F447603

General Info

Members Datasets Scaffolds Average Seq Length
455 241 910 178

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10022600|Ga0265325_100226002
Length 206
Sequence MASFRAEPHFRQSEGFGENHTSGVEVHTMKRDPIYGMMAEFDSAQALVDAARTTHQAGYQKIDAYSPFPVEGLAEEIGFHHDEVPIVTLFGGIIGGLTGYLMQYWISAVDYPLNIGGKPYHSWPAFIVITFEMTILFAGISAVFGMLALNGLPMPYHPVFNVPRFSSASKDRFFLIVFSSDKKYDPADTRKFLEAMSPRSISEVPS

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
161 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 2.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.03
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 15.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10022600 3300031241 Bacteria 3443
2 LJNas_1000046 3300000546 Bacteria 16507
3 Ga0058859_11784762 3300004798 Bacteria 1992
4 Ga0058860_11121876 3300004801 Bacteria 1261
5 Ga0065715_10122515 3300005293 Bacteria 2203
6 Ga0070658_10039311 3300005327 Bacteria 3815
7 Ga0070683_100244881 3300005329 Bacteria 1705
8 Ga0070670_100616315 3300005331 Bacteria 972
9 Ga0070680_100040029 3300005336 Unclassified 3793
10 Ga0070680_100131707 3300005336 Bacteria 2092
11 Ga0070682_100007104 3300005337 Bacteria 6302
12 Ga0070682_100153275 3300005337 Bacteria 1584
13 Ga0068868_100094801 3300005338 Bacteria 2408
14 Ga0068868_100822812 3300005338 Unclassified 839
15 Ga0070660_100007693 3300005339 Bacteria 7509
16 Ga0070689_100065490 3300005340 Bacteria 2830
17 Ga0070687_100053906 3300005343 Bacteria 2093
18 Ga0070661_100002233 3300005344 Bacteria 13282
19 Ga0070692_10164756 3300005345 Bacteria 1273
20 Ga0070668_100092176 3300005347 Bacteria 2389
21 Ga0070668_101103074 3300005347 Bacteria 716
22 Ga0070669_100270711 3300005353 Bacteria 1358
23 Ga0070669_100493417 3300005353 Bacteria 1015
24 Ga0070675_100395674 3300005354 Bacteria 1232
25 Ga0070675_100509507 3300005354 Bacteria 1085
26 Ga0070671_100154881 3300005355 Bacteria 1936
27 Ga0070673_100084603 3300005364 Bacteria 2580
28 Ga0070659_100001713 3300005366 Bacteria 15774
29 Ga0070667_100459575 3300005367 Bacteria 1164
30 Ga0070703_10207259 3300005406 Bacteria 773
31 Ga0070709_10000171 3300005434 Bacteria 40897
32 Ga0070709_10003271 3300005434 Bacteria 8710
33 Ga0070709_10033543 3300005434 Bacteria 3106
34 Ga0070709_10068342 3300005434 Bacteria 2284
35 Ga0070709_10686412 3300005434 Unclassified 796
36 Ga0070714_100000202 3300005435 Bacteria 48105
37 Ga0070714_100009046 3300005435 Bacteria 7805
38 Ga0070714_100075046 3300005435 Bacteria 2933
39 Ga0070713_100000029 3300005436 Bacteria 90705
40 Ga0070713_100082106 3300005436 Bacteria 2751
41 Ga0070713_100127807 3300005436 Unclassified 2238
42 Ga0070713_100378623 3300005436 Bacteria 1318
43 Ga0070713_100402109 3300005436 Bacteria 1279
44 Ga0070713_100469081 3300005436 Bacteria 1185
45 Ga0070713_100573241 3300005436 Unclassified 1070
46 Ga0070710_10017964 3300005437 Bacteria 3632
47 Ga0070710_10039141 3300005437 Unclassified 2608
48 Ga0070710_10055566 3300005437 Unclassified 2238
49 Ga0070710_10298175 3300005437 Bacteria 1051
50 Ga0070701_10003850 3300005438 Bacteria 5994
51 Ga0070711_100000186 3300005439 Bacteria 32876
52 Ga0070711_100010132 3300005439 Bacteria 5825
53 Ga0070711_100118947 3300005439 Bacteria 1951
54 Ga0070711_101164182 3300005439 Unclassified 666
55 Ga0070705_100533140 3300005440 Bacteria 897
56 Ga0070700_100035040 3300005441 Bacteria 3034
57 Ga0070708_100000137 3300005445 Bacteria 50233
58 Ga0070708_100000957 3300005445 Bacteria 21911
59 Ga0070708_100032233 3300005445 Bacteria 4543
60 Ga0070708_100154415 3300005445 Unclassified 2136
61 Ga0070663_100032484 3300005455 Bacteria 3598
62 Ga0070678_100389209 3300005456 Unclassified 1208
63 Ga0070678_100586049 3300005456 Bacteria 994
64 Ga0070662_100042363 3300005457 Bacteria 3252
65 Ga0070681_10000273 3300005458 Bacteria 41372
66 Ga0070681_10012065 3300005458 Bacteria 8569
67 Ga0070681_10024504 3300005458 Bacteria 6073
68 Ga0070685_10004291 3300005466 Bacteria 7199
69 Ga0070685_10031864 3300005466 Bacteria 2948
70 Ga0070706_100001324 3300005467 Bacteria 26322
71 Ga0070706_100009097 3300005467 Bacteria 9250
72 Ga0070706_100027117 3300005467 Bacteria 5271
73 Ga0070706_100192015 3300005467 Bacteria 1908
74 Ga0070706_101109583 3300005467 Bacteria 728
75 Ga0070707_100000651 3300005468 Bacteria 34704
76 Ga0070707_100004004 3300005468 Bacteria 13864
77 Ga0070707_100048843 3300005468 Bacteria 4054
78 Ga0070707_100126287 3300005468 Bacteria 2486
79 Ga0070707_100255529 3300005468 Unclassified 1705
80 Ga0070707_100513656 3300005468 Bacteria 1160
81 Ga0070698_100000012 3300005471 Bacteria 116260
82 Ga0070698_100000902 3300005471 Bacteria 32626
83 Ga0070698_100005088 3300005471 Bacteria 14398
84 Ga0070698_100201308 3300005471 Bacteria 1927
85 Ga0070699_100000439 3300005518 Bacteria 39981
86 Ga0070699_100040774 3300005518 Bacteria 4019
87 Ga0070699_100051110 3300005518 Bacteria 3579
88 Ga0070699_100053693 3300005518 Bacteria 3488
89 Ga0070699_100133991 3300005518 Bacteria 2185
90 Ga0070699_100525441 3300005518 Bacteria 1076
91 Ga0070679_100001215 3300005530 Bacteria 22690
92 Ga0070679_100441602 3300005530 Bacteria 1246
93 Ga0070684_100077532 3300005535 Bacteria 2935
94 Ga0070697_100000031 3300005536 Bacteria 110959
95 Ga0070697_100000265 3300005536 Bacteria 42493
96 Ga0070697_100001672 3300005536 Bacteria 16933
97 Ga0070697_100001710 3300005536 Bacteria 16768
98 Ga0070697_100002228 3300005536 Bacteria 14869
99 Ga0070697_100008036 3300005536 Bacteria 8225
100 Ga0070697_100013158 3300005536 Bacteria 6488
101 Ga0070697_100084791 3300005536 Bacteria 2613
102 Ga0070697_100906529 3300005536 Unclassified 782
103 Ga0068853_100333784 3300005539 Bacteria 1407
104 Ga0070686_100011047 3300005544 Bacteria 5112
105 Ga0070695_100005931 3300005545 Bacteria 7212
106 Ga0070695_100132498 3300005545 Bacteria 1719
107 Ga0070696_100616685 3300005546 Unclassified 876
108 Ga0070693_100096021 3300005547 Bacteria 1796
109 Ga0070665_100000281 3300005548 Bacteria 83503
110 Ga0070665_101772243 3300005548 Unclassified 624
111 Ga0070704_100080056 3300005549 Bacteria 2402
112 Ga0068855_100041979 3300005563 Bacteria 5420
113 Ga0068855_101207399 3300005563 Bacteria 786
114 Ga0070664_100003501 3300005564 Bacteria 12681
115 Ga0070664_101408190 3300005564 Bacteria 659
116 Ga0068854_100009349 3300005578 Bacteria 6328
117 Ga0068856_100005834 3300005614 Bacteria 12137
118 Ga0068856_100008688 3300005614 Bacteria 9881
119 Ga0068856_100075852 3300005614 Bacteria 3331
120 Ga0068852_100013118 3300005616 Bacteria 6330
121 Ga0068852_100813338 3300005616 Bacteria 949
122 Ga0068859_100193273 3300005617 Bacteria 2119
123 Ga0068864_100516169 3300005618 Bacteria 1151
124 Ga0068866_10117861 3300005718 Bacteria 1491
125 Ga0068861_100235713 3300005719 Bacteria 1554
126 Ga0068851_10005283 3300005834 Bacteria 5861
127 Ga0068863_100061303 3300005841 Bacteria 3556
128 Ga0068863_100105533 3300005841 Bacteria 2680
129 Ga0068863_100205346 3300005841 Bacteria 1896
130 Ga0068863_100350129 3300005841 Bacteria 1438
131 Ga0068863_100878520 3300005841 Unclassified 896
132 Ga0068858_101196045 3300005842 Bacteria 747
133 Ga0068860_100889261 3300005843 Unclassified 906
134 Ga0068862_100030209 3300005844 Bacteria 4566
135 Ga0068862_100183160 3300005844 Bacteria 1881
136 Ga0070717_10003549 3300006028 Bacteria 11181
137 Ga0070717_10021504 3300006028 Bacteria 5084
138 Ga0070717_10120939 3300006028 Bacteria 2243
139 Ga0070717_10189191 3300006028 Unclassified 1798
140 Ga0070717_10206344 3300006028 Bacteria 1723
141 Ga0070717_10543560 3300006028 Bacteria 1052
142 Ga0070715_10131251 3300006163 Unclassified 1206
143 Ga0070715_10154315 3300006163 Unclassified 1128
144 Ga0070715_10558083 3300006163 Bacteria 665
145 Ga0070716_100001611 3300006173 Bacteria 10162
146 Ga0070716_100003773 3300006173 Bacteria 7179
147 Ga0070716_100018169 3300006173 Bacteria 3659
148 Ga0070716_100074133 3300006173 Unclassified 2010
149 Ga0070716_100155959 3300006173 Bacteria 1474
150 Ga0070716_100285900 3300006173 Unclassified 1140
151 Ga0070712_100000080 3300006175 Bacteria 49781
152 Ga0070712_100000089 3300006175 Bacteria 45999
153 Ga0070712_100018587 3300006175 Unclassified 4518
154 Ga0070712_100024447 3300006175 Bacteria 4004
155 Ga0070712_100303031 3300006175 Bacteria 1294
156 Ga0070712_100393797 3300006175 Bacteria 1143
157 Ga0097621_100327043 3300006237 Bacteria 1359
158 Ga0068871_100416402 3300006358 Bacteria 1199
159 Ga0068871_100861653 3300006358 Bacteria 838
160 Ga0075428_100030488 3300006844 Bacteria 5964
161 Ga0075428_100296831 3300006844 Unclassified 1738
162 Ga0075431_101266032 3300006847 Bacteria 699
163 Ga0075433_10003030 3300006852 Bacteria 12906
164 Ga0075434_100002333 3300006871 Bacteria 16619
165 Ga0075434_100007662 3300006871 Bacteria 9989
166 Ga0075434_100421007 3300006871 Bacteria 1357
167 Ga0075434_100717210 3300006871 Unclassified 1017
168 Ga0075429_100842669 3300006880 Unclassified 803
169 Ga0068865_100912087 3300006881 Bacteria 765
170 Ga0075436_100161608 3300006914 Unclassified 1579
171 Ga0097620_100193280 3300006931 Bacteria 2119
172 Ga0075435_100001773 3300007076 Bacteria 14054
173 Ga0075435_100305090 3300007076 Bacteria 1362
174 Ga0075435_100473552 3300007076 Unclassified 1081
175 Ga0105240_10170980 3300009093 Bacteria 2574
176 Ga0105240_10788807 3300009093 Bacteria 1030
177 Ga0111539_10235404 3300009094 Bacteria 2132
178 Ga0111539_10636941 3300009094 Bacteria 1241
179 Ga0105245_10133889 3300009098 Bacteria 2327
180 Ga0105247_10020800 3300009101 Bacteria 3946
181 Ga0105247_10242853 3300009101 Bacteria 1228
182 Ga0114129_10049429 3300009147 Bacteria 5908
183 Ga0114129_10080799 3300009147 Bacteria 4518
184 Ga0114129_10314735 3300009147 Bacteria 2083
185 Ga0105241_10042757 3300009174 Bacteria 3430
186 Ga0105241_10239799 3300009174 Bacteria 1532
187 Ga0105241_10489808 3300009174 Bacteria 1094
188 Ga0105241_10765926 3300009174 Bacteria 886
189 Ga0105242_10328681 3300009176 Bacteria 1405
190 Ga0105248_10041542 3300009177 Bacteria 5156
191 Ga0105237_10037427 3300009545 Bacteria 4905
192 Ga0105237_10151963 3300009545 Bacteria 2312
193 Ga0105238_10005774 3300009551 Bacteria 12248
194 Ga0105238_10744309 3300009551 Bacteria 994
195 Ga0105238_11112568 3300009551 Bacteria 813
196 Ga0105249_10006145 3300009553 Bacteria 10416
197 Ga0105249_10100722 3300009553 Bacteria 2717
198 Ga0099796_10077291 3300010159 Bacteria 1214
199 Ga0105239_10037052 3300010375 Bacteria 5350
200 Ga0105246_10038528 3300011119 Bacteria 3215
201 Ga0157373_10042875 3300013100 Bacteria 3232
202 Ga0157370_10173367 3300013104 Bacteria 2005
203 Ga0157369_10040518 3300013105 Bacteria 5084
204 Ga0157374_10006871 3300013296 Bacteria 9681
205 Ga0157374_10408070 3300013296 Unclassified 1356
206 Ga0157378_10196613 3300013297 Bacteria 1905
207 Ga0157372_10023834 3300013307 Bacteria 6640
208 Ga0157372_10027404 3300013307 Bacteria 6204
209 Ga0157372_10284276 3300013307 Bacteria 1924
210 Ga0157372_10478731 3300013307 Bacteria 1451
211 Ga0157372_11964199 3300013307 Bacteria 672
212 Ga0157375_10014314 3300013308 Bacteria 7073
213 Ga0157375_11414065 3300013308 Bacteria 820
214 Ga0163163_10001892 3300014325 Bacteria 17700
215 Ga0163163_10082491 3300014325 Bacteria 3219
216 Ga0163163_10114766 3300014325 Bacteria 2725
217 Ga0157380_10110501 3300014326 Bacteria 2309
218 Ga0157380_11121444 3300014326 Bacteria 826
219 Ga0182008_10002552 3300014497 Bacteria 11339
220 Ga0157377_10825117 3300014745 Bacteria 686
221 Ga0157379_10002535 3300014968 Bacteria 15316
222 Ga0157376_10247292 3300014969 Bacteria 1664
223 Ga0182006_1011107 3300015261 Bacteria 3977
224 Ga0182007_10005966 3300015262 Bacteria 5284
225 Ga0182005_1006827 3300015265 Bacteria 3458
226 Ga0182005_1034713 3300015265 Unclassified 1372
227 Ga0163161_10015033 3300017792 Bacteria 5394
228 Ga0228598_1005826 3300024227 Bacteria 2565
229 Ga0207656_10019883 3300025321 Bacteria 2660
230 Ga0207653_10029734 3300025885 Bacteria 1760
231 Ga0207692_10003398 3300025898 Bacteria 6218
232 Ga0207692_10054196 3300025898 Bacteria 2046
233 Ga0207692_10061051 3300025898 Bacteria 1952
234 Ga0207692_10091055 3300025898 Unclassified 1654
235 Ga0207692_10430488 3300025898 Bacteria 827
236 Ga0207710_10038594 3300025900 Bacteria 2112
237 Ga0207710_10049798 3300025900 Bacteria 1878
238 Ga0207647_10102360 3300025904 Bacteria 1698
239 Ga0207647_10361956 3300025904 Bacteria 821
240 Ga0207685_10035213 3300025905 Unclassified 1825
241 Ga0207685_10046517 3300025905 Bacteria 1652
242 Ga0207685_10115650 3300025905 Unclassified 1169
243 Ga0207699_10004295 3300025906 Bacteria 6815
244 Ga0207699_10011262 3300025906 Bacteria 4509
245 Ga0207705_10026742 3300025909 Bacteria 4112
246 Ga0207705_10493788 3300025909 Unclassified 950
247 Ga0207684_10000811 3300025910 Bacteria 36097
248 Ga0207684_10002954 3300025910 Bacteria 16852
249 Ga0207684_10003678 3300025910 Bacteria 14869
250 Ga0207684_10030221 3300025910 Bacteria 4613
251 Ga0207684_10042916 3300025910 Bacteria 3834
252 Ga0207684_10155979 3300025910 Bacteria 1965
253 Ga0207654_10086054 3300025911 Bacteria 1904
254 Ga0207707_10000008 3300025912 Bacteria 330313
255 Ga0207707_10005533 3300025912 Bacteria 11047
256 Ga0207695_10588219 3300025913 Bacteria 994
257 Ga0207693_10000031 3300025915 Bacteria 117500
258 Ga0207693_10000082 3300025915 Bacteria 85372
259 Ga0207693_10035569 3300025915 Bacteria 3926
260 Ga0207663_10000784 3300025916 Bacteria 14229
261 Ga0207663_10026775 3300025916 Bacteria 3351
262 Ga0207663_10762245 3300025916 Unclassified 769
263 Ga0207660_10007885 3300025917 Bacteria 6891
264 Ga0207660_10145043 3300025917 Bacteria 1819
265 Ga0207662_10035348 3300025918 Bacteria 2918
266 Ga0207657_10003255 3300025919 Bacteria 17389
267 Ga0207649_10005166 3300025920 Bacteria 7052
268 Ga0207652_10000065 3300025921 Bacteria 111252
269 Ga0207652_10341167 3300025921 Bacteria 1352
270 Ga0207646_10000287 3300025922 Bacteria 69461
271 Ga0207646_10000494 3300025922 Bacteria 52791
272 Ga0207646_10180372 3300025922 Bacteria 1907
273 Ga0207646_10294718 3300025922 Bacteria 1466
274 Ga0207646_10914110 3300025922 Unclassified 778
275 Ga0207681_10029421 3300025923 Bacteria 3568
276 Ga0207681_10291595 3300025923 Bacteria 1288
277 Ga0207681_10316901 3300025923 Bacteria 1239
278 Ga0207694_10013526 3300025924 Bacteria 6148
279 Ga0207694_10533026 3300025924 Bacteria 985
280 Ga0207659_10151001 3300025926 Bacteria 1814
281 Ga0207659_10208597 3300025926 Bacteria 1565
282 Ga0207700_10000160 3300025928 Bacteria 40173
283 Ga0207700_10000343 3300025928 Bacteria 27314
284 Ga0207700_10270950 3300025928 Bacteria 1457
285 Ga0207700_10640071 3300025928 Unclassified 948
286 Ga0207700_11207635 3300025928 Unclassified 675
287 Ga0207664_10015052 3300025929 Bacteria 5603
288 Ga0207664_10031292 3300025929 Bacteria 4070
289 Ga0207664_10331413 3300025929 Unclassified 1344
290 Ga0207690_10013184 3300025932 Bacteria 4961
291 Ga0207706_10031627 3300025933 Bacteria 4713
292 Ga0207704_10842601 3300025938 Bacteria 768
293 Ga0207665_10003628 3300025939 Bacteria 10315
294 Ga0207665_10009932 3300025939 Bacteria 6245
295 Ga0207665_10070236 3300025939 Bacteria 2389
296 Ga0207665_10077014 3300025939 Unclassified 2288
297 Ga0207665_10103052 3300025939 Bacteria 1996
298 Ga0207665_10106933 3300025939 Unclassified 1961
299 Ga0207661_10172162 3300025944 Bacteria 1885
300 Ga0207679_10025162 3300025945 Bacteria 4090
301 Ga0207651_10152872 3300025960 Bacteria 1799
302 Ga0207712_10261072 3300025961 Bacteria 1405
303 Ga0207668_10013354 3300025972 Bacteria 5054
304 Ga0207668_10923956 3300025972 Bacteria 777
305 Ga0207640_10013206 3300025981 Bacteria 4728
306 Ga0207677_10071574 3300026023 Bacteria 2448
307 Ga0207677_10680959 3300026023 Bacteria 911
308 Ga0207677_10805800 3300026023 Unclassified 841
309 Ga0207639_10028493 3300026041 Unclassified 4078
310 Ga0207678_10294791 3300026067 Bacteria 1393
311 Ga0207708_10062683 3300026075 Bacteria 2840
312 Ga0207708_10411008 3300026075 Bacteria 1121
313 Ga0207702_10062535 3300026078 Bacteria 3179
314 Ga0207702_10476504 3300026078 Unclassified 1214
315 Ga0207641_10095026 3300026088 Bacteria 2615
316 Ga0207641_10295053 3300026088 Unclassified 1529
317 Ga0207641_10327592 3300026088 Bacteria 1454
318 Ga0207641_11904978 3300026088 Unclassified 596
319 Ga0207676_10792075 3300026095 Bacteria 924
320 Ga0207675_100066285 3300026118 Bacteria 3375
321 Ga0207675_100191870 3300026118 Bacteria 1960
322 Ga0207683_10296077 3300026121 Bacteria 1480
323 Ga0207683_11114625 3300026121 Bacteria 732
324 Ga0207698_10046797 3300026142 Bacteria 3270
325 Ga0207698_11047090 3300026142 Bacteria 828
326 Ga0207428_10098113 3300027907 Bacteria 2267
327 Ga0265356_1006055 3300028017 Bacteria 1423
328 Ga0265355_1002153 3300028036 Bacteria 1352
329 Ga0268266_10000161 3300028379 Bacteria 125387
330 Ga0268265_10519562 3300028380 Bacteria 1125
331 Ga0268264_10852605 3300028381 Bacteria 912
332 Ga0265338_10002130 3300028800 Bacteria 30400
333 Ga0265338_10102277 3300028800 Bacteria 2330
334 Ga0265338_10115134 3300028800 Bacteria 2156
335 Ga0265338_10202816 3300028800 Bacteria 1494
336 Ga0265762_1000253 3300030760 Bacteria 8812
337 Ga0265770_1002993 3300030878 Bacteria 2294
338 Ga0265765_1000976 3300030879 Unclassified 2522
339 Ga0265760_10076272 3300031090 Unclassified 1034
340 Ga0265760_10078549 3300031090 Bacteria 1020
341 Ga0265330_10014740 3300031235 Bacteria 3626
342 Ga0265330_10136837 3300031235 Bacteria 1042
343 Ga0265328_10018455 3300031239 Bacteria 2690
344 Ga0265325_10057734 3300031241 Unclassified 1979
345 Ga0265340_10046445 3300031247 Unclassified 2119
346 Ga0265339_10012191 3300031249 Bacteria 5258
347 Ga0265339_10024756 3300031249 Bacteria 3455
348 Ga0265339_10099308 3300031249 Bacteria 1517
349 Ga0265316_10017160 3300031344 Bacteria 6265
350 Ga0265316_10036382 3300031344 Bacteria 3981
351 Ga0265314_10008539 3300031711 Bacteria 8756
352 Ga0265314_10054081 3300031711 Bacteria 2780
353 Ga0373926_0203227 3300035083 Unclassified 763
354 Ga0373934_0025144 3300035086 Bacteria 2305
355 Ga0373956_0012121 3300035119 Bacteria 3567
356 Ga0373943_0352658 3300035170 Bacteria 843
357 Ga0373946_0289038 3300035171 Unclassified 808
358 Ga0373955_0088095 3300035172 Unclassified 1765
359 Ga0373955_0547402 3300035172 Bacteria 708
360 Ga0373955_0834779 3300035172 Unclassified 567
361 Ga0373924_0351061 3300035410 Bacteria 657
362 Ga0373935_0019303 3300035692 Bacteria 4157
363 Ga0373927_0021449 3300035695 Bacteria 4234
364 Ga0373933_0127743 3300035724 Bacteria 1596
365 Ga0373937_0005073 3300036401 Bacteria 11210
366 Ga0373937_0405733 3300036401 Bacteria 1293
367 Ga0373925_0009397 3300037068 Bacteria 7118
368 Ga0373925_0670688 3300037068 Unclassified 855
369 Ga0436363_1112142 3300039450 Unclassified 697
370 Ga0451851_1152553 3300041507 Bacteria 589
371 Ga0453683_0150983 3300044673 Bacteria 1468
372 Ga0466963_0426899 3300044694 Unclassified 935
373 Ga0466964_0077146 3300044706 Unclassified 1422
374 Ga0453684_0001198 3300044712 Bacteria 80046
375 Ga0451576_0009774 3300045051 Bacteria 11085
376 Ga0451576_0022569 3300045051 Bacteria 6822
377 Ga0466967_0121996 3300045976 Bacteria 2410
378 Ga0495592_0690042 3300046454 Bacteria 615
379 Ga0495580_0003395 3300046472 Bacteria 13601
380 Ga0495580_0024108 3300046472 Bacteria 4459
381 Ga0495580_0026466 3300046472 Bacteria 4229
382 Ga0495580_0091522 3300046472 Bacteria 2117
383 Ga0495580_0095473 3300046472 Bacteria 2068
384 Ga0495580_0339932 3300046472 Unclassified 1018
385 Ga0495582_0130633 3300046473 Unclassified 1419
386 Ga0495594_0029024 3300046499 Bacteria 2988
387 Ga0495628_0599740 3300046516 Bacteria 787
388 Ga0495630_0323207 3300046517 Bacteria 1180
389 Ga0495630_0697777 3300046517 Unclassified 777
390 Ga0495623_0336584 3300046679 Bacteria 825
391 Ga0495669_0136946 3300046684 Bacteria 1155
392 Ga0495581_0100904 3300047315 Bacteria 1676
393 Ga0495593_0163313 3300047673 Unclassified 1124
394 Ga0495602_0119782 3300048088 Bacteria 2120
395 Ga0496100_0745604 3300048903 Unclassified 766
396 Ga0496101_0016712 3300048904 Bacteria 4965
397 Ga0496101_0045016 3300048904 Bacteria 3159
398 Ga0496102_0004200 3300048905 Bacteria 12182
399 Ga0496102_0047515 3300048905 Unclassified 3901
400 Ga0496102_0459855 3300048905 Bacteria 1193
401 Ga0496103_0040481 3300048906 Bacteria 2863
402 Ga0496103_0171153 3300048906 Bacteria 1395
403 Ga0496104_0010723 3300048907 Bacteria 8196
404 Ga0496104_0055373 3300048907 Unclassified 3750
405 Ga0496104_0059663 3300048907 Unclassified 3612
406 Ga0496105_0054934 3300048908 Unclassified 3288
407 Ga0496106_0008132 3300048909 Bacteria 7746
408 Ga0496106_0094099 3300048909 Bacteria 2316
409 Ga0496107_0025122 3300048910 Bacteria 4216
410 Ga0496107_0082312 3300048910 Bacteria 2347
411 Ga0496108_0026455 3300048911 Bacteria 4784
412 Ga0496108_0991268 3300048911 Bacteria 718
413 Ga0496109_0005826 3300048912 Bacteria 10325
414 Ga0496109_1246429 3300048912 Bacteria 680
415 Ga0496110_0007102 3300048913 Bacteria 8916
416 Ga0496111_0003397 3300048914 Bacteria 9845
417 Ga0496112_0013101 3300048915 Bacteria 7651
418 Ga0496112_0015991 3300048915 Bacteria 7016
419 Ga0496112_1168601 3300048915 Bacteria 687
420 Ga0496113_0002253 3300048916 Bacteria 11122
421 Ga0496114_0290966 3300048917 Bacteria 1441
422 Ga0496114_0299889 3300048917 Bacteria 1419
423 Ga0496114_0430350 3300048917 Bacteria 1169
424 Ga0496115_0042868 3300048918 Bacteria 3607
425 Ga0496115_0108189 3300048918 Bacteria 2283
426 Ga0496115_0261928 3300048918 Bacteria 1422
427 Ga0501032_0123152 3300049569 Bacteria 1713
428 Ga0501032_0341197 3300049569 Bacteria 965
429 Ga0501034_0299946 3300049571 Bacteria 1543
430 Ga0501079_0235607 3300049741 Bacteria 1430
431 Ga0501045_0275232 3300049824 Bacteria 1253
432 nmdc:mga05p37_1363323_c1 3300050507 Unclassified 717
433 nmdc:mga05p37_163503_c1 3300050507 Bacteria 2717
434 nmdc:mga05p37_341993_c1 3300050507 Unclassified 1374
435 nmdc:mga09592_203391_c1 3300050508 Unclassified 1715
436 nmdc:mga08y16_120614_c1 3300050511 Bacteria 2729
437 nmdc:mga08y16_355240_c1 3300050511 Bacteria 1505
438 nmdc:mga0n895_2321_c1 3300050512 Bacteria 14818
439 nmdc:mga0n895_753_c1 3300050512 Bacteria 22907
440 nmdc:mga0n895_896045_c1 3300050512 Bacteria 873
441 nmdc:mga0rr50_110_c2 3300050513 Bacteria 25403
442 nmdc:mga0rr50_20872_c2 3300050513 Bacteria 1428
443 nmdc:mga0rr50_292437_c1 3300050513 Bacteria 1361
444 nmdc:mga0rr50_470579_c1 3300050513 Bacteria 1067
445 nmdc:mga08x19_3831_c2 3300050514 Bacteria 3994
446 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
447 nmdc:mga0a205_432721_c1 3300050515 Bacteria 1177
448 Ga0495601_0211403 3300053077 Bacteria 1267
449 Ga0495619_0141432 3300053085 Bacteria 1657
450 Ga0587084_007067 3300059477 Bacteria 1383
451 Ga0587073_0010542 3300059492 Bacteria 1555
452 Ga0587077_033744 3300059493 Bacteria 990
453 Ga0587082_011630 3300059504 Bacteria 1291
454 Ga0587076_007155 3300059645 Bacteria 1514
455 Ga0587071_022524 3300060344 Bacteria 1164
456 Ga0265325_10022600
457 LJNas_1000046
458 Ga0058859_11784762
459 Ga0058860_11121876
460 Ga0065715_10122515
461 Ga0070658_10039311
462 Ga0070683_100244881
463 Ga0070670_100616315
464 Ga0070680_100040029
465 Ga0070680_100131707
466 Ga0070682_100007104
467 Ga0070682_100153275
468 Ga0068868_100094801
469 Ga0068868_100822812
470 Ga0070660_100007693
471 Ga0070689_100065490
472 Ga0070687_100053906
473 Ga0070661_100002233
474 Ga0070692_10164756
475 Ga0070668_100092176
476 Ga0070668_101103074
477 Ga0070669_100270711
478 Ga0070669_100493417
479 Ga0070675_100395674
480 Ga0070675_100509507
481 Ga0070671_100154881
482 Ga0070673_100084603
483 Ga0070659_100001713
484 Ga0070667_100459575
485 Ga0070703_10207259
486 Ga0070709_10000171
487 Ga0070709_10003271
488 Ga0070709_10033543
489 Ga0070709_10068342
490 Ga0070709_10686412
491 Ga0070714_100000202
492 Ga0070714_100009046
493 Ga0070714_100075046
494 Ga0070713_100000029
495 Ga0070713_100082106
496 Ga0070713_100127807
497 Ga0070713_100378623
498 Ga0070713_100402109
499 Ga0070713_100469081
500 Ga0070713_100573241
501 Ga0070710_10017964
502 Ga0070710_10039141
503 Ga0070710_10055566
504 Ga0070710_10298175
505 Ga0070701_10003850
506 Ga0070711_100000186
507 Ga0070711_100010132
508 Ga0070711_100118947
509 Ga0070711_101164182
510 Ga0070705_100533140
511 Ga0070700_100035040
512 Ga0070708_100000137
513 Ga0070708_100000957
514 Ga0070708_100032233
515 Ga0070708_100154415
516 Ga0070663_100032484
517 Ga0070678_100389209
518 Ga0070678_100586049
519 Ga0070662_100042363
520 Ga0070681_10000273
521 Ga0070681_10012065
522 Ga0070681_10024504
523 Ga0070685_10004291
524 Ga0070685_10031864
525 Ga0070706_100001324
526 Ga0070706_100009097
527 Ga0070706_100027117
528 Ga0070706_100192015
529 Ga0070706_101109583
530 Ga0070707_100000651
531 Ga0070707_100004004
532 Ga0070707_100048843
533 Ga0070707_100126287
534 Ga0070707_100255529
535 Ga0070707_100513656
536 Ga0070698_100000012
537 Ga0070698_100000902
538 Ga0070698_100005088
539 Ga0070698_100201308
540 Ga0070699_100000439
541 Ga0070699_100040774
542 Ga0070699_100051110
543 Ga0070699_100053693
544 Ga0070699_100133991
545 Ga0070699_100525441
546 Ga0070679_100001215
547 Ga0070679_100441602
548 Ga0070684_100077532
549 Ga0070697_100000031
550 Ga0070697_100000265
551 Ga0070697_100001672
552 Ga0070697_100001710
553 Ga0070697_100002228
554 Ga0070697_100008036
555 Ga0070697_100013158
556 Ga0070697_100084791
557 Ga0070697_100906529
558 Ga0068853_100333784
559 Ga0070686_100011047
560 Ga0070695_100005931
561 Ga0070695_100132498
562 Ga0070696_100616685
563 Ga0070693_100096021
564 Ga0070665_100000281
565 Ga0070665_101772243
566 Ga0070704_100080056
567 Ga0068855_100041979
568 Ga0068855_101207399
569 Ga0070664_100003501
570 Ga0070664_101408190
571 Ga0068854_100009349
572 Ga0068856_100005834
573 Ga0068856_100008688
574 Ga0068856_100075852
575 Ga0068852_100013118
576 Ga0068852_100813338
577 Ga0068859_100193273
578 Ga0068864_100516169
579 Ga0068866_10117861
580 Ga0068861_100235713
581 Ga0068851_10005283
582 Ga0068863_100061303
583 Ga0068863_100105533
584 Ga0068863_100205346
585 Ga0068863_100350129
586 Ga0068863_100878520
587 Ga0068858_101196045
588 Ga0068860_100889261
589 Ga0068862_100030209
590 Ga0068862_100183160
591 Ga0070717_10003549
592 Ga0070717_10021504
593 Ga0070717_10120939
594 Ga0070717_10189191
595 Ga0070717_10206344
596 Ga0070717_10543560
597 Ga0070715_10131251
598 Ga0070715_10154315
599 Ga0070715_10558083
600 Ga0070716_100001611
601 Ga0070716_100003773
602 Ga0070716_100018169
603 Ga0070716_100074133
604 Ga0070716_100155959
605 Ga0070716_100285900
606 Ga0070712_100000080
607 Ga0070712_100000089
608 Ga0070712_100018587
609 Ga0070712_100024447
610 Ga0070712_100303031
611 Ga0070712_100393797
612 Ga0097621_100327043
613 Ga0068871_100416402
614 Ga0068871_100861653
615 Ga0075428_100030488
616 Ga0075428_100296831
617 Ga0075431_101266032
618 Ga0075433_10003030
619 Ga0075434_100002333
620 Ga0075434_100007662
621 Ga0075434_100421007
622 Ga0075434_100717210
623 Ga0075429_100842669
624 Ga0068865_100912087
625 Ga0075436_100161608
626 Ga0097620_100193280
627 Ga0075435_100001773
628 Ga0075435_100305090
629 Ga0075435_100473552
630 Ga0105240_10170980
631 Ga0105240_10788807
632 Ga0111539_10235404
633 Ga0111539_10636941
634 Ga0105245_10133889
635 Ga0105247_10020800
636 Ga0105247_10242853
637 Ga0114129_10049429
638 Ga0114129_10080799
639 Ga0114129_10314735
640 Ga0105241_10042757
641 Ga0105241_10239799
642 Ga0105241_10489808
643 Ga0105241_10765926
644 Ga0105242_10328681
645 Ga0105248_10041542
646 Ga0105237_10037427
647 Ga0105237_10151963
648 Ga0105238_10005774
649 Ga0105238_10744309
650 Ga0105238_11112568
651 Ga0105249_10006145
652 Ga0105249_10100722
653 Ga0099796_10077291
654 Ga0105239_10037052
655 Ga0105246_10038528
656 Ga0157373_10042875
657 Ga0157370_10173367
658 Ga0157369_10040518
659 Ga0157374_10006871
660 Ga0157374_10408070
661 Ga0157378_10196613
662 Ga0157372_10023834
663 Ga0157372_10027404
664 Ga0157372_10284276
665 Ga0157372_10478731
666 Ga0157372_11964199
667 Ga0157375_10014314
668 Ga0157375_11414065
669 Ga0163163_10001892
670 Ga0163163_10082491
671 Ga0163163_10114766
672 Ga0157380_10110501
673 Ga0157380_11121444
674 Ga0182008_10002552
675 Ga0157377_10825117
676 Ga0157379_10002535
677 Ga0157376_10247292
678 Ga0182006_1011107
679 Ga0182007_10005966
680 Ga0182005_1006827
681 Ga0182005_1034713
682 Ga0163161_10015033
683 Ga0228598_1005826
684 Ga0207656_10019883
685 Ga0207653_10029734
686 Ga0207692_10003398
687 Ga0207692_10054196
688 Ga0207692_10061051
689 Ga0207692_10091055
690 Ga0207692_10430488
691 Ga0207710_10038594
692 Ga0207710_10049798
693 Ga0207647_10102360
694 Ga0207647_10361956
695 Ga0207685_10035213
696 Ga0207685_10046517
697 Ga0207685_10115650
698 Ga0207699_10004295
699 Ga0207699_10011262
700 Ga0207705_10026742
701 Ga0207705_10493788
702 Ga0207684_10000811
703 Ga0207684_10002954
704 Ga0207684_10003678
705 Ga0207684_10030221
706 Ga0207684_10042916
707 Ga0207684_10155979
708 Ga0207654_10086054
709 Ga0207707_10000008
710 Ga0207707_10005533
711 Ga0207695_10588219
712 Ga0207693_10000031
713 Ga0207693_10000082
714 Ga0207693_10035569
715 Ga0207663_10000784
716 Ga0207663_10026775
717 Ga0207663_10762245
718 Ga0207660_10007885
719 Ga0207660_10145043
720 Ga0207662_10035348
721 Ga0207657_10003255
722 Ga0207649_10005166
723 Ga0207652_10000065
724 Ga0207652_10341167
725 Ga0207646_10000287
726 Ga0207646_10000494
727 Ga0207646_10180372
728 Ga0207646_10294718
729 Ga0207646_10914110
730 Ga0207681_10029421
731 Ga0207681_10291595
732 Ga0207681_10316901
733 Ga0207694_10013526
734 Ga0207694_10533026
735 Ga0207659_10151001
736 Ga0207659_10208597
737 Ga0207700_10000160
738 Ga0207700_10000343
739 Ga0207700_10270950
740 Ga0207700_10640071
741 Ga0207700_11207635
742 Ga0207664_10015052
743 Ga0207664_10031292
744 Ga0207664_10331413
745 Ga0207690_10013184
746 Ga0207706_10031627
747 Ga0207704_10842601
748 Ga0207665_10003628
749 Ga0207665_10009932
750 Ga0207665_10070236
751 Ga0207665_10077014
752 Ga0207665_10103052
753 Ga0207665_10106933
754 Ga0207661_10172162
755 Ga0207679_10025162
756 Ga0207651_10152872
757 Ga0207712_10261072
758 Ga0207668_10013354
759 Ga0207668_10923956
760 Ga0207640_10013206
761 Ga0207677_10071574
762 Ga0207677_10680959
763 Ga0207677_10805800
764 Ga0207639_10028493
765 Ga0207678_10294791
766 Ga0207708_10062683
767 Ga0207708_10411008
768 Ga0207702_10062535
769 Ga0207702_10476504
770 Ga0207641_10095026
771 Ga0207641_10295053
772 Ga0207641_10327592
773 Ga0207641_11904978
774 Ga0207676_10792075
775 Ga0207675_100066285
776 Ga0207675_100191870
777 Ga0207683_10296077
778 Ga0207683_11114625
779 Ga0207698_10046797
780 Ga0207698_11047090
781 Ga0207428_10098113
782 Ga0265356_1006055
783 Ga0265355_1002153
784 Ga0268266_10000161
785 Ga0268265_10519562
786 Ga0268264_10852605
787 Ga0265338_10002130
788 Ga0265338_10102277
789 Ga0265338_10115134
790 Ga0265338_10202816
791 Ga0265762_1000253
792 Ga0265770_1002993
793 Ga0265765_1000976
794 Ga0265760_10076272
795 Ga0265760_10078549
796 Ga0265330_10014740
797 Ga0265330_10136837
798 Ga0265328_10018455
799 Ga0265325_10057734
800 Ga0265340_10046445
801 Ga0265339_10012191
802 Ga0265339_10024756
803 Ga0265339_10099308
804 Ga0265316_10017160
805 Ga0265316_10036382
806 Ga0265314_10008539
807 Ga0265314_10054081
808 Ga0373926_0203227
809 Ga0373934_0025144
810 Ga0373956_0012121
811 Ga0373943_0352658
812 Ga0373946_0289038
813 Ga0373955_0088095
814 Ga0373955_0547402
815 Ga0373955_0834779
816 Ga0373924_0351061
817 Ga0373935_0019303
818 Ga0373927_0021449
819 Ga0373933_0127743
820 Ga0373937_0005073
821 Ga0373937_0405733
822 Ga0373925_0009397
823 Ga0373925_0670688
824 Ga0436363_1112142
825 Ga0451851_1152553
826 Ga0453683_0150983
827 Ga0466963_0426899
828 Ga0466964_0077146
829 Ga0453684_0001198
830 Ga0451576_0009774
831 Ga0451576_0022569
832 Ga0466967_0121996
833 Ga0495592_0690042
834 Ga0495580_0003395
835 Ga0495580_0024108
836 Ga0495580_0026466
837 Ga0495580_0091522
838 Ga0495580_0095473
839 Ga0495580_0339932
840 Ga0495582_0130633
841 Ga0495594_0029024
842 Ga0495628_0599740
843 Ga0495630_0323207
844 Ga0495630_0697777
845 Ga0495623_0336584
846 Ga0495669_0136946
847 Ga0495581_0100904
848 Ga0495593_0163313
849 Ga0495602_0119782
850 Ga0496100_0745604
851 Ga0496101_0016712
852 Ga0496101_0045016
853 Ga0496102_0004200
854 Ga0496102_0047515
855 Ga0496102_0459855
856 Ga0496103_0040481
857 Ga0496103_0171153
858 Ga0496104_0010723
859 Ga0496104_0055373
860 Ga0496104_0059663
861 Ga0496105_0054934
862 Ga0496106_0008132
863 Ga0496106_0094099
864 Ga0496107_0025122
865 Ga0496107_0082312
866 Ga0496108_0026455
867 Ga0496108_0991268
868 Ga0496109_0005826
869 Ga0496109_1246429
870 Ga0496110_0007102
871 Ga0496111_0003397
872 Ga0496112_0013101
873 Ga0496112_0015991
874 Ga0496112_1168601
875 Ga0496113_0002253
876 Ga0496114_0290966
877 Ga0496114_0299889
878 Ga0496114_0430350
879 Ga0496115_0042868
880 Ga0496115_0108189
881 Ga0496115_0261928
882 Ga0501032_0123152
883 Ga0501032_0341197
884 Ga0501034_0299946
885 Ga0501079_0235607
886 Ga0501045_0275232
887 nmdc:mga05p37_1363323_c1
888 nmdc:mga05p37_163503_c1
889 nmdc:mga05p37_341993_c1
890 nmdc:mga09592_203391_c1
891 nmdc:mga08y16_120614_c1
892 nmdc:mga08y16_355240_c1
893 nmdc:mga0n895_2321_c1
894 nmdc:mga0n895_753_c1
895 nmdc:mga0n895_896045_c1
896 nmdc:mga0rr50_110_c2
897 nmdc:mga0rr50_20872_c2
898 nmdc:mga0rr50_292437_c1
899 nmdc:mga0rr50_470579_c1
900 nmdc:mga08x19_3831_c2
901 nmdc:mga0a205_131_c1
902 nmdc:mga0a205_432721_c1
903 Ga0495601_0211403
904 Ga0495619_0141432
905 Ga0587084_007067
906 Ga0587073_0010542
907 Ga0587077_033744
908 Ga0587082_011630
909 Ga0587076_007155
910 Ga0587071_022524

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11821

ActD

Alternative complex III, ActD subunit

35

203

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mhy-assembly1.cif.gz_C a new pii protein structure 0.7842 6 37
2j9d-assembly3.cif.gz_H structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.7761 6 37
2j9d-assembly3.cif.gz_G structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.7739 6 37
2j9d-assembly4.cif.gz_K structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.7701 6 37
1v9o-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.7633 6 37
ID Description Score Start End Superfamily
af_Q7T3C3_31_149_3.30.70.120 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7643 7 37 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7603 6 37 3.30.70.120
1nzaA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7349 7 44 3.30.70.120
1uflA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7335 6 37 3.30.70.120
3ahpA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7184 3 38 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.7941 1 164 GO:0016020
AF-A0A517R2X2-F1-model_v4 Cytochrome c domain-containing protein 0.7918 1 164 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A5C5Z1B8-F1-model_v4 Cytochrome c domain-containing protein 0.7917 2 164 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A2M9G325-F1-model_v4 DUF3341 domain-containing protein 0.7898 1 164 GO:0016020
AF-A0A4Q3J3X9-F1-model_v4 deleted 0.7893 5 164

Map