F447680

General Info

Members Datasets Scaffolds Average Seq Length
455 262 910 255

Family's Representative Sequence

Representative Sequence 3300053103|Ga0500555_000474|Ga0500555_000474_12080_12889
Length 269
Sequence MIVCKSPAELEKMLASSQLVAQVLEALRPLAVPGASTMDIDREAERLVRAAGALPAFKGYRGFPGTICSSINDEVIHGIPSSARRLREGDVLSIDMGVKLNGFYGDSAVTVAVGKIAPEAQRLLDVTQEALARAIAVVQVGARVSDIGHAVQQYVESHGYSVVREFVGHGVGSQLHEEPQVPNYGAPGRGPRLAPGMTLAIEPMVNVGKPAVKVLSDGWTAVTVDGSLSAHFEHTVAVMPEGPWVLTALPTPAGEAGVQGGHDAHEARA

Samples

Sample ID Description Type Environment
1 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
137 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
140 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
165 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
172 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
173 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
174 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
175 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
234 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
258 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 1.1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 4.62
Rhizosphere 81.76
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500555_000474 3300053103 Bacteria 16656
2 JGI24751J29686_10004662 3300002459 Bacteria 2784
3 Ga0058862_12881717 3300004803 Bacteria 2079
4 Ga0065712_10343385 3300005290 Bacteria 796
5 Ga0065715_10027643 3300005293 Bacteria 2514
6 Ga0065715_10351421 3300005293 Bacteria 950
7 Ga0070676_10050392 3300005328 Bacteria 2441
8 Ga0070690_100034257 3300005330 Bacteria 3182
9 Ga0070670_100002364 3300005331 Bacteria 15556
10 Ga0070677_10045095 3300005333 Bacteria 1757
11 Ga0068869_100089020 3300005334 Bacteria 2318
12 Ga0070666_10012151 3300005335 Bacteria 5425
13 Ga0070680_100245966 3300005336 Bacteria 1512
14 Ga0070680_100393115 3300005336 Bacteria 1181
15 Ga0070682_100177235 3300005337 Bacteria 1486
16 Ga0070660_100193750 3300005339 Unclassified 1647
17 Ga0070687_100120021 3300005343 Bacteria 1502
18 Ga0070661_100010629 3300005344 Bacteria 6405
19 Ga0070661_100062238 3300005344 Bacteria 2740
20 Ga0070661_100453163 3300005344 Bacteria 1021
21 Ga0070692_10046451 3300005345 Bacteria 2244
22 Ga0070668_100347903 3300005347 Bacteria 1254
23 Ga0070675_100071715 3300005354 Bacteria 2874
24 Ga0070671_100005340 3300005355 Bacteria 10243
25 Ga0070674_100000710 3300005356 Bacteria 16960
26 Ga0070673_100001729 3300005364 Bacteria 12983
27 Ga0070659_100050570 3300005366 Bacteria 3267
28 Ga0070659_100051083 3300005366 Bacteria 3250
29 Ga0070659_100173239 3300005366 Bacteria 1769
30 Ga0070667_100103000 3300005367 Bacteria 2467
31 Ga0070667_100116234 3300005367 Bacteria 2323
32 Ga0070703_10027279 3300005406 Bacteria 1701
33 Ga0070714_100041338 3300005435 Bacteria 3890
34 Ga0070705_100419008 3300005440 Bacteria 996
35 Ga0070700_100164779 3300005441 Bacteria 1529
36 Ga0070694_100066579 3300005444 Bacteria 2471
37 Ga0070708_100139547 3300005445 Bacteria 2247
38 Ga0070708_100339442 3300005445 Bacteria 1416
39 Ga0070663_100375941 3300005455 Bacteria 1156
40 Ga0070678_100001040 3300005456 Bacteria 14502
41 Ga0070678_100242486 3300005456 Bacteria 1508
42 Ga0070662_100021103 3300005457 Bacteria 4444
43 Ga0070681_10341446 3300005458 Bacteria 1407
44 Ga0068867_100504465 3300005459 Bacteria 1040
45 Ga0070706_100019360 3300005467 Bacteria 6278
46 Ga0070706_100383703 3300005467 Bacteria 1308
47 Ga0070706_100450034 3300005467 Bacteria 1198
48 Ga0070698_100633107 3300005471 Bacteria 1011
49 Ga0070699_100126045 3300005518 Bacteria 2254
50 Ga0070697_100067800 3300005536 Bacteria 2919
51 Ga0070697_100284756 3300005536 Bacteria 1418
52 Ga0070695_100300917 3300005545 Bacteria 1185
53 Ga0070696_100163664 3300005546 Bacteria 1640
54 Ga0070696_100199738 3300005546 Bacteria 1492
55 Ga0070665_100169170 3300005548 Bacteria 2187
56 Ga0070665_100175576 3300005548 Bacteria 2143
57 Ga0070704_100215701 3300005549 Bacteria 1557
58 Ga0070704_100224960 3300005549 Bacteria 1527
59 Ga0068855_100193400 3300005563 Bacteria 2293
60 Ga0068855_100203054 3300005563 Bacteria 2230
61 Ga0068855_100435012 3300005563 Unclassified 1433
62 Ga0068855_100573583 3300005563 Bacteria 1219
63 Ga0070664_100156606 3300005564 Bacteria 2013
64 Ga0070664_100588418 3300005564 Bacteria 1031
65 Ga0068857_100583720 3300005577 Bacteria 1055
66 Ga0068856_100042412 3300005614 Bacteria 4476
67 Ga0068852_100333156 3300005616 Unclassified 1477
68 Ga0068859_100029403 3300005617 Bacteria 5513
69 Ga0068859_100121516 3300005617 Bacteria 2678
70 Ga0068866_10230005 3300005718 Bacteria 1124
71 Ga0068861_100080974 3300005719 Bacteria 2541
72 Ga0068861_100273754 3300005719 Bacteria 1451
73 Ga0068860_100467233 3300005843 Bacteria 1256
74 Ga0068862_100521678 3300005844 Bacteria 1130
75 Ga0081455_10017775 3300005937 Bacteria 6802
76 Ga0070717_10021534 3300006028 Bacteria 5081
77 Ga0070717_10168364 3300006028 Bacteria 1904
78 Ga0075368_10058900 3300006042 Bacteria 1536
79 Ga0075364_10028785 3300006051 Bacteria 3558
80 Ga0075364_10067018 3300006051 Bacteria 2359
81 Ga0075362_10000151 3300006177 Bacteria 18803
82 Ga0075367_10078763 3300006178 Bacteria 1991
83 Ga0075366_10015745 3300006195 Bacteria 4341
84 Ga0075366_10045195 3300006195 Bacteria 2610
85 Ga0075366_10067297 3300006195 Bacteria 2131
86 Ga0097621_100005563 3300006237 Bacteria 8883
87 Ga0068871_100022863 3300006358 Bacteria 4826
88 Ga0068871_100085533 3300006358 Bacteria 2619
89 Ga0075431_100035990 3300006847 Bacteria 5099
90 Ga0075431_100074552 3300006847 Bacteria 3501
91 Ga0075431_100691525 3300006847 Unclassified 998
92 Ga0075433_10058849 3300006852 Bacteria 3362
93 Ga0075429_100014670 3300006880 Bacteria 6794
94 Ga0075429_100582490 3300006880 Bacteria 980
95 Ga0068865_100124349 3300006881 Bacteria 1923
96 Ga0097620_100029403 3300006931 Bacteria 5513
97 Ga0097620_100121510 3300006931 Bacteria 2678
98 Ga0105240_10256804 3300009093 Bacteria 2018
99 Ga0111539_10000563 3300009094 Bacteria 47501
100 Ga0111539_10000976 3300009094 Bacteria 37564
101 Ga0114129_10008147 3300009147 Bacteria 14937
102 Ga0114129_10021566 3300009147 Bacteria 9144
103 Ga0114129_10033019 3300009147 Bacteria 7313
104 Ga0114129_10060232 3300009147 Bacteria 5308
105 Ga0114129_10260677 3300009147 Bacteria 2324
106 Ga0105243_10255561 3300009148 Bacteria 1566
107 Ga0105243_10574009 3300009148 Bacteria 1081
108 Ga0105242_10210074 3300009176 Bacteria 1734
109 Ga0105248_10459786 3300009177 Bacteria 1435
110 Ga0105248_10465033 3300009177 Bacteria 1426
111 Ga0105238_10047507 3300009551 Bacteria 4327
112 Ga0105246_10589635 3300011119 Bacteria 959
113 Ga0157371_10057666 3300013102 Bacteria 2754
114 Ga0157370_10606790 3300013104 Bacteria 1002
115 Ga0157369_10004638 3300013105 Bacteria 16148
116 Ga0157369_10058822 3300013105 Bacteria 4145
117 Ga0157374_10001458 3300013296 Bacteria 20000
118 Ga0157374_10014343 3300013296 Bacteria 6935
119 Ga0157374_10077775 3300013296 Bacteria 3141
120 Ga0157378_10001809 3300013297 Bacteria 19202
121 Ga0157378_10024572 3300013297 Bacteria 5304
122 Ga0157372_10587262 3300013307 Bacteria 1298
123 Ga0157375_10001658 3300013308 Bacteria 19148
124 Ga0157375_10240838 3300013308 Bacteria 1969
125 Ga0157375_10667917 3300013308 Bacteria 1194
126 Ga0163163_10000013 3300014325 Bacteria 242522
127 Ga0157380_10131610 3300014326 Bacteria 2135
128 Ga0157377_10242247 3300014745 Bacteria 1165
129 Ga0157379_10267805 3300014968 Bacteria 1553
130 Ga0157376_10012718 3300014969 Bacteria 6258
131 Ga0197907_10844407 3300020069 Bacteria 1328
132 Ga0206355_1280609 3300020076 Bacteria 1340
133 Ga0206350_11407233 3300020080 Bacteria 1093
134 Ga0213872_10002663 3300021361 Bacteria 10341
135 Ga0213874_10006770 3300021377 Bacteria 2725
136 Ga0213876_10000941 3300021384 Bacteria 19201
137 Ga0213876_10004016 3300021384 Bacteria 8279
138 Ga0213876_10024716 3300021384 Bacteria 3171
139 Ga0213876_10050477 3300021384 Bacteria 2198
140 Ga0213876_10236526 3300021384 Bacteria 971
141 Ga0213875_10000015 3300021388 Bacteria 280499
142 Ga0213875_10000208 3300021388 Bacteria 59796
143 Ga0213875_10002808 3300021388 Bacteria 10247
144 Ga0213875_10003963 3300021388 Bacteria 8257
145 Ga0213875_10018284 3300021388 Bacteria 3380
146 Ga0213875_10028142 3300021388 Bacteria 2672
147 Ga0207653_10000471 3300025885 Bacteria 16033
148 Ga0207680_10005943 3300025903 Bacteria 5866
149 Ga0207645_10045251 3300025907 Bacteria 2813
150 Ga0207684_10000249 3300025910 Bacteria 80711
151 Ga0207684_10381962 3300025910 Bacteria 1211
152 Ga0207707_10069028 3300025912 Bacteria 3080
153 Ga0207707_10249988 3300025912 Bacteria 1540
154 Ga0207695_10020062 3300025913 Bacteria 7670
155 Ga0207695_10341450 3300025913 Bacteria 1385
156 Ga0207663_10146014 3300025916 Bacteria 1654
157 Ga0207660_10205922 3300025917 Bacteria 1538
158 Ga0207662_10014402 3300025918 Bacteria 4437
159 Ga0207657_10195381 3300025919 Bacteria 1630
160 Ga0207649_10029759 3300025920 Bacteria 3228
161 Ga0207646_10000805 3300025922 Bacteria 40866
162 Ga0207659_10172835 3300025926 Bacteria 1706
163 Ga0207659_10175126 3300025926 Bacteria 1695
164 Ga0207700_10087240 3300025928 Bacteria 2454
165 Ga0207664_10043915 3300025929 Bacteria 3498
166 Ga0207664_10598354 3300025929 Bacteria 990
167 Ga0207644_10028859 3300025931 Bacteria 3845
168 Ga0207690_10109409 3300025932 Bacteria 1988
169 Ga0207690_10134929 3300025932 Bacteria 1811
170 Ga0207709_10392077 3300025935 Bacteria 1059
171 Ga0207669_10012304 3300025937 Bacteria 4202
172 Ga0207704_10047790 3300025938 Bacteria 2561
173 Ga0207704_10238338 3300025938 Bacteria 1357
174 Ga0207691_10000071 3300025940 Bacteria 83980
175 Ga0207711_10109227 3300025941 Bacteria 2458
176 Ga0207711_10286144 3300025941 Bacteria 1519
177 Ga0207679_10197793 3300025945 Bacteria 1677
178 Ga0207679_10551837 3300025945 Bacteria 1034
179 Ga0207667_10410601 3300025949 Bacteria 1378
180 Ga0207667_10459880 3300025949 Bacteria 1293
181 Ga0207667_10469724 3300025949 Bacteria 1277
182 Ga0207651_10000475 3300025960 Bacteria 16868
183 Ga0207712_10079729 3300025961 Bacteria 2379
184 Ga0207668_10087031 3300025972 Bacteria 2284
185 Ga0207668_10196136 3300025972 Bacteria 1604
186 Ga0207658_10426770 3300025986 Bacteria 1170
187 Ga0207677_10033745 3300026023 Bacteria 3305
188 Ga0207639_10063620 3300026041 Bacteria 2858
189 Ga0207678_10051608 3300026067 Bacteria 3550
190 Ga0207678_10154296 3300026067 Bacteria 1961
191 Ga0207702_10079214 3300026078 Bacteria 2847
192 Ga0207702_10111444 3300026078 Bacteria 2433
193 Ga0207648_10111599 3300026089 Bacteria 2401
194 Ga0207648_10123444 3300026089 Bacteria 2277
195 Ga0207648_10432172 3300026089 Bacteria 1197
196 Ga0207676_10180950 3300026095 Bacteria 1846
197 Ga0207675_100145336 3300026118 Bacteria 2254
198 Ga0207683_10001362 3300026121 Bacteria 22103
199 Ga0207683_10154632 3300026121 Bacteria 2071
200 Ga0209813_10047119 3300027866 Bacteria 1334
201 Ga0207428_10013389 3300027907 Bacteria 7167
202 Ga0207428_10023094 3300027907 Bacteria 5235
203 Ga0268266_10165165 3300028379 Bacteria 2005
204 Ga0268265_10074131 3300028380 Bacteria 2661
205 Ga0268264_10236082 3300028381 Bacteria 1691
206 Ga0265338_10010133 3300028800 Bacteria 11121
207 Ga0265765_1003869 3300030879 Bacteria 1518
208 Ga0265330_10000095 3300031235 Bacteria 74593
209 Ga0265330_10021280 3300031235 Bacteria 2962
210 Ga0265330_10027438 3300031235 Bacteria 2572
211 Ga0265332_10000091 3300031238 Bacteria 79169
212 Ga0265332_10000222 3300031238 Bacteria 45648
213 Ga0265328_10001444 3300031239 Bacteria 10939
214 Ga0265328_10022244 3300031239 Unclassified 2414
215 Ga0265320_10005860 3300031240 Bacteria 7823
216 Ga0265325_10100013 3300031241 Bacteria 1421
217 Ga0265329_10005084 3300031242 Bacteria 5366
218 Ga0265329_10024978 3300031242 Bacteria 1980
219 Ga0265339_10013550 3300031249 Bacteria 4938
220 Ga0265331_10000018 3300031250 Bacteria 264804
221 Ga0265331_10068572 3300031250 Unclassified 1662
222 Ga0265316_10000221 3300031344 Bacteria 66632
223 Ga0265316_10000450 3300031344 Bacteria 46576
224 Ga0307408_100271217 3300031548 Bacteria 1409
225 Ga0307508_10020177 3300031616 Bacteria 6053
226 Ga0265314_10000076 3300031711 Bacteria 146266
227 Ga0265314_10000116 3300031711 Bacteria 123252
228 Ga0265314_10297166 3300031711 Bacteria 907
229 Ga0265342_10000759 3300031712 Bacteria 32969
230 Ga0265342_10007794 3300031712 Bacteria 7786
231 Ga0307412_10433778 3300031911 Bacteria 1078
232 Ga0307409_100116710 3300031995 Bacteria 2251
233 Ga0307416_100469857 3300032002 Bacteria 1315
234 Ga0307411_10027543 3300032005 Bacteria 3441
235 Ga0307415_100078080 3300032126 Bacteria 2354
236 Ga0373934_0022245 3300035086 Bacteria 2445
237 Ga0373954_0236309 3300035118 Bacteria 899
238 Ga0373957_0027314 3300035120 Bacteria 2073
239 Ga0373955_0046060 3300035172 Bacteria 2356
240 Ga0373935_0030288 3300035692 Bacteria 3353
241 Ga0373933_0007088 3300035724 Bacteria 6107
242 Ga0373933_0014154 3300035724 Bacteria 4430
243 Ga0373947_0143463 3300035725 Bacteria 1533
244 Ga0373947_0148380 3300035725 Bacteria 1509
245 Ga0373947_0254592 3300035725 Bacteria 1162
246 Ga0373937_0000078 3300036401 Bacteria 88688
247 Ga0373937_0000238 3300036401 Bacteria 53880
248 Ga0373937_0618322 3300036401 Bacteria 1028
249 Ga0436364_0061901 3300037853 Bacteria 2237
250 Ga0436364_0127058 3300037853 Bacteria 5715
251 Ga0436364_0184852 3300037853 Unclassified 748
252 Ga0436364_0242495 3300037853 Bacteria 1630
253 Ga0436364_0295555 3300037853 Bacteria 2792
254 Ga0436364_0370837 3300037853 Bacteria 1761
255 Ga0436364_0375294 3300037853 Bacteria 4538
256 Ga0436364_0450922 3300037853 Bacteria 5310
257 Ga0436364_0473330 3300037853 Bacteria 2162
258 Ga0436364_0524180 3300037853 Bacteria 6467
259 Ga0436364_0529458 3300037853 Bacteria 5764
260 Ga0436364_0590649 3300037853 Bacteria 6104
261 Ga0436364_0714540 3300037853 Bacteria 1911
262 Ga0436364_1113127 3300037853 Bacteria 158393
263 Ga0436364_1121262 3300037853 Bacteria 32436
264 Ga0436364_1170510 3300037853 Bacteria 4266
265 Ga0436364_1546209 3300037853 Bacteria 11305
266 Ga0400489_12624 3300039093 Bacteria 13561
267 Ga0436365_0308639 3300039437 Bacteria 1510
268 Ga0436365_0429460 3300039437 Bacteria 759
269 Ga0436365_0668306 3300039437 Bacteria 3562
270 Ga0436365_0890233 3300039437 Bacteria 9662
271 Ga0436365_1206851 3300039437 Bacteria 4229
272 Ga0436365_1262762 3300039437 Bacteria 8818
273 Ga0436365_1420032 3300039437 Bacteria 1446
274 Ga0436365_1709979 3300039437 Bacteria 1873
275 Ga0436365_1724929 3300039437 Bacteria 3992
276 Ga0436365_1750545 3300039437 Bacteria 1651
277 Ga0436360_0443083 3300039438 Bacteria 1681
278 Ga0436360_0866726 3300039438 Bacteria 1076
279 Ga0436360_0873464 3300039438 Bacteria 1061
280 Ga0436361_0346817 3300039447 Bacteria 1636
281 Ga0436361_0938053 3300039447 Bacteria 8083
282 Ga0436361_1219030 3300039447 Bacteria 1002
283 Ga0436363_0244824 3300039450 Bacteria 1126
284 Ga0436363_0973048 3300039450 Bacteria 5253
285 Ga0436363_1684757 3300039450 Bacteria 16063
286 Ga0436362_0697743 3300039453 Bacteria 1229
287 Ga0436362_0867947 3300039453 Bacteria 932
288 Ga0436362_0997651 3300039453 Bacteria 4053
289 Ga0439436_0053767 3300041404 Bacteria 1134
290 Ga0439439_0017156 3300041406 Bacteria 1778
291 Ga0451807_1520671 3300041486 Bacteria 930
292 Ga0439460_0008818 3300042461 Bacteria 2550
293 Ga0439460_0116790 3300042461 Bacteria 870
294 Ga0451577_0006363 3300042876 Bacteria 11795
295 Ga0451577_0012676 3300042876 Bacteria 7910
296 Ga0466969_0006492 3300044656 Bacteria 6224
297 Ga0453683_0347422 3300044673 Bacteria 953
298 Ga0466963_0334717 3300044694 Bacteria 1066
299 Ga0453684_0002578 3300044712 Bacteria 43409
300 Ga0453684_0205842 3300044712 Bacteria 2290
301 Ga0453684_0385959 3300044712 Unclassified 1572
302 Ga0466959_0079341 3300045049 Bacteria 2367
303 Ga0451576_0058767 3300045051 Bacteria 4016
304 Ga0451576_0401701 3300045051 Bacteria 1437
305 Ga0451576_0639915 3300045051 Bacteria 1117
306 Ga0466967_0013058 3300045976 Bacteria 6395
307 Ga0495638_0081189 3300046460 Bacteria 1969
308 Ga0495651_0030115 3300046462 Bacteria 4232
309 Ga0495651_0108250 3300046462 Bacteria 2058
310 Ga0495653_0063946 3300046463 Bacteria 2774
311 Ga0495616_0168978 3300046513 Bacteria 979
312 Ga0495652_0054137 3300046529 Bacteria 3418
313 Ga0495587_0000380 3300046536 Bacteria 31666
314 Ga0495645_0085465 3300046543 Bacteria 2258
315 Ga0495599_0159349 3300046678 Bacteria 1395
316 Ga0495647_0160398 3300046681 Bacteria 969
317 Ga0495658_0155605 3300046683 Bacteria 1407
318 Ga0495613_0320759 3300046689 Bacteria 1069
319 Ga0495600_0320995 3300046809 Bacteria 974
320 Ga0495604_0083384 3300047317 Bacteria 2389
321 Ga0495672_0021450 3300047320 Bacteria 4214
322 Ga0495675_0005439 3300047444 Bacteria 7767
323 Ga0495684_0050094 3300047471 Bacteria 3190
324 Ga0495684_0167316 3300047471 Bacteria 1637
325 Ga0495602_0000613 3300048088 Bacteria 33515
326 Ga0496100_0009287 3300048903 Bacteria 5523
327 Ga0496100_0318521 3300048903 Bacteria 1168
328 Ga0496102_0002334 3300048905 Bacteria 16195
329 Ga0496103_0091191 3300048906 Bacteria 1923
330 Ga0496104_0009179 3300048907 Bacteria 8795
331 Ga0496104_0388225 3300048907 Bacteria 1308
332 Ga0496109_0093925 3300048912 Bacteria 2776
333 Ga0496109_0216871 3300048912 Bacteria 1799
334 Ga0496109_0359339 3300048912 Bacteria 1376
335 Ga0496110_0120140 3300048913 Bacteria 2367
336 Ga0496110_0515075 3300048913 Bacteria 1088
337 Ga0496112_0008575 3300048915 Bacteria 9163
338 Ga0496112_0021262 3300048915 Bacteria 6167
339 Ga0496112_0023788 3300048915 Bacteria 5860
340 Ga0496114_0000001 3300048917 Bacteria 893286
341 Ga0496114_0006018 3300048917 Bacteria 9547
342 Ga0496114_0036694 3300048917 Bacteria 4053
343 Ga0496114_0241593 3300048917 Bacteria 1588
344 Ga0496114_0562190 3300048917 Unclassified 1007
345 Ga0496115_0085367 3300048918 Bacteria 2575
346 Ga0501299_001676 3300049522 Bacteria 2922
347 Ga0501299_023005 3300049522 Bacteria 1153
348 Ga0501032_0009569 3300049569 Bacteria 7026
349 Ga0501032_0065141 3300049569 Bacteria 2438
350 Ga0501032_0402591 3300049569 Bacteria 879
351 Ga0501033_0027831 3300049570 Bacteria 4248
352 Ga0501033_0035198 3300049570 Bacteria 3755
353 Ga0501033_0044376 3300049570 Bacteria 3309
354 Ga0501033_0051910 3300049570 Bacteria 3039
355 Ga0501034_0006321 3300049571 Bacteria 12755
356 Ga0501034_0010656 3300049571 Bacteria 9554
357 Ga0501034_0018524 3300049571 Bacteria 7137
358 Ga0501034_0325697 3300049571 Bacteria 1468
359 Ga0501036_0011660 3300049572 Bacteria 7284
360 Ga0501036_0234787 3300049572 Bacteria 1538
361 Ga0501036_0327119 3300049572 Bacteria 1280
362 Ga0501037_0001323 3300049573 Bacteria 18182
363 Ga0501037_0432639 3300049573 Bacteria 899
364 Ga0501038_0000812 3300049574 Bacteria 27742
365 Ga0501038_0048108 3300049574 Bacteria 3692
366 Ga0501038_0057727 3300049574 Bacteria 3331
367 Ga0501039_0022803 3300049575 Bacteria 4802
368 Ga0501039_0115112 3300049575 Bacteria 2104
369 Ga0501040_0500027 3300049576 Bacteria 876
370 Ga0501042_0045229 3300049578 Bacteria 3137
371 Ga0501042_0390279 3300049578 Bacteria 1008
372 Ga0501043_0044451 3300049579 Bacteria 3492
373 Ga0501043_0071795 3300049579 Bacteria 2719
374 Ga0501046_0011472 3300049580 Bacteria 7572
375 Ga0501046_0033412 3300049580 Bacteria 4155
376 Ga0501046_0036782 3300049580 Bacteria 3938
377 Ga0501047_0003821 3300049581 Bacteria 14159
378 Ga0501047_0007192 3300049581 Bacteria 10461
379 Ga0501047_0172074 3300049581 Bacteria 2034
380 Ga0501047_0197461 3300049581 Bacteria 1873
381 Ga0501047_0449400 3300049581 Bacteria 1118
382 Ga0501048_0026892 3300049582 Bacteria 4186
383 Ga0501048_0073950 3300049582 Bacteria 2404
384 Ga0501048_0235333 3300049582 Bacteria 1299
385 Ga0501048_0319615 3300049582 Bacteria 1106
386 Ga0501048_0352882 3300049582 Bacteria 1049
387 Ga0501067_0000428 3300049583 Bacteria 22958
388 Ga0501067_0176099 3300049583 Bacteria 1191
389 Ga0501067_0266455 3300049583 Bacteria 954
390 Ga0501068_0100035 3300049584 Bacteria 1797
391 Ga0501069_0001595 3300049585 Bacteria 11218
392 Ga0501069_0018192 3300049585 Bacteria 3790
393 Ga0501069_0128877 3300049585 Bacteria 1448
394 Ga0501070_0006487 3300049586 Bacteria 9959
395 Ga0501070_0035566 3300049586 Bacteria 4161
396 Ga0501070_0133071 3300049586 Bacteria 2053
397 Ga0501071_0002536 3300049587 Bacteria 11118
398 Ga0501072_0059903 3300049588 Bacteria 3002
399 Ga0501073_0004894 3300049589 Bacteria 10051
400 Ga0501074_0005932 3300049590 Bacteria 8807
401 Ga0501074_0035555 3300049590 Bacteria 3609
402 Ga0501075_0042887 3300049591 Bacteria 3393
403 Ga0501075_0211826 3300049591 Bacteria 1478
404 Ga0501077_0015620 3300049593 Bacteria 4781
405 Ga0501227_000308 3300049665 Bacteria 10150
406 Ga0501230_000507 3300049667 Bacteria 3931
407 Ga0501233_007577 3300049668 Bacteria 2070
408 Ga0501235_038252 3300049669 Bacteria 1093
409 Ga0501236_014396 3300049670 Bacteria 1095
410 Ga0501079_0041011 3300049741 Bacteria 3572
411 Ga0501079_0062005 3300049741 Bacteria 2884
412 Ga0501079_0078441 3300049741 Bacteria 2554
413 Ga0501079_0148154 3300049741 Bacteria 1829
414 Ga0501080_0024542 3300049742 Bacteria 5589
415 Ga0501080_0309092 3300049742 Bacteria 1433
416 Ga0501081_0052541 3300049743 Bacteria 2813
417 Ga0501081_0165092 3300049743 Bacteria 1597
418 Ga0501081_0423701 3300049743 Bacteria 987
419 Ga0501081_0550441 3300049743 Bacteria 862
420 Ga0501083_0010888 3300049744 Bacteria 6398
421 Ga0501083_0117834 3300049744 Bacteria 1742
422 Ga0501035_0022892 3300049822 Bacteria 5737
423 Ga0501035_0056755 3300049822 Bacteria 3492
424 Ga0501035_0240743 3300049822 Bacteria 1539
425 Ga0501044_0003143 3300049823 Bacteria 18681
426 Ga0501044_0010929 3300049823 Bacteria 9853
427 Ga0501044_0017553 3300049823 Bacteria 7677
428 Ga0501044_0184066 3300049823 Bacteria 2054
429 Ga0501044_0228894 3300049823 Bacteria 1807
430 Ga0501045_0015202 3300049824 Bacteria 5463
431 nmdc:mga03683_1492_c1 3300050489 Bacteria 6697
432 nmdc:mga00v17_1497_c1 3300050491 Bacteria 12197
433 nmdc:mga0k408_6891_c1 3300050493 Bacteria 6065
434 nmdc:mga04h51_48621_c1 3300050495 Bacteria 1414
435 nmdc:mga05p37_10478_c1 3300050507 Bacteria 11001
436 nmdc:mga09592_48842_c1 3300050508 Bacteria 3568
437 nmdc:mga06r32_183251_c1 3300050510 Bacteria 2080
438 nmdc:mga06r32_28841_c1 3300050510 Bacteria 5195
439 nmdc:mga08y16_1680_c1 3300050511 Bacteria 19401
440 nmdc:mga08y16_202_c1 3300050511 Bacteria 53486
441 nmdc:mga08x19_209721_c1 3300050514 Bacteria 1337
442 nmdc:mga0a205_173265_c1 3300050515 Bacteria 2054
443 nmdc:mga0a205_7753_c1 3300050515 Bacteria 4152
444 Ga0495595_0235627 3300053084 Bacteria 915
445 Ga0495619_0536468 3300053085 Bacteria 803
446 Ga0500641_0001584 3300053096 Bacteria 8107
447 Ga0500628_005784 3300053129 Bacteria 2076
448 Ga0500616_0000173 3300053153 Bacteria 107646
449 Ga0500645_000077 3300053730 Bacteria 77326
450 Ga0501084_0045687 3300054114 Bacteria 3666
451 Ga0501084_0047521 3300054114 Bacteria 3594
452 Ga0501084_0164643 3300054114 Bacteria 1871
453 Ga0501084_0386818 3300054114 Bacteria 1182
454 Ga0501082_0027282 3300060353 Bacteria 4917
455 Ga0501082_0033480 3300060353 Bacteria 4434
456 Ga0500555_000474
457 JGI24751J29686_10004662
458 Ga0058862_12881717
459 Ga0065712_10343385
460 Ga0065715_10027643
461 Ga0065715_10351421
462 Ga0070676_10050392
463 Ga0070690_100034257
464 Ga0070670_100002364
465 Ga0070677_10045095
466 Ga0068869_100089020
467 Ga0070666_10012151
468 Ga0070680_100245966
469 Ga0070680_100393115
470 Ga0070682_100177235
471 Ga0070660_100193750
472 Ga0070687_100120021
473 Ga0070661_100010629
474 Ga0070661_100062238
475 Ga0070661_100453163
476 Ga0070692_10046451
477 Ga0070668_100347903
478 Ga0070675_100071715
479 Ga0070671_100005340
480 Ga0070674_100000710
481 Ga0070673_100001729
482 Ga0070659_100050570
483 Ga0070659_100051083
484 Ga0070659_100173239
485 Ga0070667_100103000
486 Ga0070667_100116234
487 Ga0070703_10027279
488 Ga0070714_100041338
489 Ga0070705_100419008
490 Ga0070700_100164779
491 Ga0070694_100066579
492 Ga0070708_100139547
493 Ga0070708_100339442
494 Ga0070663_100375941
495 Ga0070678_100001040
496 Ga0070678_100242486
497 Ga0070662_100021103
498 Ga0070681_10341446
499 Ga0068867_100504465
500 Ga0070706_100019360
501 Ga0070706_100383703
502 Ga0070706_100450034
503 Ga0070698_100633107
504 Ga0070699_100126045
505 Ga0070697_100067800
506 Ga0070697_100284756
507 Ga0070695_100300917
508 Ga0070696_100163664
509 Ga0070696_100199738
510 Ga0070665_100169170
511 Ga0070665_100175576
512 Ga0070704_100215701
513 Ga0070704_100224960
514 Ga0068855_100193400
515 Ga0068855_100203054
516 Ga0068855_100435012
517 Ga0068855_100573583
518 Ga0070664_100156606
519 Ga0070664_100588418
520 Ga0068857_100583720
521 Ga0068856_100042412
522 Ga0068852_100333156
523 Ga0068859_100029403
524 Ga0068859_100121516
525 Ga0068866_10230005
526 Ga0068861_100080974
527 Ga0068861_100273754
528 Ga0068860_100467233
529 Ga0068862_100521678
530 Ga0081455_10017775
531 Ga0070717_10021534
532 Ga0070717_10168364
533 Ga0075368_10058900
534 Ga0075364_10028785
535 Ga0075364_10067018
536 Ga0075362_10000151
537 Ga0075367_10078763
538 Ga0075366_10015745
539 Ga0075366_10045195
540 Ga0075366_10067297
541 Ga0097621_100005563
542 Ga0068871_100022863
543 Ga0068871_100085533
544 Ga0075431_100035990
545 Ga0075431_100074552
546 Ga0075431_100691525
547 Ga0075433_10058849
548 Ga0075429_100014670
549 Ga0075429_100582490
550 Ga0068865_100124349
551 Ga0097620_100029403
552 Ga0097620_100121510
553 Ga0105240_10256804
554 Ga0111539_10000563
555 Ga0111539_10000976
556 Ga0114129_10008147
557 Ga0114129_10021566
558 Ga0114129_10033019
559 Ga0114129_10060232
560 Ga0114129_10260677
561 Ga0105243_10255561
562 Ga0105243_10574009
563 Ga0105242_10210074
564 Ga0105248_10459786
565 Ga0105248_10465033
566 Ga0105238_10047507
567 Ga0105246_10589635
568 Ga0157371_10057666
569 Ga0157370_10606790
570 Ga0157369_10004638
571 Ga0157369_10058822
572 Ga0157374_10001458
573 Ga0157374_10014343
574 Ga0157374_10077775
575 Ga0157378_10001809
576 Ga0157378_10024572
577 Ga0157372_10587262
578 Ga0157375_10001658
579 Ga0157375_10240838
580 Ga0157375_10667917
581 Ga0163163_10000013
582 Ga0157380_10131610
583 Ga0157377_10242247
584 Ga0157379_10267805
585 Ga0157376_10012718
586 Ga0197907_10844407
587 Ga0206355_1280609
588 Ga0206350_11407233
589 Ga0213872_10002663
590 Ga0213874_10006770
591 Ga0213876_10000941
592 Ga0213876_10004016
593 Ga0213876_10024716
594 Ga0213876_10050477
595 Ga0213876_10236526
596 Ga0213875_10000015
597 Ga0213875_10000208
598 Ga0213875_10002808
599 Ga0213875_10003963
600 Ga0213875_10018284
601 Ga0213875_10028142
602 Ga0207653_10000471
603 Ga0207680_10005943
604 Ga0207645_10045251
605 Ga0207684_10000249
606 Ga0207684_10381962
607 Ga0207707_10069028
608 Ga0207707_10249988
609 Ga0207695_10020062
610 Ga0207695_10341450
611 Ga0207663_10146014
612 Ga0207660_10205922
613 Ga0207662_10014402
614 Ga0207657_10195381
615 Ga0207649_10029759
616 Ga0207646_10000805
617 Ga0207659_10172835
618 Ga0207659_10175126
619 Ga0207700_10087240
620 Ga0207664_10043915
621 Ga0207664_10598354
622 Ga0207644_10028859
623 Ga0207690_10109409
624 Ga0207690_10134929
625 Ga0207709_10392077
626 Ga0207669_10012304
627 Ga0207704_10047790
628 Ga0207704_10238338
629 Ga0207691_10000071
630 Ga0207711_10109227
631 Ga0207711_10286144
632 Ga0207679_10197793
633 Ga0207679_10551837
634 Ga0207667_10410601
635 Ga0207667_10459880
636 Ga0207667_10469724
637 Ga0207651_10000475
638 Ga0207712_10079729
639 Ga0207668_10087031
640 Ga0207668_10196136
641 Ga0207658_10426770
642 Ga0207677_10033745
643 Ga0207639_10063620
644 Ga0207678_10051608
645 Ga0207678_10154296
646 Ga0207702_10079214
647 Ga0207702_10111444
648 Ga0207648_10111599
649 Ga0207648_10123444
650 Ga0207648_10432172
651 Ga0207676_10180950
652 Ga0207675_100145336
653 Ga0207683_10001362
654 Ga0207683_10154632
655 Ga0209813_10047119
656 Ga0207428_10013389
657 Ga0207428_10023094
658 Ga0268266_10165165
659 Ga0268265_10074131
660 Ga0268264_10236082
661 Ga0265338_10010133
662 Ga0265765_1003869
663 Ga0265330_10000095
664 Ga0265330_10021280
665 Ga0265330_10027438
666 Ga0265332_10000091
667 Ga0265332_10000222
668 Ga0265328_10001444
669 Ga0265328_10022244
670 Ga0265320_10005860
671 Ga0265325_10100013
672 Ga0265329_10005084
673 Ga0265329_10024978
674 Ga0265339_10013550
675 Ga0265331_10000018
676 Ga0265331_10068572
677 Ga0265316_10000221
678 Ga0265316_10000450
679 Ga0307408_100271217
680 Ga0307508_10020177
681 Ga0265314_10000076
682 Ga0265314_10000116
683 Ga0265314_10297166
684 Ga0265342_10000759
685 Ga0265342_10007794
686 Ga0307412_10433778
687 Ga0307409_100116710
688 Ga0307416_100469857
689 Ga0307411_10027543
690 Ga0307415_100078080
691 Ga0373934_0022245
692 Ga0373954_0236309
693 Ga0373957_0027314
694 Ga0373955_0046060
695 Ga0373935_0030288
696 Ga0373933_0007088
697 Ga0373933_0014154
698 Ga0373947_0143463
699 Ga0373947_0148380
700 Ga0373947_0254592
701 Ga0373937_0000078
702 Ga0373937_0000238
703 Ga0373937_0618322
704 Ga0436364_0061901
705 Ga0436364_0127058
706 Ga0436364_0184852
707 Ga0436364_0242495
708 Ga0436364_0295555
709 Ga0436364_0370837
710 Ga0436364_0375294
711 Ga0436364_0450922
712 Ga0436364_0473330
713 Ga0436364_0524180
714 Ga0436364_0529458
715 Ga0436364_0590649
716 Ga0436364_0714540
717 Ga0436364_1113127
718 Ga0436364_1121262
719 Ga0436364_1170510
720 Ga0436364_1546209
721 Ga0400489_12624
722 Ga0436365_0308639
723 Ga0436365_0429460
724 Ga0436365_0668306
725 Ga0436365_0890233
726 Ga0436365_1206851
727 Ga0436365_1262762
728 Ga0436365_1420032
729 Ga0436365_1709979
730 Ga0436365_1724929
731 Ga0436365_1750545
732 Ga0436360_0443083
733 Ga0436360_0866726
734 Ga0436360_0873464
735 Ga0436361_0346817
736 Ga0436361_0938053
737 Ga0436361_1219030
738 Ga0436363_0244824
739 Ga0436363_0973048
740 Ga0436363_1684757
741 Ga0436362_0697743
742 Ga0436362_0867947
743 Ga0436362_0997651
744 Ga0439436_0053767
745 Ga0439439_0017156
746 Ga0451807_1520671
747 Ga0439460_0008818
748 Ga0439460_0116790
749 Ga0451577_0006363
750 Ga0451577_0012676
751 Ga0466969_0006492
752 Ga0453683_0347422
753 Ga0466963_0334717
754 Ga0453684_0002578
755 Ga0453684_0205842
756 Ga0453684_0385959
757 Ga0466959_0079341
758 Ga0451576_0058767
759 Ga0451576_0401701
760 Ga0451576_0639915
761 Ga0466967_0013058
762 Ga0495638_0081189
763 Ga0495651_0030115
764 Ga0495651_0108250
765 Ga0495653_0063946
766 Ga0495616_0168978
767 Ga0495652_0054137
768 Ga0495587_0000380
769 Ga0495645_0085465
770 Ga0495599_0159349
771 Ga0495647_0160398
772 Ga0495658_0155605
773 Ga0495613_0320759
774 Ga0495600_0320995
775 Ga0495604_0083384
776 Ga0495672_0021450
777 Ga0495675_0005439
778 Ga0495684_0050094
779 Ga0495684_0167316
780 Ga0495602_0000613
781 Ga0496100_0009287
782 Ga0496100_0318521
783 Ga0496102_0002334
784 Ga0496103_0091191
785 Ga0496104_0009179
786 Ga0496104_0388225
787 Ga0496109_0093925
788 Ga0496109_0216871
789 Ga0496109_0359339
790 Ga0496110_0120140
791 Ga0496110_0515075
792 Ga0496112_0008575
793 Ga0496112_0021262
794 Ga0496112_0023788
795 Ga0496114_0000001
796 Ga0496114_0006018
797 Ga0496114_0036694
798 Ga0496114_0241593
799 Ga0496114_0562190
800 Ga0496115_0085367
801 Ga0501299_001676
802 Ga0501299_023005
803 Ga0501032_0009569
804 Ga0501032_0065141
805 Ga0501032_0402591
806 Ga0501033_0027831
807 Ga0501033_0035198
808 Ga0501033_0044376
809 Ga0501033_0051910
810 Ga0501034_0006321
811 Ga0501034_0010656
812 Ga0501034_0018524
813 Ga0501034_0325697
814 Ga0501036_0011660
815 Ga0501036_0234787
816 Ga0501036_0327119
817 Ga0501037_0001323
818 Ga0501037_0432639
819 Ga0501038_0000812
820 Ga0501038_0048108
821 Ga0501038_0057727
822 Ga0501039_0022803
823 Ga0501039_0115112
824 Ga0501040_0500027
825 Ga0501042_0045229
826 Ga0501042_0390279
827 Ga0501043_0044451
828 Ga0501043_0071795
829 Ga0501046_0011472
830 Ga0501046_0033412
831 Ga0501046_0036782
832 Ga0501047_0003821
833 Ga0501047_0007192
834 Ga0501047_0172074
835 Ga0501047_0197461
836 Ga0501047_0449400
837 Ga0501048_0026892
838 Ga0501048_0073950
839 Ga0501048_0235333
840 Ga0501048_0319615
841 Ga0501048_0352882
842 Ga0501067_0000428
843 Ga0501067_0176099
844 Ga0501067_0266455
845 Ga0501068_0100035
846 Ga0501069_0001595
847 Ga0501069_0018192
848 Ga0501069_0128877
849 Ga0501070_0006487
850 Ga0501070_0035566
851 Ga0501070_0133071
852 Ga0501071_0002536
853 Ga0501072_0059903
854 Ga0501073_0004894
855 Ga0501074_0005932
856 Ga0501074_0035555
857 Ga0501075_0042887
858 Ga0501075_0211826
859 Ga0501077_0015620
860 Ga0501227_000308
861 Ga0501230_000507
862 Ga0501233_007577
863 Ga0501235_038252
864 Ga0501236_014396
865 Ga0501079_0041011
866 Ga0501079_0062005
867 Ga0501079_0078441
868 Ga0501079_0148154
869 Ga0501080_0024542
870 Ga0501080_0309092
871 Ga0501081_0052541
872 Ga0501081_0165092
873 Ga0501081_0423701
874 Ga0501081_0550441
875 Ga0501083_0010888
876 Ga0501083_0117834
877 Ga0501035_0022892
878 Ga0501035_0056755
879 Ga0501035_0240743
880 Ga0501044_0003143
881 Ga0501044_0010929
882 Ga0501044_0017553
883 Ga0501044_0184066
884 Ga0501044_0228894
885 Ga0501045_0015202
886 nmdc:mga03683_1492_c1
887 nmdc:mga00v17_1497_c1
888 nmdc:mga0k408_6891_c1
889 nmdc:mga04h51_48621_c1
890 nmdc:mga05p37_10478_c1
891 nmdc:mga09592_48842_c1
892 nmdc:mga06r32_183251_c1
893 nmdc:mga06r32_28841_c1
894 nmdc:mga08y16_1680_c1
895 nmdc:mga08y16_202_c1
896 nmdc:mga08x19_209721_c1
897 nmdc:mga0a205_173265_c1
898 nmdc:mga0a205_7753_c1
899 Ga0495595_0235627
900 Ga0495619_0536468
901 Ga0500641_0001584
902 Ga0500628_005784
903 Ga0500616_0000173
904 Ga0500645_000077
905 Ga0501084_0045687
906 Ga0501084_0047521
907 Ga0501084_0164643
908 Ga0501084_0386818
909 Ga0501082_0027282
910 Ga0501082_0033480

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

11

240

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4juq-assembly1.cif.gz_A pseudomonas aeruginosa metap t2n mutant, in mn form 0.9876 2 225
3mr1-assembly2.cif.gz_B crystal structure of methionine aminopeptidase from rickettsia prowazekii 0.9861 2 225
3tb5-assembly2.cif.gz_B crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9861 4 225
1o0x-assembly1.cif.gz_A crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution 0.9855 1 225
3tb5-assembly3.cif.gz_C crystal structure of the enterococcus faecalis methionine aminopeptidase apo form 0.9802 4 222
ID Description Score Start End Superfamily
af_Q6Z3V9_1_121_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.994 1 112 3.90.230.10
4juqD00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9869 1 225 3.90.230.10
1o0xA00 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9855 1 225 3.90.230.10
af_Q4VBS4_53_336_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9824 2 225 3.90.230.10
af_P9WK21_10_265_3.90.230.10 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9816 1 225 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A7V8WKD3-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9962 7 222 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-A0A1F5F213-F1-model_v4 Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M) 0.9957 1 222 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006
AF-K3YJQ4-F1-model_v4 Peptidase M24 domain-containing protein 0.9941 1 138
AF-A0A661YHV2-F1-model_v4 deleted 0.9938 2 210
AF-A0A7C3XA93-F1-model_v4 Methionine aminopeptidase (EC 3.4.11.18) 0.9936 1 180 GO:0004239
GO:0005829
GO:0006508
GO:0046872
GO:0070006

Map