F447567

General Info

Members Datasets Scaffolds Average Seq Length
455 209 910 214

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10011743|Ga0105237_100117436
Length 243
Sequence LTEKRWLQKEQNQFCAXXXXLWLLNLRQTMKARVDAIIHRDQADYLDQLLTQNDPVLAEMEAYAAEHRVPIADREVARFLEITARATGARKALEIGMAIGYSVVHLVRGMGQDGLLVTIEPSDEMIQRATAYLERAGLRDRVRIERGKALEVMPGLNETFDLLFIDAVKEEYSHYLDLGLPRLRTGGVVIVDNLLWGGRVASDDDETSTVALREFNTYFINHPQLRAEVLSVGDGLGYAVKIS

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
168 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
172 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
173 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
174 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
175 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
176 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
177 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
180 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
181 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
182 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
183 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
184 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
185 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
186 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
187 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
188 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
193 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
194 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
195 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
196 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
197 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 0.88
Rhizosphere 97.36
Stem 0
Stem Tuber 0
Unclassified 17.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10011743 3300009545 Bacteria 9265
2 Ga0065714_10002183 3300005288 Bacteria 378167
3 Ga0065712_10000030 3300005290 Bacteria 237869
4 Ga0065712_10016272 3300005290 Bacteria 1810
5 Ga0065712_10081730 3300005290 Bacteria 2981
6 Ga0065712_10160518 3300005290 Unclassified 1306
7 Ga0065715_10010146 3300005293 Bacteria 4189
8 Ga0065715_10092595 3300005293 Bacteria 5034
9 Ga0065715_10155307 3300005293 Bacteria 1684
10 Ga0065715_10273891 3300005293 Bacteria 1104
11 Ga0065715_10382248 3300005293 Unclassified 906
12 Ga0070676_10240867 3300005328 Bacteria 1203
13 Ga0070690_100098702 3300005330 Unclassified 1933
14 Ga0070690_100117174 3300005330 Bacteria 1784
15 Ga0070670_100000057 3300005331 Bacteria 118540
16 Ga0070670_100072333 3300005331 Bacteria 2961
17 Ga0070670_100160586 3300005331 Bacteria 1948
18 Ga0070670_100219019 3300005331 Bacteria 1656
19 Ga0068869_100089487 3300005334 Bacteria 2312
20 Ga0068869_100401056 3300005334 Bacteria 1128
21 Ga0070680_100005730 3300005336 Bacteria 9423
22 Ga0070682_100011033 3300005337 Bacteria 5152
23 Ga0070682_100085064 3300005337 Bacteria 2057
24 Ga0070660_100538608 3300005339 Unclassified 973
25 Ga0070689_100001847 3300005340 Bacteria 13635
26 Ga0070661_100013069 3300005344 Bacteria 5823
27 Ga0070692_10072294 3300005345 Bacteria 1840
28 Ga0070692_10095137 3300005345 Bacteria 1625
29 Ga0070692_10111427 3300005345 Unclassified 1514
30 Ga0070692_10122208 3300005345 Bacteria 1453
31 Ga0070668_100002468 3300005347 Bacteria 13618
32 Ga0070668_100281832 3300005347 Bacteria 1388
33 Ga0070675_100364280 3300005354 Bacteria 1284
34 Ga0070675_100386656 3300005354 Unclassified 1246
35 Ga0070674_100148735 3300005356 Bacteria 1765
36 Ga0070688_100398778 3300005365 Unclassified 1018
37 Ga0070659_100004869 3300005366 Bacteria 9596
38 Ga0070701_10133422 3300005438 Bacteria 1413
39 Ga0070701_10214103 3300005438 Bacteria 1146
40 Ga0070705_100065906 3300005440 Bacteria 2170
41 Ga0070705_100431307 3300005440 Unclassified 984
42 Ga0070700_100000278 3300005441 Bacteria 27369
43 Ga0070700_100068770 3300005441 Unclassified 2253
44 Ga0070700_100189587 3300005441 Bacteria 1437
45 Ga0070700_100315695 3300005441 Unclassified 1146
46 Ga0070694_100014387 3300005444 Bacteria 4952
47 Ga0070694_100028850 3300005444 Bacteria 3615
48 Ga0070694_100175145 3300005444 Bacteria 1583
49 Ga0070694_100191085 3300005444 Bacteria 1520
50 Ga0070694_100676842 3300005444 Unclassified 837
51 Ga0070678_100413559 3300005456 Bacteria 1174
52 Ga0070662_100422441 3300005457 Bacteria 1103
53 Ga0070681_10000694 3300005458 Bacteria 27958
54 Ga0070681_10002764 3300005458 Bacteria 16194
55 Ga0068867_100249788 3300005459 Unclassified 1442
56 Ga0068867_100290089 3300005459 Bacteria 1345
57 Ga0070706_100000002 3300005467 Bacteria 326510
58 Ga0070706_100220676 3300005467 Bacteria 1769
59 Ga0070706_100353810 3300005467 Bacteria 1369
60 Ga0070707_100073756 3300005468 Bacteria 3290
61 Ga0070698_100004183 3300005471 Bacteria 15855
62 Ga0070699_100004594 3300005518 Bacteria 12214
63 Ga0070699_100216286 3300005518 Bacteria 1707
64 Ga0070699_100266303 3300005518 Bacteria 1533
65 Ga0070699_100311097 3300005518 Unclassified 1414
66 Ga0070679_100003161 3300005530 Bacteria 15050
67 Ga0070679_100480356 3300005530 Unclassified 1187
68 Ga0070679_100684433 3300005530 Bacteria 968
69 Ga0070697_100018441 3300005536 Bacteria 5501
70 Ga0070697_100030464 3300005536 Bacteria 4334
71 Ga0070697_100100349 3300005536 Bacteria 2404
72 Ga0068853_100008945 3300005539 Bacteria 8064
73 Ga0068853_100110685 3300005539 Bacteria 2439
74 Ga0070672_100779774 3300005543 Bacteria 840
75 Ga0070695_100021041 3300005545 Bacteria 3987
76 Ga0070695_100271914 3300005545 Unclassified 1241
77 Ga0070695_100620761 3300005545 Unclassified 851
78 Ga0070696_100020756 3300005546 Bacteria 4450
79 Ga0070696_100023653 3300005546 Bacteria 4176
80 Ga0070696_100123688 3300005546 Bacteria 1875
81 Ga0070696_100936771 3300005546 Bacteria 720
82 Ga0070693_100013483 3300005547 Bacteria 4163
83 Ga0070693_100061877 3300005547 Bacteria 2177
84 Ga0070704_100382098 3300005549 Bacteria 1197
85 Ga0070704_100419361 3300005549 Bacteria 1146
86 Ga0070664_100044659 3300005564 Bacteria 3741
87 Ga0070664_100208351 3300005564 Bacteria 1746
88 Ga0068857_100011274 3300005577 Bacteria 7774
89 Ga0068857_100043117 3300005577 Bacteria 4002
90 Ga0068857_100266458 3300005577 Bacteria 1573
91 Ga0068857_100329125 3300005577 Bacteria 1412
92 Ga0068854_100220029 3300005578 Bacteria 1502
93 Ga0070702_100003262 3300005615 Bacteria 7226
94 Ga0070702_100065767 3300005615 Bacteria 2124
95 Ga0070702_100332661 3300005615 Unclassified 1063
96 Ga0068852_100047693 3300005616 Bacteria 3656
97 Ga0068859_100004493 3300005617 Bacteria 14229
98 Ga0068859_100045034 3300005617 Bacteria 4433
99 Ga0068859_100094578 3300005617 Bacteria 3040
100 Ga0068859_100207197 3300005617 Bacteria 2046
101 Ga0068859_100246685 3300005617 Bacteria 1875
102 Ga0068859_100585198 3300005617 Bacteria 1210
103 Ga0068859_101487643 3300005617 Unclassified 747
104 Ga0068864_100013171 3300005618 Bacteria 6846
105 Ga0068864_100021556 3300005618 Bacteria 5397
106 Ga0068864_100036940 3300005618 Bacteria 4165
107 Ga0068864_100305242 3300005618 Unclassified 1491
108 Ga0068864_100451759 3300005618 Unclassified 1229
109 Ga0068864_100487028 3300005618 Bacteria 1185
110 Ga0068864_100906830 3300005618 Bacteria 871
111 Ga0068866_10014397 3300005718 Bacteria 3493
112 Ga0068861_100027560 3300005719 Unclassified 4139
113 Ga0068861_100054833 3300005719 Bacteria 3038
114 Ga0068861_100117326 3300005719 Bacteria 2142
115 Ga0068861_100941231 3300005719 Bacteria 821
116 Ga0068851_10003690 3300005834 Bacteria 6839
117 Ga0068863_100086311 3300005841 Unclassified 2973
118 Ga0068863_100706560 3300005841 Bacteria 1002
119 Ga0068863_100824317 3300005841 Bacteria 926
120 Ga0068858_100040522 3300005842 Bacteria 4320
121 Ga0068858_100070559 3300005842 Bacteria 3238
122 Ga0068858_100253063 3300005842 Bacteria 1673
123 Ga0068858_100256237 3300005842 Bacteria 1662
124 Ga0068858_100521063 3300005842 Bacteria 1149
125 Ga0068860_100019697 3300005843 Bacteria 6542
126 Ga0068860_100226422 3300005843 Unclassified 1816
127 Ga0068862_100115705 3300005844 Bacteria 2358
128 Ga0068862_100157639 3300005844 Bacteria 2025
129 Ga0068862_100410135 3300005844 Bacteria 1269
130 Ga0068862_100546334 3300005844 Bacteria 1106
131 Ga0068862_100937648 3300005844 Bacteria 853
132 Ga0081455_10057570 3300005937 Unclassified 3293
133 Ga0081539_10002825 3300005985 Bacteria 23207
134 Ga0070716_100056174 3300006173 Bacteria 2256
135 Ga0097621_100065360 3300006237 Bacteria 2993
136 Ga0097621_100203204 3300006237 Bacteria 1721
137 Ga0068871_100014229 3300006358 Bacteria 5925
138 Ga0075430_100014667 3300006846 Bacteria 6676
139 Ga0075430_100035479 3300006846 Bacteria 4231
140 Ga0075431_100056630 3300006847 Bacteria 4042
141 Ga0075431_100231896 3300006847 Bacteria 1880
142 Ga0075431_100813167 3300006847 Unclassified 907
143 Ga0075433_10099850 3300006852 Bacteria 2569
144 Ga0075433_10120705 3300006852 Bacteria 2327
145 Ga0075433_10177728 3300006852 Bacteria 1894
146 Ga0075434_100034192 3300006871 Bacteria 5019
147 Ga0075434_100034412 3300006871 Bacteria 5002
148 Ga0075434_100899667 3300006871 Bacteria 900
149 Ga0075429_100003452 3300006880 Bacteria 13491
150 Ga0068865_100108839 3300006881 Bacteria 2041
151 Ga0097620_100004493 3300006931 Bacteria 14229
152 Ga0097620_100045034 3300006931 Bacteria 4433
153 Ga0097620_100094576 3300006931 Bacteria 3040
154 Ga0097620_100207194 3300006931 Bacteria 2046
155 Ga0097620_100246705 3300006931 Bacteria 1875
156 Ga0097620_100585162 3300006931 Bacteria 1210
157 Ga0097620_101487735 3300006931 Unclassified 747
158 Ga0075435_100179800 3300007076 Bacteria 1787
159 Ga0099794_10023001 3300007265 Bacteria 2846
160 Ga0105251_10050784 3300009011 Bacteria 1980
161 Ga0105240_10225980 3300009093 Unclassified 2178
162 Ga0111539_10000646 3300009094 Bacteria 45013
163 Ga0111539_10026434 3300009094 Bacteria 7096
164 Ga0111539_10311694 3300009094 Bacteria 1831
165 Ga0105247_10006752 3300009101 Bacteria 7082
166 Ga0105247_10042645 3300009101 Bacteria 2779
167 Ga0114129_10018195 3300009147 Bacteria 10003
168 Ga0114129_10061487 3300009147 Bacteria 5248
169 Ga0114129_10066803 3300009147 Bacteria 5015
170 Ga0114129_10166311 3300009147 Bacteria 3010
171 Ga0114129_11468670 3300009147 Unclassified 839
172 Ga0105243_10320039 3300009148 Bacteria 1413
173 Ga0105243_10549199 3300009148 Bacteria 1103
174 Ga0105241_10087081 3300009174 Bacteria 2457
175 Ga0105241_10286981 3300009174 Bacteria 1408
176 Ga0105242_10029968 3300009176 Bacteria 4343
177 Ga0105242_10129765 3300009176 Bacteria 2174
178 Ga0105248_10003390 3300009177 Bacteria 17711
179 Ga0105248_10015403 3300009177 Bacteria 8432
180 Ga0105248_10024634 3300009177 Bacteria 6691
181 Ga0105248_10129467 3300009177 Bacteria 2847
182 Ga0105248_10148897 3300009177 Bacteria 2641
183 Ga0105237_10305302 3300009545 Bacteria 1594
184 Ga0105238_10003089 3300009551 Bacteria 16600
185 Ga0105238_10004315 3300009551 Bacteria 14104
186 Ga0105238_10314668 3300009551 Bacteria 1551
187 Ga0105249_10000227 3300009553 Bacteria 63667
188 Ga0105249_10015486 3300009553 Bacteria 6748
189 Ga0105249_10093770 3300009553 Unclassified 2813
190 Ga0105249_11010624 3300009553 Bacteria 900
191 Ga0105249_11375839 3300009553 Bacteria 778
192 Ga0105239_10303277 3300010375 Bacteria 1799
193 Ga0105239_10431238 3300010375 Unclassified 1494
194 Ga0105246_10074201 3300011119 Bacteria 2404
195 Ga0105246_10188672 3300011119 Bacteria 1594
196 Ga0105246_10704592 3300011119 Bacteria 885
197 Ga0157373_10011014 3300013100 Bacteria 6659
198 Ga0157371_10212710 3300013102 Bacteria 1388
199 Ga0157371_10625016 3300013102 Unclassified 802
200 Ga0157378_10034627 3300013297 Bacteria 4466
201 Ga0157378_10286956 3300013297 Bacteria 1588
202 Ga0157378_10365690 3300013297 Bacteria 1413
203 Ga0157378_10412067 3300013297 Bacteria 1334
204 Ga0157378_10499038 3300013297 Bacteria 1215
205 Ga0157378_10527540 3300013297 Unclassified 1183
206 Ga0157378_11202023 3300013297 Unclassified 797
207 Ga0163162_10000047 3300013306 Bacteria 123541
208 Ga0163162_10012422 3300013306 Bacteria 8318
209 Ga0163162_10206843 3300013306 Bacteria 2092
210 Ga0163162_10422932 3300013306 Bacteria 1464
211 Ga0157372_10330642 3300013307 Bacteria 1775
212 Ga0157372_10510917 3300013307 Unclassified 1401
213 Ga0157375_10031533 3300013308 Bacteria 5012
214 Ga0157375_10061035 3300013308 Bacteria 3742
215 Ga0157375_10140360 3300013308 Bacteria 2543
216 Ga0157375_10503519 3300013308 Unclassified 1375
217 Ga0157375_10761023 3300013308 Unclassified 1119
218 Ga0163163_10000765 3300014325 Bacteria 27327
219 Ga0163163_10009189 3300014325 Bacteria 8810
220 Ga0163163_10036658 3300014325 Bacteria 4765
221 Ga0163163_10051080 3300014325 Unclassified 4075
222 Ga0163163_10091230 3300014325 Bacteria 3061
223 Ga0163163_10145793 3300014325 Bacteria 2411
224 Ga0163163_10326516 3300014325 Bacteria 1588
225 Ga0163163_11020236 3300014325 Unclassified 891
226 Ga0157380_10008751 3300014326 Bacteria 7232
227 Ga0157380_10017603 3300014326 Bacteria 5289
228 Ga0157380_10037954 3300014326 Bacteria 3737
229 Ga0157380_10415922 3300014326 Unclassified 1281
230 Ga0157380_10441191 3300014326 Bacteria 1247
231 Ga0157380_11010754 3300014326 Unclassified 865
232 Ga0157377_10487382 3300014745 Unclassified 859
233 Ga0213876_10000043 3300021384 Bacteria 162257
234 Ga0213876_10000535 3300021384 Bacteria 28746
235 Ga0213876_10266938 3300021384 Bacteria 909
236 Ga0207672_1000887 3300025223 Bacteria 3035
237 Ga0207697_10119598 3300025315 Bacteria 1133
238 Ga0207656_10000688 3300025321 Bacteria 11066
239 Ga0207653_10015478 3300025885 Bacteria 2393
240 Ga0207642_10037761 3300025899 Bacteria 2084
241 Ga0207710_10000001 3300025900 Bacteria 1797433
242 Ga0207710_10000656 3300025900 Bacteria 19566
243 Ga0207710_10031204 3300025900 Bacteria 2329
244 Ga0207647_10008763 3300025904 Bacteria 7223
245 Ga0207647_10296935 3300025904 Bacteria 920
246 Ga0207685_10000015 3300025905 Bacteria 170813
247 Ga0207643_10001788 3300025908 Bacteria 11966
248 Ga0207643_10040298 3300025908 Unclassified 2629
249 Ga0207643_10394696 3300025908 Bacteria 874
250 Ga0207684_10000076 3300025910 Bacteria 183107
251 Ga0207684_10038975 3300025910 Bacteria 4032
252 Ga0207654_10055212 3300025911 Bacteria 2299
253 Ga0207654_10276030 3300025911 Unclassified 1135
254 Ga0207707_10015755 3300025912 Bacteria 6590
255 Ga0207707_10034258 3300025912 Bacteria 4442
256 Ga0207695_10264945 3300025913 Unclassified 1615
257 Ga0207671_10091091 3300025914 Bacteria 2297
258 Ga0207671_10287427 3300025914 Bacteria 1298
259 Ga0207660_10072385 3300025917 Bacteria 2510
260 Ga0207662_10077826 3300025918 Bacteria 2018
261 Ga0207662_10201563 3300025918 Bacteria 1288
262 Ga0207652_10023266 3300025921 Bacteria 5131
263 Ga0207646_10311220 3300025922 Unclassified 1423
264 Ga0207681_10350542 3300025923 Bacteria 1182
265 Ga0207694_10001553 3300025924 Bacteria 19484
266 Ga0207694_10152426 3300025924 Unclassified 1863
267 Ga0207694_10529611 3300025924 Bacteria 988
268 Ga0207650_10000027 3300025925 Bacteria 257466
269 Ga0207650_10025602 3300025925 Bacteria 4204
270 Ga0207650_10147078 3300025925 Unclassified 1857
271 Ga0207650_10217309 3300025925 Bacteria 1537
272 Ga0207650_10271068 3300025925 Bacteria 1379
273 Ga0207659_10262173 3300025926 Unclassified 1406
274 Ga0207659_10331276 3300025926 Unclassified 1259
275 Ga0207659_10985859 3300025926 Bacteria 725
276 Ga0207644_10000671 3300025931 Bacteria 21612
277 Ga0207644_10127590 3300025931 Bacteria 1943
278 Ga0207690_10479108 3300025932 Unclassified 1004
279 Ga0207686_10037726 3300025934 Bacteria 2918
280 Ga0207709_10001213 3300025935 Bacteria 18538
281 Ga0207709_10160708 3300025935 Bacteria 1566
282 Ga0207670_10000488 3300025936 Bacteria 21872
283 Ga0207669_10122989 3300025937 Bacteria 1766
284 Ga0207704_10012570 3300025938 Bacteria 4206
285 Ga0207665_10078175 3300025939 Bacteria 2272
286 Ga0207711_10023396 3300025941 Bacteria 5173
287 Ga0207711_10050625 3300025941 Bacteria 3556
288 Ga0207711_10494702 3300025941 Bacteria 1139
289 Ga0207711_10738337 3300025941 Bacteria 918
290 Ga0207689_10176915 3300025942 Bacteria 1760
291 Ga0207689_10246471 3300025942 Bacteria 1477
292 Ga0207689_10353148 3300025942 Bacteria 1222
293 Ga0207689_10359751 3300025942 Bacteria 1210
294 Ga0207679_10259492 3300025945 Unclassified 1481
295 Ga0207679_10405195 3300025945 Unclassified 1200
296 Ga0207679_10631698 3300025945 Bacteria 967
297 Ga0207679_11005548 3300025945 Unclassified 764
298 Ga0207667_10321337 3300025949 Unclassified 1581
299 Ga0207651_10084819 3300025960 Bacteria 2296
300 Ga0207651_10823345 3300025960 Unclassified 824
301 Ga0207712_10015262 3300025961 Unclassified 4952
302 Ga0207712_10023572 3300025961 Bacteria 4064
303 Ga0207712_10027117 3300025961 Bacteria 3823
304 Ga0207668_10013299 3300025972 Bacteria 5063
305 Ga0207640_10020305 3300025981 Bacteria 3943
306 Ga0207640_10315542 3300025981 Unclassified 1242
307 Ga0207677_10179685 3300026023 Bacteria 1663
308 Ga0207703_10000024 3300026035 Bacteria 217968
309 Ga0207703_10022237 3300026035 Bacteria 4972
310 Ga0207703_10078356 3300026035 Bacteria 2745
311 Ga0207703_10084109 3300026035 Bacteria 2660
312 Ga0207703_10527724 3300026035 Bacteria 1111
313 Ga0207703_10970835 3300026035 Unclassified 815
314 Ga0207639_10094489 3300026041 Bacteria 2400
315 Ga0207639_10662109 3300026041 Bacteria 967
316 Ga0207708_10000807 3300026075 Bacteria 23594
317 Ga0207708_10024518 3300026075 Bacteria 4563
318 Ga0207708_10037645 3300026075 Unclassified 3684
319 Ga0207708_10098284 3300026075 Unclassified 2263
320 Ga0207708_10261221 3300026075 Bacteria 1398
321 Ga0207641_10013984 3300026088 Bacteria 6579
322 Ga0207641_10125072 3300026088 Bacteria 2301
323 Ga0207641_10263466 3300026088 Bacteria 1615
324 Ga0207641_10271079 3300026088 Bacteria 1593
325 Ga0207641_10338450 3300026088 Bacteria 1431
326 Ga0207648_10027858 3300026089 Bacteria 5012
327 Ga0207648_10107140 3300026089 Bacteria 2453
328 Ga0207676_10004568 3300026095 Bacteria 9806
329 Ga0207676_10019195 3300026095 Bacteria 4982
330 Ga0207676_10123447 3300026095 Unclassified 2188
331 Ga0207676_10127198 3300026095 Bacteria 2160
332 Ga0207676_10780689 3300026095 Unclassified 931
333 Ga0207674_10000392 3300026116 Bacteria 56723
334 Ga0207674_10074533 3300026116 Bacteria 3405
335 Ga0207674_10221874 3300026116 Bacteria 1838
336 Ga0207674_10334819 3300026116 Bacteria 1463
337 Ga0207675_100003724 3300026118 Bacteria 14846
338 Ga0207675_100005660 3300026118 Bacteria 11963
339 Ga0207675_100013066 3300026118 Bacteria 7750
340 Ga0207675_100024591 3300026118 Bacteria 5600
341 Ga0207675_100201092 3300026118 Bacteria 1914
342 Ga0207675_100291453 3300026118 Bacteria 1588
343 Ga0207683_10586288 3300026121 Unclassified 1032
344 Ga0207698_10591272 3300026142 Unclassified 1093
345 Ga0207428_10004527 3300027907 Bacteria 13186
346 Ga0268265_10127328 3300028380 Bacteria 2110
347 Ga0268265_10254873 3300028380 Bacteria 1557
348 Ga0268265_10351434 3300028380 Bacteria 1346
349 Ga0268265_10397890 3300028380 Unclassified 1272
350 Ga0268264_10000421 3300028381 Bacteria 59726
351 Ga0268264_10496746 3300028381 Bacteria 1189
352 Ga0307515_10234303 3300028794 Bacteria 1621
353 Ga0307408_100027439 3300031548 Bacteria 3923
354 Ga0307408_100110802 3300031548 Bacteria 2108
355 Ga0307408_100176432 3300031548 Unclassified 1710
356 Ga0307408_100239438 3300031548 Bacteria 1491
357 Ga0307405_10027187 3300031731 Bacteria 3313
358 Ga0307405_10448676 3300031731 Bacteria 1022
359 Ga0307413_10408649 3300031824 Bacteria 1066
360 Ga0307410_10217595 3300031852 Bacteria 1468
361 Ga0307406_10019941 3300031901 Bacteria 3940
362 Ga0307406_10150028 3300031901 Bacteria 1662
363 Ga0307412_10003086 3300031911 Bacteria 9242
364 Ga0307416_100057625 3300032002 Bacteria 3144
365 Ga0307416_101039732 3300032002 Bacteria 923
366 Ga0307414_10000777 3300032004 Bacteria 16349
367 Ga0307414_10218805 3300032004 Bacteria 1562
368 Ga0307414_11007770 3300032004 Bacteria 767
369 Ga0307411_10075999 3300032005 Bacteria 2295
370 Ga0307411_10444105 3300032005 Bacteria 1083
371 Ga0307415_100049132 3300032126 Bacteria 2850
372 Ga0307415_100137660 3300032126 Bacteria 1860
373 Ga0307415_100412515 3300032126 Unclassified 1156
374 Ga0373941_0043105 3300035115 Bacteria 1403
375 Ga0395898_0882948 3300037466 Unclassified 833
376 Ga0242420_028112 3300038996 Bacteria 1034
377 Ga0436365_0421852 3300039437 Bacteria 162876
378 Ga0436365_0963059 3300039437 Bacteria 1110
379 Ga0436365_1158192 3300039437 Bacteria 75272
380 Ga0439455_0001755 3300042012 Bacteria 3760
381 Ga0439458_0005176 3300042157 Bacteria 2939
382 Ga0451576_0164995 3300045051 Bacteria 2311
383 Ga0451576_0942079 3300045051 Bacteria 906
384 Ga0495663_0003115 3300046525 Bacteria 4840
385 Ga0495598_0002056 3300046537 Bacteria 4097
386 Ga0495621_0000095 3300046539 Bacteria 18053
387 Ga0496104_0157183 3300048907 Bacteria 2182
388 Ga0496110_0426342 3300048913 Unclassified 1209
389 Ga0496112_0131973 3300048915 Bacteria 2469
390 Ga0496112_0843341 3300048915 Bacteria 840
391 Ga0501298_024105 3300049521 Bacteria 1157
392 Ga0501311_011243 3300049527 Bacteria 1100
393 Ga0501038_0108897 3300049574 Bacteria 2296
394 Ga0501038_0434911 3300049574 Bacteria 1011
395 Ga0501072_0919211 3300049588 Unclassified 683
396 Ga0501198_082373 3300049649 Unclassified 625
397 Ga0501199_004817 3300049650 Bacteria 1341
398 Ga0501202_001725 3300049652 Bacteria 3552
399 Ga0501206_019315 3300049653 Unclassified 964
400 Ga0501207_000044 3300049654 Bacteria 8967
401 Ga0501209_039926 3300049656 Bacteria 1237
402 Ga0501209_055188 3300049656 Bacteria 1095
403 Ga0501216_005092 3300049660 Bacteria 1971
404 Ga0501216_009757 3300049660 Bacteria 1535
405 Ga0501217_002002 3300049661 Bacteria 3933
406 Ga0501223_007754 3300049663 Bacteria 2192
407 Ga0501223_019119 3300049663 Bacteria 1347
408 Ga0501223_036994 3300049663 Bacteria 948
409 Ga0501224_000257 3300049664 Bacteria 6064
410 Ga0501224_018221 3300049664 Unclassified 1046
411 Ga0501227_008561 3300049665 Bacteria 2195
412 Ga0501233_011148 3300049668 Bacteria 1782
413 Ga0501235_003189 3300049669 Bacteria 3534
414 Ga0501236_002506 3300049670 Bacteria 2111
415 Ga0501238_032747 3300049671 Unclassified 754
416 Ga0501243_020034 3300049675 Bacteria 1098
417 Ga0501253_002300 3300049683 Bacteria 2130
418 Ga0501260_004778 3300049689 Bacteria 1259
419 Ga0501221_108083 3300049704 Bacteria 698
420 Ga0501225_0001541 3300049705 Bacteria 7241
421 Ga0501225_0015021 3300049705 Bacteria 2160
422 Ga0501234_006277 3300049707 Bacteria 1860
423 Ga0501245_004249 3300049708 Unclassified 1964
424 Ga0501268_023559 3300049765 Unclassified 1070
425 Ga0501273_005377 3300049770 Bacteria 1444
426 Ga0501204_015485 3300049850 Bacteria 948
427 Ga0501212_014136 3300049851 Bacteria 1178
428 Ga0501226_004941 3300049853 Unclassified 1529
429 nmdc:mga05p37_136119_c1 3300050507 Bacteria 3012
430 nmdc:mga05p37_163443_c1 3300050507 Bacteria 2718
431 nmdc:mga05p37_170049_c1 3300050507 Bacteria 2658
432 nmdc:mga05p37_70106_c1 3300050507 Bacteria 4312
433 nmdc:mga09592_136074_c1 3300050508 Bacteria 2116
434 nmdc:mga09592_71006_c1 3300050508 Bacteria 2955
435 nmdc:mga0qj67_41881_c1 3300050509 Bacteria 3604
436 nmdc:mga06r32_124141_c1 3300050510 Bacteria 2548
437 nmdc:mga06r32_176285_c1 3300050510 Bacteria 2122
438 nmdc:mga06r32_574569_c1 3300050510 Bacteria 1100
439 nmdc:mga06r32_74129_c1 3300050510 Bacteria 3298
440 nmdc:mga08y16_5374_c1 3300050511 Bacteria 13395
441 nmdc:mga0n895_140318_c1 3300050512 Bacteria 2445
442 nmdc:mga0n895_28606_c1 3300050512 Bacteria 5303
443 nmdc:mga0n895_792603_c1 3300050512 Bacteria 938
444 nmdc:mga0n895_955417_c1 3300050512 Unclassified 840
445 nmdc:mga0rr50_276063_c1 3300050513 Bacteria 1401
446 nmdc:mga0rr50_884646_c1 3300050513 Unclassified 762
447 nmdc:mga08x19_3974_c2 3300050514 Bacteria 7926
448 nmdc:mga0a205_182890_c1 3300050515 Bacteria 1990
449 nmdc:mga0a205_186325_c1 3300050515 Bacteria 1968
450 nmdc:mga0a205_577940_c1 3300050515 Unclassified 978
451 nmdc:mga0a205_64484_c1 3300050515 Bacteria 3538
452 Ga0500616_0001231 3300053153 Bacteria 25700
453 Ga0501084_0266310 3300054114 Bacteria 1447
454 Ga0530510_0065039 3300061734 Unclassified 2642
455 Ga0530510_0138019 3300061734 Bacteria 1795
456 Ga0105237_10011743
457 Ga0065714_10002183
458 Ga0065712_10000030
459 Ga0065712_10016272
460 Ga0065712_10081730
461 Ga0065712_10160518
462 Ga0065715_10010146
463 Ga0065715_10092595
464 Ga0065715_10155307
465 Ga0065715_10273891
466 Ga0065715_10382248
467 Ga0070676_10240867
468 Ga0070690_100098702
469 Ga0070690_100117174
470 Ga0070670_100000057
471 Ga0070670_100072333
472 Ga0070670_100160586
473 Ga0070670_100219019
474 Ga0068869_100089487
475 Ga0068869_100401056
476 Ga0070680_100005730
477 Ga0070682_100011033
478 Ga0070682_100085064
479 Ga0070660_100538608
480 Ga0070689_100001847
481 Ga0070661_100013069
482 Ga0070692_10072294
483 Ga0070692_10095137
484 Ga0070692_10111427
485 Ga0070692_10122208
486 Ga0070668_100002468
487 Ga0070668_100281832
488 Ga0070675_100364280
489 Ga0070675_100386656
490 Ga0070674_100148735
491 Ga0070688_100398778
492 Ga0070659_100004869
493 Ga0070701_10133422
494 Ga0070701_10214103
495 Ga0070705_100065906
496 Ga0070705_100431307
497 Ga0070700_100000278
498 Ga0070700_100068770
499 Ga0070700_100189587
500 Ga0070700_100315695
501 Ga0070694_100014387
502 Ga0070694_100028850
503 Ga0070694_100175145
504 Ga0070694_100191085
505 Ga0070694_100676842
506 Ga0070678_100413559
507 Ga0070662_100422441
508 Ga0070681_10000694
509 Ga0070681_10002764
510 Ga0068867_100249788
511 Ga0068867_100290089
512 Ga0070706_100000002
513 Ga0070706_100220676
514 Ga0070706_100353810
515 Ga0070707_100073756
516 Ga0070698_100004183
517 Ga0070699_100004594
518 Ga0070699_100216286
519 Ga0070699_100266303
520 Ga0070699_100311097
521 Ga0070679_100003161
522 Ga0070679_100480356
523 Ga0070679_100684433
524 Ga0070697_100018441
525 Ga0070697_100030464
526 Ga0070697_100100349
527 Ga0068853_100008945
528 Ga0068853_100110685
529 Ga0070672_100779774
530 Ga0070695_100021041
531 Ga0070695_100271914
532 Ga0070695_100620761
533 Ga0070696_100020756
534 Ga0070696_100023653
535 Ga0070696_100123688
536 Ga0070696_100936771
537 Ga0070693_100013483
538 Ga0070693_100061877
539 Ga0070704_100382098
540 Ga0070704_100419361
541 Ga0070664_100044659
542 Ga0070664_100208351
543 Ga0068857_100011274
544 Ga0068857_100043117
545 Ga0068857_100266458
546 Ga0068857_100329125
547 Ga0068854_100220029
548 Ga0070702_100003262
549 Ga0070702_100065767
550 Ga0070702_100332661
551 Ga0068852_100047693
552 Ga0068859_100004493
553 Ga0068859_100045034
554 Ga0068859_100094578
555 Ga0068859_100207197
556 Ga0068859_100246685
557 Ga0068859_100585198
558 Ga0068859_101487643
559 Ga0068864_100013171
560 Ga0068864_100021556
561 Ga0068864_100036940
562 Ga0068864_100305242
563 Ga0068864_100451759
564 Ga0068864_100487028
565 Ga0068864_100906830
566 Ga0068866_10014397
567 Ga0068861_100027560
568 Ga0068861_100054833
569 Ga0068861_100117326
570 Ga0068861_100941231
571 Ga0068851_10003690
572 Ga0068863_100086311
573 Ga0068863_100706560
574 Ga0068863_100824317
575 Ga0068858_100040522
576 Ga0068858_100070559
577 Ga0068858_100253063
578 Ga0068858_100256237
579 Ga0068858_100521063
580 Ga0068860_100019697
581 Ga0068860_100226422
582 Ga0068862_100115705
583 Ga0068862_100157639
584 Ga0068862_100410135
585 Ga0068862_100546334
586 Ga0068862_100937648
587 Ga0081455_10057570
588 Ga0081539_10002825
589 Ga0070716_100056174
590 Ga0097621_100065360
591 Ga0097621_100203204
592 Ga0068871_100014229
593 Ga0075430_100014667
594 Ga0075430_100035479
595 Ga0075431_100056630
596 Ga0075431_100231896
597 Ga0075431_100813167
598 Ga0075433_10099850
599 Ga0075433_10120705
600 Ga0075433_10177728
601 Ga0075434_100034192
602 Ga0075434_100034412
603 Ga0075434_100899667
604 Ga0075429_100003452
605 Ga0068865_100108839
606 Ga0097620_100004493
607 Ga0097620_100045034
608 Ga0097620_100094576
609 Ga0097620_100207194
610 Ga0097620_100246705
611 Ga0097620_100585162
612 Ga0097620_101487735
613 Ga0075435_100179800
614 Ga0099794_10023001
615 Ga0105251_10050784
616 Ga0105240_10225980
617 Ga0111539_10000646
618 Ga0111539_10026434
619 Ga0111539_10311694
620 Ga0105247_10006752
621 Ga0105247_10042645
622 Ga0114129_10018195
623 Ga0114129_10061487
624 Ga0114129_10066803
625 Ga0114129_10166311
626 Ga0114129_11468670
627 Ga0105243_10320039
628 Ga0105243_10549199
629 Ga0105241_10087081
630 Ga0105241_10286981
631 Ga0105242_10029968
632 Ga0105242_10129765
633 Ga0105248_10003390
634 Ga0105248_10015403
635 Ga0105248_10024634
636 Ga0105248_10129467
637 Ga0105248_10148897
638 Ga0105237_10305302
639 Ga0105238_10003089
640 Ga0105238_10004315
641 Ga0105238_10314668
642 Ga0105249_10000227
643 Ga0105249_10015486
644 Ga0105249_10093770
645 Ga0105249_11010624
646 Ga0105249_11375839
647 Ga0105239_10303277
648 Ga0105239_10431238
649 Ga0105246_10074201
650 Ga0105246_10188672
651 Ga0105246_10704592
652 Ga0157373_10011014
653 Ga0157371_10212710
654 Ga0157371_10625016
655 Ga0157378_10034627
656 Ga0157378_10286956
657 Ga0157378_10365690
658 Ga0157378_10412067
659 Ga0157378_10499038
660 Ga0157378_10527540
661 Ga0157378_11202023
662 Ga0163162_10000047
663 Ga0163162_10012422
664 Ga0163162_10206843
665 Ga0163162_10422932
666 Ga0157372_10330642
667 Ga0157372_10510917
668 Ga0157375_10031533
669 Ga0157375_10061035
670 Ga0157375_10140360
671 Ga0157375_10503519
672 Ga0157375_10761023
673 Ga0163163_10000765
674 Ga0163163_10009189
675 Ga0163163_10036658
676 Ga0163163_10051080
677 Ga0163163_10091230
678 Ga0163163_10145793
679 Ga0163163_10326516
680 Ga0163163_11020236
681 Ga0157380_10008751
682 Ga0157380_10017603
683 Ga0157380_10037954
684 Ga0157380_10415922
685 Ga0157380_10441191
686 Ga0157380_11010754
687 Ga0157377_10487382
688 Ga0213876_10000043
689 Ga0213876_10000535
690 Ga0213876_10266938
691 Ga0207672_1000887
692 Ga0207697_10119598
693 Ga0207656_10000688
694 Ga0207653_10015478
695 Ga0207642_10037761
696 Ga0207710_10000001
697 Ga0207710_10000656
698 Ga0207710_10031204
699 Ga0207647_10008763
700 Ga0207647_10296935
701 Ga0207685_10000015
702 Ga0207643_10001788
703 Ga0207643_10040298
704 Ga0207643_10394696
705 Ga0207684_10000076
706 Ga0207684_10038975
707 Ga0207654_10055212
708 Ga0207654_10276030
709 Ga0207707_10015755
710 Ga0207707_10034258
711 Ga0207695_10264945
712 Ga0207671_10091091
713 Ga0207671_10287427
714 Ga0207660_10072385
715 Ga0207662_10077826
716 Ga0207662_10201563
717 Ga0207652_10023266
718 Ga0207646_10311220
719 Ga0207681_10350542
720 Ga0207694_10001553
721 Ga0207694_10152426
722 Ga0207694_10529611
723 Ga0207650_10000027
724 Ga0207650_10025602
725 Ga0207650_10147078
726 Ga0207650_10217309
727 Ga0207650_10271068
728 Ga0207659_10262173
729 Ga0207659_10331276
730 Ga0207659_10985859
731 Ga0207644_10000671
732 Ga0207644_10127590
733 Ga0207690_10479108
734 Ga0207686_10037726
735 Ga0207709_10001213
736 Ga0207709_10160708
737 Ga0207670_10000488
738 Ga0207669_10122989
739 Ga0207704_10012570
740 Ga0207665_10078175
741 Ga0207711_10023396
742 Ga0207711_10050625
743 Ga0207711_10494702
744 Ga0207711_10738337
745 Ga0207689_10176915
746 Ga0207689_10246471
747 Ga0207689_10353148
748 Ga0207689_10359751
749 Ga0207679_10259492
750 Ga0207679_10405195
751 Ga0207679_10631698
752 Ga0207679_11005548
753 Ga0207667_10321337
754 Ga0207651_10084819
755 Ga0207651_10823345
756 Ga0207712_10015262
757 Ga0207712_10023572
758 Ga0207712_10027117
759 Ga0207668_10013299
760 Ga0207640_10020305
761 Ga0207640_10315542
762 Ga0207677_10179685
763 Ga0207703_10000024
764 Ga0207703_10022237
765 Ga0207703_10078356
766 Ga0207703_10084109
767 Ga0207703_10527724
768 Ga0207703_10970835
769 Ga0207639_10094489
770 Ga0207639_10662109
771 Ga0207708_10000807
772 Ga0207708_10024518
773 Ga0207708_10037645
774 Ga0207708_10098284
775 Ga0207708_10261221
776 Ga0207641_10013984
777 Ga0207641_10125072
778 Ga0207641_10263466
779 Ga0207641_10271079
780 Ga0207641_10338450
781 Ga0207648_10027858
782 Ga0207648_10107140
783 Ga0207676_10004568
784 Ga0207676_10019195
785 Ga0207676_10123447
786 Ga0207676_10127198
787 Ga0207676_10780689
788 Ga0207674_10000392
789 Ga0207674_10074533
790 Ga0207674_10221874
791 Ga0207674_10334819
792 Ga0207675_100003724
793 Ga0207675_100005660
794 Ga0207675_100013066
795 Ga0207675_100024591
796 Ga0207675_100201092
797 Ga0207675_100291453
798 Ga0207683_10586288
799 Ga0207698_10591272
800 Ga0207428_10004527
801 Ga0268265_10127328
802 Ga0268265_10254873
803 Ga0268265_10351434
804 Ga0268265_10397890
805 Ga0268264_10000421
806 Ga0268264_10496746
807 Ga0307515_10234303
808 Ga0307408_100027439
809 Ga0307408_100110802
810 Ga0307408_100176432
811 Ga0307408_100239438
812 Ga0307405_10027187
813 Ga0307405_10448676
814 Ga0307413_10408649
815 Ga0307410_10217595
816 Ga0307406_10019941
817 Ga0307406_10150028
818 Ga0307412_10003086
819 Ga0307416_100057625
820 Ga0307416_101039732
821 Ga0307414_10000777
822 Ga0307414_10218805
823 Ga0307414_11007770
824 Ga0307411_10075999
825 Ga0307411_10444105
826 Ga0307415_100049132
827 Ga0307415_100137660
828 Ga0307415_100412515
829 Ga0373941_0043105
830 Ga0395898_0882948
831 Ga0242420_028112
832 Ga0436365_0421852
833 Ga0436365_0963059
834 Ga0436365_1158192
835 Ga0439455_0001755
836 Ga0439458_0005176
837 Ga0451576_0164995
838 Ga0451576_0942079
839 Ga0495663_0003115
840 Ga0495598_0002056
841 Ga0495621_0000095
842 Ga0496104_0157183
843 Ga0496110_0426342
844 Ga0496112_0131973
845 Ga0496112_0843341
846 Ga0501298_024105
847 Ga0501311_011243
848 Ga0501038_0108897
849 Ga0501038_0434911
850 Ga0501072_0919211
851 Ga0501198_082373
852 Ga0501199_004817
853 Ga0501202_001725
854 Ga0501206_019315
855 Ga0501207_000044
856 Ga0501209_039926
857 Ga0501209_055188
858 Ga0501216_005092
859 Ga0501216_009757
860 Ga0501217_002002
861 Ga0501223_007754
862 Ga0501223_019119
863 Ga0501223_036994
864 Ga0501224_000257
865 Ga0501224_018221
866 Ga0501227_008561
867 Ga0501233_011148
868 Ga0501235_003189
869 Ga0501236_002506
870 Ga0501238_032747
871 Ga0501243_020034
872 Ga0501253_002300
873 Ga0501260_004778
874 Ga0501221_108083
875 Ga0501225_0001541
876 Ga0501225_0015021
877 Ga0501234_006277
878 Ga0501245_004249
879 Ga0501268_023559
880 Ga0501273_005377
881 Ga0501204_015485
882 Ga0501212_014136
883 Ga0501226_004941
884 nmdc:mga05p37_136119_c1
885 nmdc:mga05p37_163443_c1
886 nmdc:mga05p37_170049_c1
887 nmdc:mga05p37_70106_c1
888 nmdc:mga09592_136074_c1
889 nmdc:mga09592_71006_c1
890 nmdc:mga0qj67_41881_c1
891 nmdc:mga06r32_124141_c1
892 nmdc:mga06r32_176285_c1
893 nmdc:mga06r32_574569_c1
894 nmdc:mga06r32_74129_c1
895 nmdc:mga08y16_5374_c1
896 nmdc:mga0n895_140318_c1
897 nmdc:mga0n895_28606_c1
898 nmdc:mga0n895_792603_c1
899 nmdc:mga0n895_955417_c1
900 nmdc:mga0rr50_276063_c1
901 nmdc:mga0rr50_884646_c1
902 nmdc:mga08x19_3974_c2
903 nmdc:mga0a205_182890_c1
904 nmdc:mga0a205_186325_c1
905 nmdc:mga0a205_577940_c1
906 nmdc:mga0a205_64484_c1
907 Ga0500616_0001231
908 Ga0501084_0266310
909 Ga0530510_0065039
910 Ga0530510_0138019

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13578

Methyltransf_24

Methyltransferase domain

93

194

0.97

PF01596

Methyltransf_3

O-methyltransferase

32

242

0.9

PF01135

PCMT

Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)

28

192

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tr6-assembly1.cif.gz_A-2 structure of a o-methyltransferase from coxiella burnetii 0.9385 8 213
3cbg-assembly1.cif.gz_A-2 functional and structural characterization of a cationdependent o-methyltransferase from the cyanobacterium synechocystis sp. strain pcc 6803 0.9362 9 213
5lhm-assembly1.cif.gz_A crystal structure of safc from myxococcus xanthus apo-form 0.93 9 213
5zw3-assembly1.cif.gz_B crystal structure of trmr from b. subtilis 0.93 12 213
3c3p-assembly1.cif.gz_A crystal structure of a methyltransferase (np_951602.1) from geobacter sulfurreducens at 1.90 a resolution 0.9254 9 212
ID Description Score Start End Superfamily
af_A0A0R0IR39_2_192_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9443 42 211 3.40.50.150
3cbgA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9362 9 213 3.40.50.150
5lhmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.93 9 213 3.40.50.150
3tr6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9294 8 213 3.40.50.150
af_Q9M266_77_290_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9285 9 213 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2V9SL72-F1-model_v4 O-methyltransferase 0.9602 9 213 GO:0008171
GO:0008757
GO:0032259
AF-D3FCV8-F1-model_v4 O-methyltransferase family 3 0.959 8 213 GO:0008171
GO:0008757
GO:0032259
AF-A0A7C2E1F2-F1-model_v4 O-methyltransferase 0.9577 29 213 GO:0008171
GO:0008757
GO:0032259
AF-A0A1W2AET3-F1-model_v4 tRNA 5-hydroxyuridine methyltransferase (EC 2.1.1.-) (ho5U methyltransferase) 0.9567 27 213 GO:0000287
GO:0008171
GO:0016300
GO:0030488
AF-A0A3D0P5I3-F1-model_v4 O-methyltransferase 0.9557 77 213 GO:0008171
GO:0008757
GO:0032259

Map