F447631

General Info

Members Datasets Scaffolds Average Seq Length
455 236 910 143

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0050887|Ga0451577_0050887_971_1468
Length 165
Sequence MKFIFEGIQKITTFASFKAYLMTINEVQREIVEEFSVYEDWMDKYSYLIELGNDLKDLDPKDKTEEFLIKGCQSRVWLISEFVGGKIIFRGESDAVIVKGLVALLLRVVSNRTPDEILNNELFFIDEIGLKQHLSPTRSNGLLSMVKQIRLYAVAYNRISGKENE

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
107 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
110 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
111 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
112 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
113 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
130 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
137 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
138 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
142 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
147 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
148 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
166 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
171 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
172 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
182 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
183 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
184 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
185 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
186 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
187 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
188 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
189 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
190 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
191 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
192 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
193 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
194 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
195 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
196 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
197 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
198 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
199 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
200 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
201 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
202 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
203 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
206 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
207 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
208 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
209 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
212 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
218 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
219 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
220 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
221 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
224 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
225 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
226 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
227 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
228 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
229 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
230 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
231 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
232 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
233 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
234 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
235 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
236 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.73
Metatranscriptomes 2.2
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.37
Nodule 0
Rhizoplane 1.32
Rhizosphere 82.64
Stem 0
Stem Tuber 0
Unclassified 11.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0050887 3300042876 Bacteria 3698
2 rootH1_10088002 3300003316 Bacteria 1268
3 rootH1_10198657 3300003316 Unclassified 1076
4 rootH2_10048257 3300003320 Bacteria 13727
5 rootH2_10070396 3300003320 Bacteria 9968
6 rootH2_10097278 3300003320 Bacteria 1802
7 rootH2_10127612 3300003320 Bacteria 2241
8 rootH2_10175132 3300003320 Unclassified 1672
9 rootH2_10175765 3300003320 Bacteria 1322
10 rootH2_10269147 3300003320 Unclassified 2151
11 rootL2_10032615 3300003322 Bacteria 4495
12 rootL2_10053323 3300003322 Bacteria 2664
13 rootL2_10184829 3300003322 Bacteria 3136
14 rootL2_10257866 3300003322 Bacteria 1724
15 rootH1_10030641 3300003323 Bacteria 9103
16 rootH1_10033717 3300003323 Bacteria 7735
17 rootH1_10125111 3300003323 Bacteria 6700
18 rootH1_10131459 3300003323 Bacteria 2275
19 rootH1_10166581 3300003323 Bacteria 1781
20 rootH1_10359626 3300003323 Bacteria 1013
21 JGI25160J50197_1009679 3300003354 Bacteria 3551
22 Ga0055542_1011188 3300003762 Bacteria 1603
23 Ga0055531_10000151 3300003794 Bacteria 80302
24 Ga0065165_1016122 3300005262 Bacteria 2813
25 Ga0065714_10438774 3300005288 Bacteria 562
26 Ga0065704_10081320 3300005289 Bacteria 3769
27 Ga0065715_10435036 3300005293 Bacteria 842
28 Ga0070690_100106810 3300005330 Bacteria 1863
29 Ga0070670_100943383 3300005331 Bacteria 783
30 Ga0068868_100360151 3300005338 Bacteria 1248
31 Ga0070660_101816056 3300005339 Bacteria 519
32 Ga0070691_10109629 3300005341 Bacteria 1379
33 Ga0070661_100414087 3300005344 Bacteria 1067
34 Ga0070675_100209595 3300005354 Bacteria 1694
35 Ga0070659_100161427 3300005366 Bacteria 1833
36 Ga0070659_100841413 3300005366 Bacteria 799
37 Ga0070667_100133396 3300005367 Bacteria 2169
38 Ga0070714_100415140 3300005435 Unclassified 1274
39 Ga0070713_100263000 3300005436 Bacteria 1577
40 Ga0070663_100095353 3300005455 Bacteria 2211
41 Ga0070662_100065555 3300005457 Bacteria 2663
42 Ga0070681_10228548 3300005458 Bacteria 1775
43 Ga0068867_100219232 3300005459 Bacteria 1532
44 Ga0070684_100206437 3300005535 Bacteria 1790
45 Ga0068853_100029776 3300005539 Bacteria 4605
46 Ga0068853_100139778 3300005539 Bacteria 2173
47 Ga0068853_100162785 3300005539 Bacteria 2014
48 Ga0068853_102124049 3300005539 Bacteria 545
49 Ga0070665_100000013 3300005548 Bacteria 484927
50 Ga0070665_101953507 3300005548 Unclassified 592
51 Ga0068855_100053435 3300005563 Bacteria 4752
52 Ga0068855_100118547 3300005563 Bacteria 3031
53 Ga0068855_100179913 3300005563 Unclassified 2391
54 Ga0068855_100313929 3300005563 Unclassified 1734
55 Ga0068855_100796288 3300005563 Bacteria 1005
56 Ga0070664_100292624 3300005564 Bacteria 1470
57 Ga0068857_100005032 3300005577 Bacteria 11230
58 Ga0068857_100167147 3300005577 Bacteria 1998
59 Ga0068857_100377584 3300005577 Bacteria 1316
60 Ga0068854_100023267 3300005578 Bacteria 4230
61 Ga0068854_100049314 3300005578 Bacteria 3007
62 Ga0068854_100187479 3300005578 Bacteria 1619
63 Ga0068856_100028576 3300005614 Bacteria 5446
64 Ga0068856_100050484 3300005614 Bacteria 4101
65 Ga0068856_100110786 3300005614 Bacteria 2742
66 Ga0068856_100167710 3300005614 Bacteria 2207
67 Ga0068856_100174043 3300005614 Bacteria 2165
68 Ga0068852_100065274 3300005616 Bacteria 3175
69 Ga0068852_100186287 3300005616 Bacteria 1955
70 Ga0068859_101137061 3300005617 Bacteria 859
71 Ga0068861_100076654 3300005719 Bacteria 2606
72 Ga0068861_101024099 3300005719 Bacteria 789
73 Ga0068858_100652208 3300005842 Bacteria 1023
74 Ga0068860_100000138 3300005843 Bacteria 119368
75 Ga0068860_100002367 3300005843 Bacteria 19810
76 Ga0081540_1161375 3300005983 Unclassified 869
77 Ga0070715_10557323 3300006163 Bacteria 665
78 Ga0070716_100317482 3300006173 Unclassified 1090
79 Ga0070712_100196634 3300006175 Unclassified 1581
80 Ga0097621_100373055 3300006237 Bacteria 1273
81 Ga0068871_100112411 3300006358 Bacteria 2292
82 Ga0068871_100658145 3300006358 Bacteria 957
83 Ga0097620_101137192 3300006931 Bacteria 859
84 Ga0105240_10000165 3300009093 Bacteria 134738
85 Ga0105240_10000288 3300009093 Bacteria 98146
86 Ga0105240_10000289 3300009093 Bacteria 98095
87 Ga0105240_10014817 3300009093 Bacteria 10626
88 Ga0105240_10046848 3300009093 Bacteria 5475
89 Ga0105240_10399981 3300009093 Bacteria 1547
90 Ga0105241_10001610 3300009174 Bacteria 17198
91 Ga0105241_10432580 3300009174 Bacteria 1160
92 Ga0105237_10000340 3300009545 Bacteria 65768
93 Ga0105237_10007977 3300009545 Bacteria 11530
94 Ga0105237_10014422 3300009545 Bacteria 8265
95 Ga0105237_10015354 3300009545 Bacteria 7974
96 Ga0105237_10016851 3300009545 Bacteria 7583
97 Ga0105237_10608695 3300009545 Bacteria 1099
98 Ga0105238_10003436 3300009551 Bacteria 15777
99 Ga0105238_10010702 3300009551 Bacteria 9213
100 Ga0105238_10129985 3300009551 Bacteria 2496
101 Ga0105238_10228436 3300009551 Unclassified 1838
102 Ga0105238_10621420 3300009551 Bacteria 1089
103 Ga0105249_10715077 3300009553 Bacteria 1062
104 Ga0105239_10000299 3300010375 Bacteria 73314
105 Ga0105239_10009958 3300010375 Bacteria 10672
106 Ga0105239_10056310 3300010375 Bacteria 4313
107 Ga0105239_10097938 3300010375 Unclassified 3242
108 Ga0105239_10145186 3300010375 Bacteria 2646
109 Ga0105239_10510495 3300010375 Bacteria 1367
110 Ga0105239_11682742 3300010375 Bacteria 734
111 Ga0157373_10049857 3300013100 Bacteria 2983
112 Ga0157373_10333559 3300013100 Bacteria 1080
113 Ga0157371_10027627 3300013102 Bacteria 4115
114 Ga0157371_10120836 3300013102 Bacteria 1862
115 Ga0157370_10011883 3300013104 Bacteria 9082
116 Ga0157370_10472442 3300013104 Bacteria 1152
117 Ga0157370_10518312 3300013104 Bacteria 1094
118 Ga0157369_10001033 3300013105 Bacteria 35163
119 Ga0157369_10169241 3300013105 Bacteria 2303
120 Ga0157374_10000007 3300013296 Bacteria 595643
121 Ga0157374_10060060 3300013296 Bacteria 3557
122 Ga0157374_10386629 3300013296 Unclassified 1394
123 Ga0157378_10030242 3300013297 Bacteria 4785
124 Ga0157378_10173124 3300013297 Bacteria 2026
125 Ga0163162_10013806 3300013306 Bacteria 7891
126 Ga0157372_10000016 3300013307 Bacteria 220177
127 Ga0157372_10001950 3300013307 Bacteria 22402
128 Ga0157372_10005312 3300013307 Bacteria 13680
129 Ga0157372_10007391 3300013307 Bacteria 11683
130 Ga0157372_10034375 3300013307 Bacteria 5572
131 Ga0157372_10127312 3300013307 Bacteria 2928
132 Ga0163163_10374960 3300014325 Bacteria 1480
133 Ga0157380_10602249 3300014326 Bacteria 1087
134 Ga0182008_10656298 3300014497 Bacteria 595
135 Ga0157376_10001301 3300014969 Bacteria 16427
136 Ga0182005_1000338 3300015265 Bacteria 27177
137 Ga0163161_10373808 3300017792 Bacteria 1138
138 Ga0206356_10288355 3300020070 Bacteria 806
139 Ga0206356_10627144 3300020070 Bacteria 1226
140 Ga0206356_11517976 3300020070 Bacteria 1220
141 Ga0206351_10486953 3300020077 Bacteria 1133
142 Ga0224712_10227025 3300022467 Bacteria 856
143 Ga0209436_100350 3300025208 Bacteria 20823
144 Ga0209436_102274 3300025208 Bacteria 5915
145 Ga0209258_100156 3300025242 Bacteria 156926
146 Ga0209646_1044911 3300025246 Bacteria 544
147 Ga0209148_1000507 3300025254 Bacteria 39385
148 Ga0209130_1004105 3300025284 Bacteria 5733
149 Ga0207426_1000019 3300025302 Bacteria 558579
150 Ga0207426_1000114 3300025302 Bacteria 228273
151 Ga0207426_1002921 3300025302 Bacteria 10067
152 Ga0209257_1000013 3300025304 Bacteria 1047305
153 Ga0207680_10516539 3300025903 Bacteria 851
154 Ga0207647_10020687 3300025904 Bacteria 4408
155 Ga0207647_10063589 3300025904 Bacteria 2244
156 Ga0207647_10072799 3300025904 Bacteria 2072
157 Ga0207705_10117199 3300025909 Bacteria 1972
158 Ga0207654_10012209 3300025911 Bacteria 4397
159 Ga0207707_10787836 3300025912 Bacteria 793
160 Ga0207695_10000027 3300025913 Bacteria 612456
161 Ga0207695_10000247 3300025913 Bacteria 140966
162 Ga0207695_10001063 3300025913 Bacteria 48025
163 Ga0207695_10009504 3300025913 Bacteria 12025
164 Ga0207695_10098938 3300025913 Bacteria 2915
165 Ga0207695_10163817 3300025913 Bacteria 2153
166 Ga0207695_10166070 3300025913 Unclassified 2136
167 Ga0207671_10000456 3300025914 Bacteria 56238
168 Ga0207671_10004433 3300025914 Bacteria 13436
169 Ga0207671_10009759 3300025914 Bacteria 7989
170 Ga0207671_10024821 3300025914 Bacteria 4504
171 Ga0207671_10085773 3300025914 Bacteria 2366
172 Ga0207649_10424022 3300025920 Bacteria 1000
173 Ga0207694_10010098 3300025924 Bacteria 7114
174 Ga0207694_10045324 3300025924 Bacteria 3397
175 Ga0207694_10052705 3300025924 Bacteria 3154
176 Ga0207694_10172822 3300025924 Bacteria 1750
177 Ga0207694_10438384 3300025924 Bacteria 1090
178 Ga0207694_11212560 3300025924 Bacteria 638
179 Ga0207700_10271830 3300025928 Unclassified 1455
180 Ga0207664_10134911 3300025929 Bacteria 2082
181 Ga0207644_10945357 3300025931 Bacteria 723
182 Ga0207690_10112563 3300025932 Bacteria 1963
183 Ga0207690_11274087 3300025932 Unclassified 614
184 Ga0207706_10012762 3300025933 Bacteria 7647
185 Ga0207665_10325369 3300025939 Unclassified 1155
186 Ga0207667_10007316 3300025949 Bacteria 13292
187 Ga0207667_10117493 3300025949 Unclassified 2741
188 Ga0207667_10641740 3300025949 Bacteria 1068
189 Ga0207640_10042688 3300025981 Bacteria 2893
190 Ga0207677_10283704 3300026023 Bacteria 1360
191 Ga0207677_11108383 3300026023 Unclassified 722
192 Ga0207639_10096839 3300026041 Bacteria 2375
193 Ga0207639_10106061 3300026041 Bacteria 2280
194 Ga0207639_11506201 3300026041 Bacteria 631
195 Ga0207678_10027573 3300026067 Bacteria 4956
196 Ga0207702_10037963 3300026078 Bacteria 4034
197 Ga0207702_10120574 3300026078 Bacteria 2347
198 Ga0207702_10199873 3300026078 Bacteria 1852
199 Ga0207702_10486966 3300026078 Bacteria 1201
200 Ga0207702_11293524 3300026078 Bacteria 723
201 Ga0207702_11682954 3300026078 Unclassified 627
202 Ga0207674_10020353 3300026116 Bacteria 7168
203 Ga0207674_10065890 3300026116 Bacteria 3650
204 Ga0207674_10367125 3300026116 Bacteria 1391
205 Ga0207675_100840594 3300026118 Unclassified 933
206 Ga0207698_10012814 3300026142 Bacteria 5506
207 Ga0209995_1001388 3300027471 Bacteria 3731
208 Ga0210002_1003964 3300027617 Bacteria 2198
209 Ga0268266_10000024 3300028379 Bacteria 490820
210 Ga0268264_10000109 3300028381 Bacteria 208477
211 Ga0268264_10025493 3300028381 Unclassified 4831
212 Ga0265334_10068388 3300028573 Bacteria 1326
213 Ga0307517_10002335 3300028786 Bacteria 30606
214 Ga0307517_10185741 3300028786 Bacteria 1331
215 Ga0307517_10298997 3300028786 Bacteria 904
216 Ga0265338_10011982 3300028800 Bacteria 9930
217 Ga0265338_10088481 3300028800 Bacteria 2570
218 Ga0307511_10041542 3300030521 Bacteria 3881
219 Ga0316177_1064778 3300030731 Bacteria 12164
220 Ga0316176_1199238 3300030732 Bacteria 14583
221 Ga0316183_1116149 3300030742 Bacteria 41729
222 Ga0316181_1222010 3300030744 Bacteria 6880
223 Ga0265327_10000051 3300031251 Bacteria 257963
224 Ga0265327_10007045 3300031251 Bacteria 8809
225 Ga0265327_10011790 3300031251 Bacteria 5978
226 Ga0265316_10583590 3300031344 Bacteria 794
227 Ga0307408_100000154 3300031548 Bacteria 76673
228 Ga0265314_10341074 3300031711 Bacteria 827
229 Ga0316576_10071984 3300031727 Bacteria 2551
230 Ga0316576_10117115 3300031727 Bacteria 1999
231 Ga0316576_10140273 3300031727 Bacteria 1820
232 Ga0316576_10652031 3300031727 Bacteria 766
233 Ga0316578_10526766 3300031728 Unclassified 695
234 Ga0307516_10089676 3300031730 Bacteria 2905
235 Ga0316577_10266021 3300031733 Bacteria 970
236 Ga0307413_10087591 3300031824 Bacteria 2018
237 Ga0307414_10976293 3300032004 Bacteria 779
238 Ga0307414_11071141 3300032004 Bacteria 744
239 Ga0307414_11895462 3300032004 Unclassified 556
240 Ga0307411_10013543 3300032005 Bacteria 4503
241 Ga0307411_10293310 3300032005 Unclassified 1301
242 Ga0307415_101049483 3300032126 Bacteria 760
243 Ga0307510_10152968 3300033180 Bacteria 1921
244 Ga0307510_10613553 3300033180 Bacteria 541
245 Ga0316592_1162633 3300033524 Bacteria 529
246 Ga0316574_0197553 3300035398 Unclassified 1293
247 Ga0316574_0254400 3300035398 Bacteria 1122
248 Ga0316574_0323220 3300035398 Eukaryota 979
249 Ga0316574_0397269 3300035398 Bacteria 868
250 Ga0316582_0462108 3300036647 Unclassified 875
251 Ga0316584_0139398 3300036712 Bacteria 1810
252 Ga0316584_0216382 3300036712 Bacteria 1409
253 Ga0316584_1121936 3300036712 Unclassified 521
254 Ga0395899_0000021 3300037312 Bacteria 391702
255 Ga0395899_0000414 3300037312 Bacteria 49488
256 Ga0395900_0064472 3300037418 Bacteria 3765
257 Ga0395900_0256777 3300037418 Unclassified 1747
258 Ga0395901_0003672 3300038443 Bacteria 15476
259 Ga0395901_1181520 3300038443 Bacteria 732
260 Ga0439436_0029496 3300041404 Bacteria 1598
261 Ga0439439_0231186 3300041406 Bacteria 544
262 Ga0451787_068097 3300041441 Bacteria 602
263 Ga0451795_0069779 3300041456 Bacteria 1112
264 Ga0451795_0382025 3300041456 Bacteria 867
265 Ga0451795_1494843 3300041456 Unclassified 661
266 Ga0451798_0728727 3300041458 Bacteria 906
267 Ga0451807_0408119 3300041486 Bacteria 1235
268 Ga0451837_1638131 3300041494 Bacteria 2063
269 Ga0451847_0830976 3300041503 Bacteria 646
270 Ga0451855_0017182 3300041511 Bacteria 2427
271 Ga0451855_0246242 3300041511 Bacteria 978
272 Ga0451855_0478816 3300041511 Bacteria 922
273 Ga0451855_0497280 3300041511 Unclassified 627
274 Ga0451855_0803371 3300041511 Bacteria 506
275 Ga0451855_1188987 3300041511 Bacteria 1330
276 Ga0451855_2017355 3300041511 Bacteria 1922
277 Ga0439431_0001568 3300041997 Bacteria 5063
278 Ga0439431_0036839 3300041997 Bacteria 1233
279 Ga0439445_0006880 3300042004 Bacteria 2626
280 Ga0439445_0088770 3300042004 Bacteria 869
281 Ga0439449_0085717 3300042007 Bacteria 1162
282 Ga0439449_0215093 3300042007 Bacteria 720
283 Ga0439449_0221444 3300042007 Bacteria 709
284 Ga0439457_077665 3300042014 Bacteria 761
285 Ga0439462_0136411 3300042015 Bacteria 686
286 Ga0439446_0047592 3300042156 Bacteria 1276
287 Ga0451577_0000030 3300042876 Bacteria 391423
288 Ga0451577_0000044 3300042876 Bacteria 329357
289 Ga0451577_0004990 3300042876 Bacteria 13754
290 Ga0451577_0057186 3300042876 Bacteria 3478
291 Ga0451577_0058377 3300042876 Bacteria 3440
292 Ga0451577_0139189 3300042876 Unclassified 2180
293 Ga0451577_0141088 3300042876 Bacteria 2165
294 Ga0451577_0172665 3300042876 Bacteria 1948
295 Ga0451577_0190499 3300042876 Bacteria 1850
296 Ga0451577_0304279 3300042876 Bacteria 1445
297 Ga0451577_0340131 3300042876 Bacteria 1361
298 Ga0451577_0539834 3300042876 Unclassified 1059
299 Ga0451577_0776826 3300042876 Bacteria 866
300 Ga0451577_1218429 3300042876 Bacteria 671
301 Ga0466969_0127330 3300044656 Bacteria 1182
302 Ga0466972_0002257 3300044658 Bacteria 9475
303 Ga0466972_0071096 3300044658 Bacteria 1660
304 Ga0453683_0000022 3300044673 Bacteria 269593
305 Ga0453683_0000040 3300044673 Bacteria 225430
306 Ga0453683_0000183 3300044673 Bacteria 86894
307 Ga0453683_0002356 3300044673 Bacteria 14778
308 Ga0453683_0031765 3300044673 Bacteria 3335
309 Ga0453683_0040540 3300044673 Bacteria 2923
310 Ga0453683_0063980 3300044673 Bacteria 2299
311 Ga0453683_0094792 3300044673 Bacteria 1872
312 Ga0453683_0118330 3300044673 Bacteria 1667
313 Ga0453683_0194016 3300044673 Unclassified 1289
314 Ga0453683_0282637 3300044673 Bacteria 1060
315 Ga0466961_0078774 3300044693 Bacteria 2087
316 Ga0453684_0000051 3300044712 Bacteria 551033
317 Ga0453684_0000461 3300044712 Bacteria 162371
318 Ga0453684_0000558 3300044712 Bacteria 140560
319 Ga0453684_0000970 3300044712 Bacteria 94484
320 Ga0453684_0001154 3300044712 Bacteria 82455
321 Ga0453684_0004658 3300044712 Bacteria 28488
322 Ga0453684_0007656 3300044712 Bacteria 19769
323 Ga0453684_0017144 3300044712 Bacteria 11249
324 Ga0453684_0032342 3300044712 Bacteria 7325
325 Ga0453684_0042293 3300044712 Bacteria 6144
326 Ga0453684_0042766 3300044712 Bacteria 6101
327 Ga0453684_0050588 3300044712 Bacteria 5463
328 Ga0453684_0090793 3300044712 Bacteria 3773
329 Ga0453684_0227731 3300044712 Bacteria 2154
330 Ga0453684_0252783 3300044712 Bacteria 2023
331 Ga0453684_0351757 3300044712 Unclassified 1661
332 Ga0453684_0375896 3300044712 Bacteria 1596
333 Ga0453684_0383369 3300044712 Unclassified 1578
334 Ga0453684_0392179 3300044712 Bacteria 1557
335 Ga0453684_0439329 3300044712 Bacteria 1454
336 Ga0453684_0819909 3300044712 Bacteria 1002
337 Ga0453684_0842456 3300044712 Bacteria 986
338 Ga0453684_1433997 3300044712 Unclassified 715
339 Ga0453684_1664943 3300044712 Bacteria 653
340 Ga0453684_1776453 3300044712 Bacteria 628
341 Ga0453684_2139332 3300044712 Bacteria 560
342 Ga0453684_2243609 3300044712 Bacteria 544
343 Ga0466968_0014613 3300044735 Bacteria 3104
344 Ga0466968_0648596 3300044735 Bacteria 536
345 Ga0466957_0173612 3300044842 Bacteria 1405
346 Ga0466960_0069308 3300044901 Unclassified 1752
347 Ga0466959_0043469 3300045049 Bacteria 3312
348 Ga0466959_0102680 3300045049 Unclassified 2046
349 Ga0451576_0000047 3300045051 Bacteria 329357
350 Ga0451576_0000172 3300045051 Bacteria 162376
351 Ga0451576_0000442 3300045051 Bacteria 94498
352 Ga0451576_0000644 3300045051 Bacteria 72113
353 Ga0451576_0023577 3300045051 Bacteria 6662
354 Ga0451576_0040505 3300045051 Bacteria 4929
355 Ga0451576_0053377 3300045051 Bacteria 4234
356 Ga0451576_0131609 3300045051 Bacteria 2608
357 Ga0451576_0140085 3300045051 Bacteria 2523
358 Ga0451576_0177718 3300045051 Bacteria 2222
359 Ga0451576_0409086 3300045051 Unclassified 1423
360 Ga0451576_0419166 3300045051 Bacteria 1404
361 Ga0451576_0446688 3300045051 Unclassified 1357
362 Ga0451576_0625314 3300045051 Unclassified 1131
363 Ga0451576_0764858 3300045051 Unclassified 1014
364 Ga0451576_0939549 3300045051 Bacteria 907
365 Ga0451576_1190282 3300045051 Bacteria 796
366 Ga0451576_1495976 3300045051 Bacteria 701
367 Ga0451576_1739124 3300045051 Unclassified 645
368 Ga0451576_1777479 3300045051 Bacteria 637
369 Ga0466958_0209015 3300045836 Unclassified 1243
370 Ga0495627_002795 3300046453 Bacteria 8106
371 Ga0495638_0023187 3300046460 Bacteria 4064
372 Ga0495638_0148120 3300046460 Bacteria 1363
373 Ga0495648_0001379 3300046524 Bacteria 23931
374 Ga0495633_0000450 3300046558 Bacteria 42356
375 Ga0495611_0000089 3300046648 Bacteria 63663
376 Ga0495687_000014 3300047443 Bacteria 366896
377 Ga0495686_0000034 3300047472 Bacteria 325038
378 Ga0495686_0000577 3300047472 Bacteria 51975
379 Ga0496121_0000043 3300048924 Bacteria 341882
380 Ga0496125_0325777 3300048928 Bacteria 929
381 Ga0496126_0021998 3300048929 Bacteria 6215
382 Ga0501292_003062 3300049515 Bacteria 2206
383 Ga0501292_065097 3300049515 Unclassified 668
384 Ga0501298_000528 3300049521 Bacteria 5185
385 Ga0501312_072042 3300049528 Bacteria 614
386 Ga0501313_039001 3300049529 Bacteria 634
387 Ga0501315_016001 3300049531 Bacteria 967
388 Ga0501319_019631 3300049535 Bacteria 599
389 Ga0501034_0293490 3300049571 Bacteria 1563
390 Ga0501036_0154711 3300049572 Unclassified 1934
391 Ga0501040_0071800 3300049576 Bacteria 2390
392 Ga0501043_0298681 3300049579 Unclassified 1231
393 Ga0501047_0086305 3300049581 Bacteria 3016
394 Ga0501047_0163925 3300049581 Bacteria 2094
395 Ga0501198_001652 3300049649 Bacteria 2944
396 Ga0501201_001160 3300049651 Bacteria 2466
397 Ga0501202_015033 3300049652 Bacteria 1487
398 Ga0501206_004467 3300049653 Bacteria 1778
399 Ga0501207_001484 3300049654 Bacteria 2937
400 Ga0501217_001070 3300049661 Bacteria 4978
401 Ga0501222_001329 3300049662 Bacteria 3464
402 Ga0501223_001668 3300049663 Bacteria 5094
403 Ga0501224_001096 3300049664 Bacteria 3525
404 Ga0501233_001595 3300049668 Bacteria 3900
405 Ga0501235_002068 3300049669 Bacteria 4311
406 Ga0501238_030982 3300049671 Bacteria 773
407 Ga0501242_016718 3300049674 Bacteria 921
408 Ga0501243_009543 3300049675 Bacteria 1509
409 Ga0501249_020903 3300049679 Bacteria 1426
410 Ga0501252_000239 3300049682 Bacteria 3777
411 Ga0501257_009314 3300049686 Bacteria 2216
412 Ga0501259_001580 3300049688 Bacteria 3790
413 Ga0501261_002231 3300049690 Unclassified 2378
414 Ga0501221_000015 3300049704 Bacteria 19020
415 Ga0501225_0003181 3300049705 Bacteria 5018
416 Ga0501234_000964 3300049707 Bacteria 4545
417 Ga0501245_006287 3300049708 Bacteria 1657
418 Ga0501080_0422691 3300049742 Bacteria 1197
419 Ga0501232_038953 3300049757 Bacteria 693
420 Ga0501241_002031 3300049758 Bacteria 3964
421 Ga0501279_002940 3300049775 Bacteria 2217
422 Ga0501282_006245 3300049778 Bacteria 1275
423 Ga0501035_0007812 3300049822 Bacteria 9995
424 Ga0501044_0297706 3300049823 Unclassified 1543
425 Ga0501044_0424726 3300049823 Bacteria 1239
426 Ga0500644_0000361 3300053088 Bacteria 22312
427 Ga0500644_0047088 3300053088 Unclassified 1461
428 Ga0500583_0114968 3300053092 Bacteria 1328
429 Ga0500583_0229822 3300053092 Bacteria 918
430 Ga0500651_0364610 3300053093 Bacteria 818
431 Ga0500607_012809 3300053121 Bacteria 4913
432 Ga0500642_0081183 3300053130 Unclassified 1489
433 Ga0500559_0033685 3300053136 Bacteria 2206
434 Ga0500590_021391 3300053148 Bacteria 3357
435 Ga0500590_215673 3300053148 Bacteria 797
436 Ga0500622_0000328 3300053156 Bacteria 47220
437 Ga0500622_0000711 3300053156 Bacteria 29208
438 Ga0500627_0004682 3300053158 Bacteria 4433
439 Ga0500633_0005148 3300053160 Bacteria 3076
440 Ga0500634_0006246 3300053161 Bacteria 5748
441 Ga0500637_0069184 3300053178 Bacteria 2029
442 2819577908 2818991442 Bacteria 8318214
443 2819681606 2818991460 Bacteria 7595395
444 2821139066 2821136567 Bacteria 8080116
445 2883068117 2883068021 Bacteria 6192739
446 2890808058 2890804823 Bacteria 3717572
447 2896111529 2896109856 Bacteria 7140722
448 2896320056 2896317667 Bacteria 4606601
449 2904473373 2904467357 Bacteria 8057758
450 2910247168 2910245624 Bacteria 6935613
451 2919442034 2919437846 Bacteria 6199444
452 2929181494 2929177148 Bacteria 7883697
453 2945983906 2945977869 Bacteria 7777518
454 2946016701 2946013367 Bacteria 7766675
455 8036739541 8036736890 Bacteria 2944828
456 Ga0451577_0050887
457 rootH1_10088002
458 rootH1_10198657
459 rootH2_10048257
460 rootH2_10070396
461 rootH2_10097278
462 rootH2_10127612
463 rootH2_10175132
464 rootH2_10175765
465 rootH2_10269147
466 rootL2_10032615
467 rootL2_10053323
468 rootL2_10184829
469 rootL2_10257866
470 rootH1_10030641
471 rootH1_10033717
472 rootH1_10125111
473 rootH1_10131459
474 rootH1_10166581
475 rootH1_10359626
476 JGI25160J50197_1009679
477 Ga0055542_1011188
478 Ga0055531_10000151
479 Ga0065165_1016122
480 Ga0065714_10438774
481 Ga0065704_10081320
482 Ga0065715_10435036
483 Ga0070690_100106810
484 Ga0070670_100943383
485 Ga0068868_100360151
486 Ga0070660_101816056
487 Ga0070691_10109629
488 Ga0070661_100414087
489 Ga0070675_100209595
490 Ga0070659_100161427
491 Ga0070659_100841413
492 Ga0070667_100133396
493 Ga0070714_100415140
494 Ga0070713_100263000
495 Ga0070663_100095353
496 Ga0070662_100065555
497 Ga0070681_10228548
498 Ga0068867_100219232
499 Ga0070684_100206437
500 Ga0068853_100029776
501 Ga0068853_100139778
502 Ga0068853_100162785
503 Ga0068853_102124049
504 Ga0070665_100000013
505 Ga0070665_101953507
506 Ga0068855_100053435
507 Ga0068855_100118547
508 Ga0068855_100179913
509 Ga0068855_100313929
510 Ga0068855_100796288
511 Ga0070664_100292624
512 Ga0068857_100005032
513 Ga0068857_100167147
514 Ga0068857_100377584
515 Ga0068854_100023267
516 Ga0068854_100049314
517 Ga0068854_100187479
518 Ga0068856_100028576
519 Ga0068856_100050484
520 Ga0068856_100110786
521 Ga0068856_100167710
522 Ga0068856_100174043
523 Ga0068852_100065274
524 Ga0068852_100186287
525 Ga0068859_101137061
526 Ga0068861_100076654
527 Ga0068861_101024099
528 Ga0068858_100652208
529 Ga0068860_100000138
530 Ga0068860_100002367
531 Ga0081540_1161375
532 Ga0070715_10557323
533 Ga0070716_100317482
534 Ga0070712_100196634
535 Ga0097621_100373055
536 Ga0068871_100112411
537 Ga0068871_100658145
538 Ga0097620_101137192
539 Ga0105240_10000165
540 Ga0105240_10000288
541 Ga0105240_10000289
542 Ga0105240_10014817
543 Ga0105240_10046848
544 Ga0105240_10399981
545 Ga0105241_10001610
546 Ga0105241_10432580
547 Ga0105237_10000340
548 Ga0105237_10007977
549 Ga0105237_10014422
550 Ga0105237_10015354
551 Ga0105237_10016851
552 Ga0105237_10608695
553 Ga0105238_10003436
554 Ga0105238_10010702
555 Ga0105238_10129985
556 Ga0105238_10228436
557 Ga0105238_10621420
558 Ga0105249_10715077
559 Ga0105239_10000299
560 Ga0105239_10009958
561 Ga0105239_10056310
562 Ga0105239_10097938
563 Ga0105239_10145186
564 Ga0105239_10510495
565 Ga0105239_11682742
566 Ga0157373_10049857
567 Ga0157373_10333559
568 Ga0157371_10027627
569 Ga0157371_10120836
570 Ga0157370_10011883
571 Ga0157370_10472442
572 Ga0157370_10518312
573 Ga0157369_10001033
574 Ga0157369_10169241
575 Ga0157374_10000007
576 Ga0157374_10060060
577 Ga0157374_10386629
578 Ga0157378_10030242
579 Ga0157378_10173124
580 Ga0163162_10013806
581 Ga0157372_10000016
582 Ga0157372_10001950
583 Ga0157372_10005312
584 Ga0157372_10007391
585 Ga0157372_10034375
586 Ga0157372_10127312
587 Ga0163163_10374960
588 Ga0157380_10602249
589 Ga0182008_10656298
590 Ga0157376_10001301
591 Ga0182005_1000338
592 Ga0163161_10373808
593 Ga0206356_10288355
594 Ga0206356_10627144
595 Ga0206356_11517976
596 Ga0206351_10486953
597 Ga0224712_10227025
598 Ga0209436_100350
599 Ga0209436_102274
600 Ga0209258_100156
601 Ga0209646_1044911
602 Ga0209148_1000507
603 Ga0209130_1004105
604 Ga0207426_1000019
605 Ga0207426_1000114
606 Ga0207426_1002921
607 Ga0209257_1000013
608 Ga0207680_10516539
609 Ga0207647_10020687
610 Ga0207647_10063589
611 Ga0207647_10072799
612 Ga0207705_10117199
613 Ga0207654_10012209
614 Ga0207707_10787836
615 Ga0207695_10000027
616 Ga0207695_10000247
617 Ga0207695_10001063
618 Ga0207695_10009504
619 Ga0207695_10098938
620 Ga0207695_10163817
621 Ga0207695_10166070
622 Ga0207671_10000456
623 Ga0207671_10004433
624 Ga0207671_10009759
625 Ga0207671_10024821
626 Ga0207671_10085773
627 Ga0207649_10424022
628 Ga0207694_10010098
629 Ga0207694_10045324
630 Ga0207694_10052705
631 Ga0207694_10172822
632 Ga0207694_10438384
633 Ga0207694_11212560
634 Ga0207700_10271830
635 Ga0207664_10134911
636 Ga0207644_10945357
637 Ga0207690_10112563
638 Ga0207690_11274087
639 Ga0207706_10012762
640 Ga0207665_10325369
641 Ga0207667_10007316
642 Ga0207667_10117493
643 Ga0207667_10641740
644 Ga0207640_10042688
645 Ga0207677_10283704
646 Ga0207677_11108383
647 Ga0207639_10096839
648 Ga0207639_10106061
649 Ga0207639_11506201
650 Ga0207678_10027573
651 Ga0207702_10037963
652 Ga0207702_10120574
653 Ga0207702_10199873
654 Ga0207702_10486966
655 Ga0207702_11293524
656 Ga0207702_11682954
657 Ga0207674_10020353
658 Ga0207674_10065890
659 Ga0207674_10367125
660 Ga0207675_100840594
661 Ga0207698_10012814
662 Ga0209995_1001388
663 Ga0210002_1003964
664 Ga0268266_10000024
665 Ga0268264_10000109
666 Ga0268264_10025493
667 Ga0265334_10068388
668 Ga0307517_10002335
669 Ga0307517_10185741
670 Ga0307517_10298997
671 Ga0265338_10011982
672 Ga0265338_10088481
673 Ga0307511_10041542
674 Ga0316177_1064778
675 Ga0316176_1199238
676 Ga0316183_1116149
677 Ga0316181_1222010
678 Ga0265327_10000051
679 Ga0265327_10007045
680 Ga0265327_10011790
681 Ga0265316_10583590
682 Ga0307408_100000154
683 Ga0265314_10341074
684 Ga0316576_10071984
685 Ga0316576_10117115
686 Ga0316576_10140273
687 Ga0316576_10652031
688 Ga0316578_10526766
689 Ga0307516_10089676
690 Ga0316577_10266021
691 Ga0307413_10087591
692 Ga0307414_10976293
693 Ga0307414_11071141
694 Ga0307414_11895462
695 Ga0307411_10013543
696 Ga0307411_10293310
697 Ga0307415_101049483
698 Ga0307510_10152968
699 Ga0307510_10613553
700 Ga0316592_1162633
701 Ga0316574_0197553
702 Ga0316574_0254400
703 Ga0316574_0323220
704 Ga0316574_0397269
705 Ga0316582_0462108
706 Ga0316584_0139398
707 Ga0316584_0216382
708 Ga0316584_1121936
709 Ga0395899_0000021
710 Ga0395899_0000414
711 Ga0395900_0064472
712 Ga0395900_0256777
713 Ga0395901_0003672
714 Ga0395901_1181520
715 Ga0439436_0029496
716 Ga0439439_0231186
717 Ga0451787_068097
718 Ga0451795_0069779
719 Ga0451795_0382025
720 Ga0451795_1494843
721 Ga0451798_0728727
722 Ga0451807_0408119
723 Ga0451837_1638131
724 Ga0451847_0830976
725 Ga0451855_0017182
726 Ga0451855_0246242
727 Ga0451855_0478816
728 Ga0451855_0497280
729 Ga0451855_0803371
730 Ga0451855_1188987
731 Ga0451855_2017355
732 Ga0439431_0001568
733 Ga0439431_0036839
734 Ga0439445_0006880
735 Ga0439445_0088770
736 Ga0439449_0085717
737 Ga0439449_0215093
738 Ga0439449_0221444
739 Ga0439457_077665
740 Ga0439462_0136411
741 Ga0439446_0047592
742 Ga0451577_0000030
743 Ga0451577_0000044
744 Ga0451577_0004990
745 Ga0451577_0057186
746 Ga0451577_0058377
747 Ga0451577_0139189
748 Ga0451577_0141088
749 Ga0451577_0172665
750 Ga0451577_0190499
751 Ga0451577_0304279
752 Ga0451577_0340131
753 Ga0451577_0539834
754 Ga0451577_0776826
755 Ga0451577_1218429
756 Ga0466969_0127330
757 Ga0466972_0002257
758 Ga0466972_0071096
759 Ga0453683_0000022
760 Ga0453683_0000040
761 Ga0453683_0000183
762 Ga0453683_0002356
763 Ga0453683_0031765
764 Ga0453683_0040540
765 Ga0453683_0063980
766 Ga0453683_0094792
767 Ga0453683_0118330
768 Ga0453683_0194016
769 Ga0453683_0282637
770 Ga0466961_0078774
771 Ga0453684_0000051
772 Ga0453684_0000461
773 Ga0453684_0000558
774 Ga0453684_0000970
775 Ga0453684_0001154
776 Ga0453684_0004658
777 Ga0453684_0007656
778 Ga0453684_0017144
779 Ga0453684_0032342
780 Ga0453684_0042293
781 Ga0453684_0042766
782 Ga0453684_0050588
783 Ga0453684_0090793
784 Ga0453684_0227731
785 Ga0453684_0252783
786 Ga0453684_0351757
787 Ga0453684_0375896
788 Ga0453684_0383369
789 Ga0453684_0392179
790 Ga0453684_0439329
791 Ga0453684_0819909
792 Ga0453684_0842456
793 Ga0453684_1433997
794 Ga0453684_1664943
795 Ga0453684_1776453
796 Ga0453684_2139332
797 Ga0453684_2243609
798 Ga0466968_0014613
799 Ga0466968_0648596
800 Ga0466957_0173612
801 Ga0466960_0069308
802 Ga0466959_0043469
803 Ga0466959_0102680
804 Ga0451576_0000047
805 Ga0451576_0000172
806 Ga0451576_0000442
807 Ga0451576_0000644
808 Ga0451576_0023577
809 Ga0451576_0040505
810 Ga0451576_0053377
811 Ga0451576_0131609
812 Ga0451576_0140085
813 Ga0451576_0177718
814 Ga0451576_0409086
815 Ga0451576_0419166
816 Ga0451576_0446688
817 Ga0451576_0625314
818 Ga0451576_0764858
819 Ga0451576_0939549
820 Ga0451576_1190282
821 Ga0451576_1495976
822 Ga0451576_1739124
823 Ga0451576_1777479
824 Ga0466958_0209015
825 Ga0495627_002795
826 Ga0495638_0023187
827 Ga0495638_0148120
828 Ga0495648_0001379
829 Ga0495633_0000450
830 Ga0495611_0000089
831 Ga0495687_000014
832 Ga0495686_0000034
833 Ga0495686_0000577
834 Ga0496121_0000043
835 Ga0496125_0325777
836 Ga0496126_0021998
837 Ga0501292_003062
838 Ga0501292_065097
839 Ga0501298_000528
840 Ga0501312_072042
841 Ga0501313_039001
842 Ga0501315_016001
843 Ga0501319_019631
844 Ga0501034_0293490
845 Ga0501036_0154711
846 Ga0501040_0071800
847 Ga0501043_0298681
848 Ga0501047_0086305
849 Ga0501047_0163925
850 Ga0501198_001652
851 Ga0501201_001160
852 Ga0501202_015033
853 Ga0501206_004467
854 Ga0501207_001484
855 Ga0501217_001070
856 Ga0501222_001329
857 Ga0501223_001668
858 Ga0501224_001096
859 Ga0501233_001595
860 Ga0501235_002068
861 Ga0501238_030982
862 Ga0501242_016718
863 Ga0501243_009543
864 Ga0501249_020903
865 Ga0501252_000239
866 Ga0501257_009314
867 Ga0501259_001580
868 Ga0501261_002231
869 Ga0501221_000015
870 Ga0501225_0003181
871 Ga0501234_000964
872 Ga0501245_006287
873 Ga0501080_0422691
874 Ga0501232_038953
875 Ga0501241_002031
876 Ga0501279_002940
877 Ga0501282_006245
878 Ga0501035_0007812
879 Ga0501044_0297706
880 Ga0501044_0424726
881 Ga0500644_0000361
882 Ga0500644_0047088
883 Ga0500583_0114968
884 Ga0500583_0229822
885 Ga0500651_0364610
886 Ga0500607_012809
887 Ga0500642_0081183
888 Ga0500559_0033685
889 Ga0500590_021391
890 Ga0500590_215673
891 Ga0500622_0000328
892 Ga0500622_0000711
893 Ga0500627_0004682
894 Ga0500633_0005148
895 Ga0500634_0006246
896 Ga0500637_0069184
897 2819577908
898 2819681606
899 2821139066
900 2883068117
901 2890808058
902 2896111529
903 2896320056
904 2904473373
905 2910247168
906 2919442034
907 2929181494
908 2945983906
909 2946016701
910 8036739541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02657

SufE

Fe-S metabolism associated domain

32

152

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.9499 7 136
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.9388 7 140
3g0m-assembly1.cif.gz_A crystal structure of cysteine desulfuration protein sufe from salmonella typhimurium lt2 0.8903 7 136
1mzg-assembly1.cif.gz_B x-ray structure of sufe from e.coli northeast structural genomics (nesg) consortium target er30 0.8762 7 140
5eep-assembly1.cif.gz_A crystal structure of e. coli csde 0.8705 1 135
ID Description Score Start End Superfamily
3g0mA00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9499 7 136 3.90.1010.10
af_A0A0R0FV61_26_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9381 19 139 3.90.1010.10
af_Q6K258_62_207_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9185 7 134 3.90.1010.10
af_O96155_92_241_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9153 6 133 3.90.1010.10
af_Q10RM2_1_106_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9101 38 140 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A2U0UJT8-F1-model_v4 Cysteine desulfuration protein SufE 0.9947 1 139
AF-U2HVT2-F1-model_v4 Fe-S metabolism protein SufE 0.9943 1 138
AF-A0A4R6WFZ2-F1-model_v4 Cysteine desulfuration protein SufE 0.9937 1 138
AF-A0A2N6Q4B0-F1-model_v4 Fe-S metabolism protein SufE 0.9922 1 139
AF-A0A2D0NAY6-F1-model_v4 Fe-S metabolism protein SufE 0.992 1 140

Map