga0495618_0007658 3300046514 Bacteria 6531
344 Ga0495618_0282626 3300046514 Bacteria 1035
345 Ga0495628_0000140 3300046516 Bacteria 62202
346 Ga0495628_0114496 3300046516 Bacteria 2072
347 Ga0495628_0294987 3300046516 Bacteria 1201
348 Ga0495630_0000022 3300046517 Bacteria 172932
349 Ga0495630_0021741 3300046517 Bacteria 4737
350 Ga0495630_0066878 3300046517 Bacteria 2702
351 Ga0495630_0188291 3300046517 Bacteria 1574
352 Ga0495630_0191527 3300046517 Bacteria 1560
353 Ga0495630_0199907 3300046517 Bacteria 1525
354 Ga0495630_0223113 3300046517 Bacteria 1439
355 Ga0495630_0299007 3300046517 Bacteria 1230
356 Ga0495630_0403500 3300046517 Bacteria 1047
357 Ga0495666_0043760 3300046526 Bacteria 2162
358 Ga0495666_0204264 3300046526 Bacteria 908
359 Ga0495665_0111443 3300046531 Bacteria 1435
360 Ga0495640_0018113 3300046533 Bacteria 5233
361 Ga0495640_0394317 3300046533 Bacteria 850
362 Ga0495586_0000010 3300046535 Bacteria 143135
363 Ga0495586_0000942 3300046535 Bacteria 16500
364 Ga0495586_0008130 3300046535 Bacteria 5593
365 Ga0495586_0040090 3300046535 Bacteria 2518
366 Ga0495586_0222177 3300046535 Bacteria 1074
367 Ga0495587_0106327 3300046536 Bacteria 1614
368 Ga0495587_0140983 3300046536 Bacteria 1376
369 Ga0495645_0002009 3300046543 Bacteria 13855
370 Ga0495645_0105552 3300046543 Bacteria 1999
371 Ga0495622_0037836 3300046557 Bacteria 2247
372 Ga0495667_0032330 3300046559 Bacteria 3507
373 Ga0495667_0127873 3300046559 Bacteria 1639
374 Ga0495667_0169903 3300046559 Bacteria 1401
375 Ga0495634_0006447 3300046642 Bacteria 8915
376 Ga0495634_0035656 3300046642 Bacteria 3405
377 Ga0495634_0046148 3300046642 Bacteria 2942
378 Ga0495634_0162614 3300046642 Bacteria 1407
379 Ga0495635_0132791 3300046663 Bacteria 1697
380 Ga0495599_0037695 3300046678 Bacteria 3037
381 Ga0495599_0061823 3300046678 Bacteria 2339
382 Ga0495599_0160989 3300046678 Bacteria 1387
383 Ga0495646_0403706 3300046680 Bacteria 710
384 Ga0495647_0005636 3300046681 Bacteria 4113
385 Ga0495647_0033043 3300046681 Bacteria 1932
386 Ga0495647_0052559 3300046681 Bacteria 1587
387 Ga0495658_0003253 3300046683 Bacteria 8076
388 Ga0495658_0023804 3300046683 Bacteria 3254
389 Ga0495658_0043055 3300046683 Bacteria 2523
390 Ga0495658_0157652 3300046683 Bacteria 1398
391 Ga0495613_0153542 3300046689 Bacteria 1641
392 Ga0495613_0164444 3300046689 Bacteria 1577
393 Ga0495613_0393601 3300046689 Unclassified 946
394 Ga0495624_0039744 3300046690 Bacteria 3015
395 Ga0495624_0138185 3300046690 Bacteria 1493
396 Ga0495674_0000992 3300047319 Bacteria 27284
397 Ga0495674_0008677 3300047319 Bacteria 9666
398 Ga0495674_0109181 3300047319 Bacteria 2347
399 Ga0495674_0531651 3300047319 Bacteria 938
400 Ga0495676_0029339 3300047321 Bacteria 4685
401 Ga0495680_0005121 3300047322 Bacteria 12378
402 Ga0495680_0261117 3300047322 Bacteria 1225
403 Ga0495683_0106745 3300047323 Bacteria 1341
404 Ga0495675_0086306 3300047444 Bacteria 1973
405 Ga0495684_0312572 3300047471 Bacteria 1125
406 Ga0495614_0297510 3300048089 Unclassified 745
407 Ga0496107_0038808 3300048910 Bacteria 3415
408 Ga0496115_0021650 3300048918 Bacteria 4968
409 Ga0496121_0209965 3300048924 Bacteria 1380
410 Ga0501308_000610 3300049128 Bacteria 2433
411 Ga0501309_009706 3300049129 Bacteria 1232
412 Ga0501309_026499 3300049129 Bacteria 837
413 Ga0501310_004066 3300049130 Bacteria 1454
414 Ga0501305_003444 3300049161 Bacteria 1791
415 Ga0501307_011434 3300049162 Bacteria 1042
416 Ga0501311_012083 3300049527 Bacteria 1072
417 Ga0501312_002052 3300049528 Bacteria 2115
418 Ga0501314_010276 3300049530 Bacteria 870
419 Ga0501317_005132 3300049533 Bacteria 1393
420 Ga0501031_0000229 3300049568 Bacteria 31986
421 Ga0501032_0025533 3300049569 Bacteria 4072
422 Ga0501032_0027127 3300049569 Bacteria 3938
423 Ga0501033_0004135 3300049570 Bacteria 11687
424 Ga0501033_0029907 3300049570 Bacteria 4094
425 Ga0501033_0291541 3300049570 Bacteria 1150
426 Ga0501034_0220726 3300049571 Bacteria 1848
427 Ga0501034_0238599 3300049571 Bacteria 1765
428 Ga0501037_0223617 3300049573 Bacteria 1323
429 Ga0501217_032592 3300049661 Bacteria 1290
430 Ga0501080_0112660 3300049742 Bacteria 2522
431 Ga0501083_0123131 3300049744 Bacteria 1700
432 Ga0501035_0022917 3300049822 Bacteria 5733
433 Ga0501035_0042376 3300049822 Bacteria 4105
434 Ga0501035_0496021 3300049822 Bacteria 1005
435 Ga0501044_0001696 3300049823 Bacteria 25845
436 Ga0501044_0010340 3300049823 Bacteria 10130
437 Ga0501044_0200874 3300049823 Bacteria 1952
438 nmdc:mga0k408_180008_c1 3300050493 Bacteria 1261
439 nmdc:mga09592_179157_c1 3300050508 Bacteria 1833
440 nmdc:mga06r32_44550_c1 3300050510 Bacteria 4225
441 nmdc:mga06r32_467361_c1 3300050510 Bacteria 1240
442 nmdc:mga08y16_11198_c1 3300050511 Bacteria 9420
443 nmdc:mga08y16_160700_c1 3300050511 Bacteria 2334
444 nmdc:mga08y16_327462_c1 3300050511 Bacteria 1576
445 nmdc:mga08y16_360700_c1 3300050511 Bacteria 1492
446 nmdc:mga08y16_535552_c1 3300050511 Bacteria 1186
447 nmdc:mga08y16_67370_c1 3300050511 Bacteria 3734
448 nmdc:mga08x19_106664_c1 3300050514 Bacteria 1864
449 Ga0500650_0003182 3300053098 Bacteria 5637
450 Ga0500555_000022 3300053103 Bacteria 157445
451 Ga0500616_0014131 3300053153 Bacteria 4599
452 Ga0500636_0154770 3300053177 Bacteria 1256
453 Ga0587070_011658 3300059491 Bacteria 1320
454 Ga0587080_017768 3300059503 Bacteria 1136
455 Ga0587067_022213 3300059640 Bacteria 1102
456 2787435659 2786546517 Bacteria 6614109
457 Ga0070689_100001105
458 Ga0058861_12055730
459 Ga0070658_10038544
460 Ga0070658_10846499
461 Ga0070676_10494941
462 Ga0070690_100002343
463 Ga0070690_100152237
464 Ga0070670_100142016
465 Ga0070670_100234322
466 Ga0068868_100348883
467 Ga0070689_100023540
468 Ga0070689_100459060
469 Ga0070689_100563151
470 Ga0070689_100625917
471 Ga0070687_100168920
472 Ga0070668_100143988
473 Ga0070675_100126864
474 Ga0070675_100815190
475 Ga0070688_100030103
476 Ga0070688_100083409
477 Ga0070688_100658076
478 Ga0070667_100357454
479 Ga0070713_100262319
480 Ga0070713_100326864
481 Ga0070701_10002782
482 Ga0070701_10351199
483 Ga0070711_100009588
484 Ga0070705_100084927
485 Ga0070700_100546365
486 Ga0070708_100220131
487 Ga0070681_10117944
488 Ga0070681_10239429
489 Ga0070685_10039195
490 Ga0070679_100205627
491 Ga0070679_100399816
492 Ga0070686_100005306
493 Ga0070686_100541676
494 Ga0070704_100031808
495 Ga0068855_100098533
496 Ga0068855_100205062
497 Ga0068855_100247431
498 Ga0068855_100303284
499 Ga0068857_100000314
500 Ga0068857_100091911
501 Ga0068857_100510374
502 Ga0068856_100000641
503 Ga0068856_100071629
504 Ga0068856_100154035
505 Ga0068859_100089231
506 Ga0068859_100329771
507 Ga0068864_100039557
508 Ga0068864_100136345
509 Ga0068864_100395663
510 Ga0068864_100967162
511 Ga0068863_100002752
512 Ga0068863_100112083
513 Ga0068863_100544140
514 Ga0068863_100554125
515 Ga0068858_100328122
516 Ga0068858_100496451
517 Ga0068858_100966158
518 Ga0070717_10953892
519 Ga0075363_100159653
520 Ga0070715_10291600
521 Ga0070712_100550418
522 Ga0075366_10140343
523 Ga0097621_100100323
524 Ga0097621_100143197
525 Ga0097621_100264768
526 Ga0097621_100406797
527 Ga0068871_100005071
528 Ga0068871_100245356
529 Ga0075428_100012485
530 Ga0075428_100145194
531 Ga0075428_100511307
532 Ga0075431_100045285
533 Ga0075429_100163751
534 Ga0075436_100224566
535 Ga0097620_100089233
536 Ga0097620_100329756
537 Ga0105240_10002950
538 Ga0105240_10061220
539 Ga0105240_10112418
540 Ga0105240_10630149
541 Ga0111539_10012384
542 Ga0111539_10096763
543 Ga0111539_10157066
544 Ga0111539_10199111
545 Ga0111539_10360705
546 Ga0111539_10362553
547 Ga0105241_10625625
548 Ga0105248_10361523
549 Ga0105248_10728979
550 Ga0105238_10035176
551 Ga0105238_10064489
552 Ga0105238_10278104
553 Ga0105249_10197216
554 Ga0105249_10386969
555 Ga0157371_10224899
556 Ga0157370_10328423
557 Ga0157374_10237474
558 Ga0157374_10773453
559 Ga0163162_10313887
560 Ga0163162_10326750
561 Ga0157372_10242435
562 Ga0157372_10420636
563 Ga0157375_10000016
564 Ga0157375_10790890
565 Ga0163163_10000130
566 Ga0163163_10284621
567 Ga0163163_10487555
568 Ga0206352_10324391
569 Ga0206352_11309314
570 Ga0209050_1000212
571 Ga0207685_10164284
572 Ga0207705_10588053
573 Ga0207707_10309811
574 Ga0207695_10043377
575 Ga0207695_10050094
576 Ga0207695_10205050
577 Ga0207695_10418482
578 Ga0207663_10009428
579 Ga0207657_10127159
580 Ga0207652_10308906
581 Ga0207694_10020359
582 Ga0207694_10030076
583 Ga0207694_10348563
584 Ga0207650_10076590
585 Ga0207659_10160768
586 Ga0207659_10451415
587 Ga0207700_10197682
588 Ga0207664_10014961
589 Ga0207670_10002276
590 Ga0207670_10027186
591 Ga0207670_10027396
592 Ga0207670_10040222
593 Ga0207670_10306299
594 Ga0207670_10514149
595 Ga0207691_10450973
596 Ga0207711_10225843
597 Ga0207667_10097416
598 Ga0207667_10117627
599 Ga0207667_10157547
600 Ga0207651_10285519
601 Ga0207703_10030262
602 Ga0207703_10349680
603 Ga0207708_10078302
604 Ga0207702_10002532
605 Ga0207702_10201626
606 Ga0207702_10615108
607 Ga0207641_10256580
608 Ga0207641_10680976
609 Ga0207648_10217040
610 Ga0207674_10014586
611 Ga0207674_10111751
612 Ga0207674_10143260
613 Ga0207698_10221931
614 Ga0207428_10235704
615 Ga0268265_10148866
616 Ga0268265_10520920
617 Ga0265337_1000229
618 Ga0265337_1000970
619 Ga0265337_1002027
620 Ga0265337_1027333
621 Ga0265337_1066757
622 Ga0265326_10003823
623 Ga0265326_10010042
624 Ga0265326_10057634
625 Ga0265319_1000019
626 Ga0265319_1008100
627 Ga0265334_10068431
628 Ga0265334_10085184
629 Ga0265334_10100953
630 Ga0265318_10027779
631 Ga0265323_10000417
632 Ga0265323_10008406
633 Ga0265323_10020972
634 Ga0265323_10051176
635 Ga0265322_10011183
636 Ga0265336_10017444
637 Ga0265336_10020180
638 Ga0265336_10021674
639 Ga0265338_10000030
640 Ga0265338_10000780
641 Ga0265338_10000987
642 Ga0265338_10004601
643 Ga0265338_10006533
644 Ga0265338_10008265
645 Ga0265338_10012654
646 Ga0265338_10013914
647 Ga0265338_10013920
648 Ga0265338_10015221
649 Ga0265338_10020800
650 Ga0265338_10022019
651 Ga0265338_10022274
652 Ga0265338_10033305
653 Ga0265338_10052895
654 Ga0265338_10056827
655 Ga0265338_10156876
656 Ga0265338_10176641
657 Ga0265338_10179185
658 Ga0265338_10207234
659 Ga0265338_10207408
660 Ga0265338_10219591
661 Ga0265338_10270964
662 Ga0265338_10355418
663 Ga0265324_10001435
664 Ga0265324_10001945
665 Ga0265324_10007514
666 Ga0265324_10014532
667 Ga0265324_10060873
668 Ga0265324_10063069
669 Ga0265330_10013828
670 Ga0265330_10248420
671 Ga0265332_10092285
672 Ga0265328_10021918
673 Ga0265320_10000792
674 Ga0265320_10011788
675 Ga0265320_10033671
676 Ga0265320_10049581
677 Ga0265320_10141783
678 Ga0265320_10206555
679 Ga0265325_10048433
680 Ga0265325_10059088
681 Ga0265325_10094253
682 Ga0265329_10003820
683 Ga0265340_10001882
684 Ga0265340_10034214
685 Ga0265340_10140928
686 Ga0265340_10173340
687 Ga0265339_10005066
688 Ga0265339_10018742
689 Ga0265331_10032119
690 Ga0265331_10132573
691 Ga0265327_10000005
692 Ga0265327_10002732
693 Ga0265327_10012586
694 Ga0265327_10033624
695 Ga0265327_10072287
696 Ga0265316_10001873
697 Ga0265316_10030917
698 Ga0265316_10031247
699 Ga0265316_10141589
700 Ga0265316_10159068
701 Ga0265316_10238190
702 Ga0265316_10550044
703 Ga0307408_100453410
704 Ga0265313_10000967
705 Ga0265313_10013640
706 Ga0265314_10000087
707 Ga0265314_10059631
708 Ga0265314_10070841
709 Ga0265314_10319898
710 Ga0265342_10068440
711 Ga0265342_10186684
712 Ga0307412_10165749
713 Ga0307414_10057144
714 Ga0316583_10061926
715 Ga0373938_0031526
716 Ga0373926_0015216
717 Ga0373929_0000280
718 Ga0373940_0128346
719 Ga0373944_0000297
720 Ga0373949_0000949
721 Ga0373949_0056397
722 Ga0373951_0030370
723 Ga0373932_0000009
724 Ga0373936_0118062
725 Ga0373945_0134238
726 Ga0373954_0001471
727 Ga0373954_0002140
728 Ga0373956_0271161
729 Ga0373960_0049790
730 Ga0373946_0052471
731 Ga0373962_0000011
732 Ga0316574_0036220
733 Ga0316574_0228176
734 Ga0316574_0362288
735 Ga0373931_0000030
736 Ga0373931_0215378
737 Ga0373931_0335574
738 Ga0373935_0064365
739 Ga0373935_0115509
740 Ga0373935_0201180
741 Ga0373927_0007553
742 Ga0373927_0078363
743 Ga0373927_0255472
744 Ga0373933_0114497
745 Ga0373947_0001855
746 Ga0373947_0223153
747 Ga0373937_0212650
748 Ga0373937_0663370
749 Ga0265778_001151
750 Ga0316582_0071725
751 Ga0316584_0252080
752 Ga0373925_0000423
753 Ga0373925_0005094
754 Ga0373925_0067045
755 Ga0373925_0217505
756 Ga0451798_0271669
757 Ga0451577_0006545
758 Ga0451577_0020815
759 Ga0451577_0042234
760 Ga0451577_0136316
761 Ga0451577_0141816
762 Ga0451577_0166999
763 Ga0451577_0175940
764 Ga0451577_0257709
765 Ga0451577_0269296
766 Ga0453684_0000516
767 Ga0453684_0003298
768 Ga0453684_0005150
769 Ga0453684_0018899
770 Ga0453684_0022847
771 Ga0453684_0146841
772 Ga0453684_0258266
773 Ga0453684_0298352
774 Ga0453684_0354038
775 Ga0453684_0407705
776 Ga0453684_0417833
777 Ga0466957_0646211
778 Ga0451576_0015000
779 Ga0451576_0096656
780 Ga0451576_0106982
781 Ga0451576_0133627
782 Ga0451576_0196668
783 Ga0451576_0217304
784 Ga0451576_0331094
785 Ga0451576_0397661
786 Ga0451576_0551165
787 Ga0451576_0571935
788 Ga0451576_0602774
789 Ga0451576_0683770
790 Ga0451576_1125794
791 Ga0495592_0000015
792 Ga0495592_0018446
793 Ga0495592_0117059
794 Ga0495641_0019823
795 Ga0495582_0039765
796 Ga0495582_0355942
797 Ga0495662_0004542
798 Ga0495664_0055490
799 Ga0495618_0007658
800 Ga0495618_0282626
801 Ga0495628_0000140
802 Ga0495628_0114496
803 Ga0495628_0294987
804 Ga0495630_0000022
805 Ga0495630_0021741
806 Ga0495630_0066878
807 Ga0495630_0188291
808 Ga0495630_0191527
809 Ga0495630_0199907
810 Ga0495630_0223113
811 Ga0495630_0299007
812 Ga0495630_0403500
813 Ga0495666_0043760
814 Ga0495666_0204264
815 Ga0495665_0111443
816 Ga0495640_0018113
817 Ga0495640_0394317
818 Ga0495586_0000010
819 Ga0495586_0000942
820 Ga0495586_0008130
821 Ga0495586_0040090
822 Ga0495586_0222177
823 Ga0495587_0106327
824 Ga0495587_0140983
825 Ga0495645_0002009
826 Ga0495645_0105552
827 Ga0495622_0037836
828 Ga0495667_0032330
829 Ga0495667_0127873
830 Ga0495667_0169903
831 Ga0495634_0006447
832 Ga0495634_0035656
833 Ga0495634_0046148
834 Ga0495634_0162614
835 Ga0495635_0132791
836 Ga0495599_0037695
837 Ga0495599_0061823
838 Ga0495599_0160989
839 Ga0495646_0403706
840 Ga0495647_0005636
841 Ga0495647_0033043
842 Ga0495647_0052559
843 Ga0495658_0003253
844 Ga0495658_0023804
845 Ga0495658_0043055
846 Ga0495658_0157652
847 Ga0495613_0153542
848 Ga0495613_0164444
849 Ga0495613_0393601
850 Ga0495624_0039744
851 Ga0495624_0138185
852 Ga0495674_0000992
853 Ga0495674_0008677
854 Ga0495674_0109181
855 Ga0495674_0531651
856 Ga0495676_0029339
857 Ga0495680_0005121
858 Ga0495680_0261117
859 Ga0495683_0106745
860 Ga0495675_0086306
861 Ga0495684_0312572
862 Ga0495614_0297510
863 Ga0496107_0038808
864 Ga0496115_0021650
865 Ga0496121_0209965
866 Ga0501308_000610
867 Ga0501309_009706
868 Ga0501309_026499
869 Ga0501310_004066
870 Ga0501305_003444
871 Ga0501307_011434
872 Ga0501311_012083
873 Ga0501312_002052
874 Ga0501314_010276
875 Ga0501317_005132
876 Ga0501031_0000229
877 Ga0501032_0025533
878 Ga0501032_0027127
879 Ga0501033_0004135
880 Ga0501033_0029907
881 Ga0501033_0291541
882 Ga0501034_0220726
883 Ga0501034_0238599
884 Ga0501037_0223617
885 Ga0501217_032592
886 Ga0501080_0112660
887 Ga0501083_0123131
888 Ga0501035_0022917
889 Ga0501035_0042376
890 Ga0501035_0496021
891 Ga0501044_0001696
892 Ga0501044_0010340
893 Ga0501044_0200874
894 nmdc:mga0k408_180008_c1
895 nmdc:mga09592_179157_c1
896 nmdc:mga06r32_44550_c1
897 nmdc:mga06r32_467361_c1
898 nmdc:mga08y16_11198_c1
899 nmdc:mga08y16_160700_c1
900 nmdc:mga08y16_327462_c1
901 nmdc:mga08y16_360700_c1
902 nmdc:mga08y16_535552_c1
903 nmdc:mga08y16_67370_c1
904 nmdc:mga08x19_106664_c1
905 Ga0500650_0003182
906 Ga0500555_000022
907 Ga0500616_0014131
908 Ga0500636_0154770
909 Ga0587070_011658
910 Ga0587080_017768
911 Ga0587067_022213
912 2787435659

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00687

Ribosomal_L1

Ribosomal protein L1p/L10e family

37

228

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vpl-assembly1.cif.gz_A the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii 0.9031 3 226
2ov7-assembly3.cif.gz_C the first domain of the ribosomal protein l1 from thermus thermophilus 0.8935 10 226
4wpo-assembly1.cif.gz_AC crystal structure of the thermus thermophilus 70s ribosome in complex with elongation factor g in the pre-translocational state 0.8894 3 224
7nhk-assembly1.cif.gz_F lsaa, an antibiotic resistance abcf, in complex with 70s ribosome from enterococcus faecalis 0.8848 8 224
6wdj-assembly1.cif.gz_a cryo-em of elongating ribosome with ef-tu*gtp elucidates trna proofreading (non-cognate structure v-a1) 0.8814 3 224
ID Description Score Start End Superfamily
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.8997 14 224 3.30.190.20
af_F1M9A4_157_229_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.8861 72 132 3.40.50.790
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.8859 71 158 3.40.50.790
af_Q60E59_194_280_3.40.50.790 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Ribosomal protein L1/L10, domain II 0.8764 71 158 3.40.50.790
2wrrC01 Alpha Beta;2-Layer Sandwich;Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase;Ribosomal protein L1/L10, rRNA-binding domain 0.8718 14 224 3.30.190.20
ID Description Score Start End GO Terms
AF-A0A4Q3XW15-F1-model_v4 deleted 0.8821 3 209
AF-A0A7C1DJ35-F1-model_v4 Large ribosomal subunit protein uL1 (50S ribosomal protein L1) 0.8819 59 229 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A660VFQ9-F1-model_v4 Large ribosomal subunit protein uL1 0.8568 1 225 GO:0000049
GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843
AF-A0A3Q7J4F8-F1-model_v4 Protein kinase domain-containing protein 0.8488 14 226 GO:0004672
GO:0004674
GO:0005524
GO:0005737
GO:0005840
GO:0007165
GO:1990904
AF-A0A1F4W0B7-F1-model_v4 Ribosomal protein 0.844 1 226 GO:0003735
GO:0006412
GO:0006417
GO:0015934
GO:0019843

Map