F447547

General Info

Members Datasets Scaffolds Average Seq Length
455 249 455 69

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10420287|Ga0075365_104202872
Length 81
Sequence MRERPVSRVNRVPLMAEPEHGFKEGDPVWVEDGDGKHHPGVFVGDNEAPGWFGGGPSAYVAHPEAHQAEVVSIFRITPREE

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 0
Rhizoplane 8.79
Rhizosphere 79.78
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012572 3300001979 Bacteria 3188
2 JGI24748J21848_1000307 3300002074 Bacteria 5690
3 JGI24034J26672_10000119 3300002239 Bacteria 12014
4 JGI24742J22300_10001957 3300002244 Bacteria 3282
5 Ga0070676_11195002 3300005328 Bacteria 578
6 Ga0070683_101858864 3300005329 Bacteria 579
7 Ga0070670_100058698 3300005331 Bacteria 3303
8 Ga0070666_10494959 3300005335 Bacteria 886
9 Ga0070682_100000556 3300005337 Bacteria 23033
10 Ga0068868_101306536 3300005338 Unclassified 674
11 Ga0070691_10000074 3300005341 Bacteria 27912
12 Ga0070691_10025951 3300005341 Bacteria 2730
13 Ga0070691_10222437 3300005341 Bacteria 1001
14 Ga0070691_10494607 3300005341 Bacteria 706
15 Ga0070661_100000004 3300005344 Bacteria 243876
16 Ga0070661_100939961 3300005344 Bacteria 715
17 Ga0070661_101451168 3300005344 Bacteria 578
18 Ga0070692_10227161 3300005345 Bacteria 1106
19 Ga0070668_100544294 3300005347 Bacteria 1010
20 Ga0070668_101376163 3300005347 Bacteria 643
21 Ga0070675_100000078 3300005354 Bacteria 56469
22 Ga0070674_100000030 3300005356 Bacteria 69481
23 Ga0070673_100031795 3300005364 Bacteria 3965
24 Ga0070688_100001862 3300005365 Bacteria 10574
25 Ga0070688_100002739 3300005365 Bacteria 8952
26 Ga0070667_100133714 3300005367 Bacteria 2167
27 Ga0070701_10940642 3300005438 Bacteria 599
28 Ga0070701_10991896 3300005438 Bacteria 585
29 Ga0070700_100289426 3300005441 Unclassified 1191
30 Ga0070700_100586339 3300005441 Bacteria 871
31 Ga0070678_100004618 3300005456 Bacteria 7826
32 Ga0070685_10000189 3300005466 Bacteria 41176
33 Ga0070685_10002457 3300005466 Bacteria 9510
34 Ga0070684_100020411 3300005535 Bacteria 5498
35 Ga0070684_101165193 3300005535 Bacteria 725
36 Ga0068853_101189713 3300005539 Bacteria 736
37 Ga0070686_100136141 3300005544 Bacteria 1705
38 Ga0070686_100336405 3300005544 Unclassified 1130
39 Ga0070686_101452221 3300005544 Bacteria 577
40 Ga0070695_100145570 3300005545 Unclassified 1648
41 Ga0070696_101228596 3300005546 Bacteria 634
42 Ga0070665_100000682 3300005548 Bacteria 45471
43 Ga0070704_102133956 3300005549 Unclassified 521
44 Ga0068855_100465422 3300005563 Bacteria 1378
45 Ga0070664_100521275 3300005564 Bacteria 1097
46 Ga0068854_100000062 3300005578 Bacteria 78159
47 Ga0068856_100000377 3300005614 Bacteria 48877
48 Ga0068856_100077139 3300005614 Bacteria 3302
49 Ga0068852_100000093 3300005616 Bacteria 60834
50 Ga0068852_100108127 3300005616 Bacteria 2524
51 Ga0068864_100000043 3300005618 Bacteria 162928
52 Ga0068866_10000382 3300005718 Bacteria 20838
53 Ga0068866_10012759 3300005718 Bacteria 3667
54 Ga0068866_10066218 3300005718 Bacteria 1892
55 Ga0068851_10000297 3300005834 Bacteria 22748
56 Ga0068851_10015205 3300005834 Bacteria 3664
57 Ga0068863_100852496 3300005841 Bacteria 910
58 Ga0068863_101637795 3300005841 Bacteria 653
59 Ga0068858_100000017 3300005842 Bacteria 186913
60 Ga0081455_10023910 3300005937 Bacteria 5675
61 Ga0081455_10095488 3300005937 Bacteria 2399
62 Ga0081455_10466250 3300005937 Unclassified 859
63 Ga0075365_10002852 3300006038 Bacteria 8679
64 Ga0075365_10002884 3300006038 Bacteria 8657
65 Ga0075365_10041723 3300006038 Bacteria 2998
66 Ga0075365_10420287 3300006038 Bacteria 944
67 Ga0075365_10554652 3300006038 Bacteria 813
68 Ga0075365_10633515 3300006038 Bacteria 756
69 Ga0075365_10699335 3300006038 Bacteria 716
70 Ga0075365_10880592 3300006038 Unclassified 631
71 Ga0075368_10046025 3300006042 Bacteria 1725
72 Ga0075368_10393650 3300006042 Bacteria 608
73 Ga0075368_10475318 3300006042 Bacteria 556
74 Ga0075368_10561931 3300006042 Bacteria 514
75 Ga0075363_100061011 3300006048 Bacteria 2031
76 Ga0075363_100480888 3300006048 Bacteria 736
77 Ga0075363_100504249 3300006048 Bacteria 719
78 Ga0075364_10021442 3300006051 Bacteria 4072
79 Ga0075364_10027559 3300006051 Bacteria 3630
80 Ga0075364_10056496 3300006051 Bacteria 2570
81 Ga0075364_10386013 3300006051 Bacteria 955
82 Ga0070712_101955211 3300006175 Bacteria 514
83 Ga0097621_100184659 3300006237 Bacteria 1803
84 Ga0097621_101987150 3300006237 Unclassified 555
85 Ga0068871_100307811 3300006358 Unclassified 1392
86 Ga0075428_100197443 3300006844 Bacteria 2176
87 Ga0075428_102320552 3300006844 Bacteria 552
88 Ga0075430_100177755 3300006846 Bacteria 1770
89 Ga0075431_100023812 3300006847 Bacteria 6267
90 Ga0075433_11611497 3300006852 Unclassified 560
91 Ga0075434_100222854 3300006871 Bacteria 1906
92 Ga0075429_101142895 3300006880 Bacteria 680
93 Ga0068865_100216839 3300006881 Unclassified 1494
94 Ga0075436_100745088 3300006914 Bacteria 727
95 Ga0111539_10128832 3300009094 Unclassified 2964
96 Ga0111539_12146258 3300009094 Bacteria 648
97 Ga0111539_13321703 3300009094 Bacteria 518
98 Ga0105245_10001831 3300009098 Bacteria 19354
99 Ga0105245_10005744 3300009098 Bacteria 10888
100 Ga0105245_10308240 3300009098 Bacteria 1556
101 Ga0105245_11933173 3300009098 Bacteria 643
102 Ga0105247_10137206 3300009101 Bacteria 1599
103 Ga0105247_10881580 3300009101 Unclassified 689
104 Ga0114129_10068723 3300009147 Unclassified 4939
105 Ga0114129_10621598 3300009147 Archaea 1397
106 Ga0114129_10709951 3300009147 Bacteria 1291
107 Ga0114129_11374182 3300009147 Bacteria 872
108 Ga0105243_10053059 3300009148 Bacteria 3215
109 Ga0105243_10508999 3300009148 Bacteria 1142
110 Ga0105243_10811439 3300009148 Unclassified 923
111 Ga0105243_11794225 3300009148 Bacteria 644
112 Ga0105241_10083959 3300009174 Bacteria 2500
113 Ga0105241_10120186 3300009174 Unclassified 2114
114 Ga0105242_10000034 3300009176 Bacteria 95536
115 Ga0105242_10022832 3300009176 Bacteria 4926
116 Ga0105242_11920673 3300009176 Bacteria 633
117 Ga0105248_10000008 3300009177 Bacteria 403910
118 Ga0105248_10446267 3300009177 Bacteria 1458
119 Ga0105249_10186539 3300009553 Unclassified 2021
120 Ga0105239_10043707 3300010375 Bacteria 4912
121 Ga0105239_11568049 3300010375 Unclassified 761
122 Ga0105239_12119327 3300010375 Unclassified 653
123 Ga0105246_10690672 3300011119 Bacteria 893
124 Ga0157329_1012388 3300012491 Bacteria 697
125 Ga0157371_11602338 3300013102 Unclassified 510
126 Ga0157370_10132387 3300013104 Bacteria 2325
127 Ga0157369_10000110 3300013105 Bacteria 115514
128 Ga0157378_10001375 3300013297 Bacteria 21833
129 Ga0157378_10031676 3300013297 Bacteria 4671
130 Ga0157378_11642021 3300013297 Unclassified 689
131 Ga0157378_13209417 3300013297 Bacteria 508
132 Ga0157375_10000765 3300013308 Bacteria 28141
133 Ga0157375_10000885 3300013308 Bacteria 25959
134 Ga0157375_11936289 3300013308 Unclassified 700
135 Ga0163163_10264988 3300014325 Bacteria 1769
136 Ga0163163_10379427 3300014325 Bacteria 1471
137 Ga0157377_10713493 3300014745 Bacteria 729
138 Ga0157376_12403247 3300014969 Unclassified 566
139 Ga0206353_11289487 3300020082 Unclassified 1534
140 Ga0207656_10000084 3300025321 Bacteria 35284
141 Ga0207656_10463700 3300025321 Unclassified 641
142 Ga0207642_10005123 3300025899 Bacteria 4265
143 Ga0207642_10067087 3300025899 Bacteria 1692
144 Ga0207710_10000477 3300025900 Bacteria 25496
145 Ga0207710_10662480 3300025900 Unclassified 547
146 Ga0207680_10025490 3300025903 Bacteria 3262
147 Ga0207705_10153233 3300025909 Bacteria 1728
148 Ga0207654_10040090 3300025911 Bacteria 2637
149 Ga0207649_10000003 3300025920 Bacteria 388908
150 Ga0207649_10952511 3300025920 Bacteria 674
151 Ga0207650_10049183 3300025925 Bacteria 3112
152 Ga0207659_10000018 3300025926 Bacteria 156920
153 Ga0207687_10000007 3300025927 Bacteria 604185
154 Ga0207687_10003583 3300025927 Bacteria 10452
155 Ga0207687_10259620 3300025927 Unclassified 1384
156 Ga0207687_10831440 3300025927 Bacteria 788
157 Ga0207664_10302769 3300025929 Bacteria 1407
158 Ga0207686_10000223 3300025934 Bacteria 43288
159 Ga0207686_10000667 3300025934 Bacteria 21210
160 Ga0207686_10045574 3300025934 Bacteria 2699
161 Ga0207686_10072382 3300025934 Bacteria 2221
162 Ga0207709_10024483 3300025935 Bacteria 3447
163 Ga0207709_10331555 3300025935 Unclassified 1142
164 Ga0207709_11268017 3300025935 Bacteria 608
165 Ga0207669_10000262 3300025937 Bacteria 23932
166 Ga0207704_10224281 3300025938 Unclassified 1393
167 Ga0207711_10000006 3300025941 Bacteria 792692
168 Ga0207711_10315375 3300025941 Bacteria 1444
169 Ga0207661_10000247 3300025944 Bacteria 35222
170 Ga0207661_10588974 3300025944 Bacteria 1020
171 Ga0207679_10398005 3300025945 Bacteria 1211
172 Ga0207679_10800857 3300025945 Bacteria 859
173 Ga0207667_10405470 3300025949 Bacteria 1388
174 Ga0207651_10018543 3300025960 Bacteria 4145
175 Ga0207712_10276940 3300025961 Unclassified 1368
176 Ga0207712_11063448 3300025961 Bacteria 719
177 Ga0207668_10239059 3300025972 Bacteria 1468
178 Ga0207668_10400289 3300025972 Unclassified 1161
179 Ga0207668_11202642 3300025972 Bacteria 681
180 Ga0207668_11610781 3300025972 Bacteria 586
181 Ga0207640_10000074 3300025981 Bacteria 78164
182 Ga0207640_10349471 3300025981 Bacteria 1188
183 Ga0207658_10205483 3300025986 Bacteria 1647
184 Ga0207677_10003263 3300026023 Bacteria 8568
185 Ga0207677_11420702 3300026023 Unclassified 639
186 Ga0207703_10000030 3300026035 Bacteria 199014
187 Ga0207703_11254942 3300026035 Bacteria 712
188 Ga0207639_10289387 3300026041 Bacteria 1444
189 Ga0207708_10046221 3300026075 Bacteria 3316
190 Ga0207708_10435811 3300026075 Unclassified 1089
191 Ga0207702_10000085 3300026078 Bacteria 106728
192 Ga0207702_10012965 3300026078 Bacteria 6934
193 Ga0207641_10002678 3300026088 Bacteria 16262
194 Ga0207641_11260548 3300026088 Bacteria 739
195 Ga0207676_10000042 3300026095 Bacteria 163475
196 Ga0207683_10005878 3300026121 Bacteria 10524
197 Ga0207683_10387885 3300026121 Bacteria 1284
198 Ga0207698_10000440 3300026142 Bacteria 23916
199 Ga0207698_10068547 3300026142 Bacteria 2802
200 Ga0209813_10025044 3300027866 Bacteria 1712
201 Ga0209813_10319235 3300027866 Bacteria 608
202 Ga0268266_10000731 3300028379 Bacteria 44067
203 Ga0268266_10760683 3300028379 Bacteria 935
204 Ga0268266_10831419 3300028379 Bacteria 892
205 Ga0265337_1000254 3300028556 Bacteria 28842
206 Ga0265326_10000079 3300028558 Bacteria 51707
207 Ga0265322_10000004 3300028654 Bacteria 275155
208 Ga0265336_10033026 3300028666 Bacteria 1603
209 Ga0265338_10560397 3300028800 Bacteria 799
210 Ga0265324_10000747 3300029957 Bacteria 21609
211 Ga0307511_10285932 3300030521 Unclassified 758
212 Ga0265328_10014255 3300031239 Bacteria 3132
213 Ga0265320_10000029 3300031240 Bacteria 159627
214 Ga0265329_10006945 3300031242 Bacteria 4426
215 Ga0265331_10006096 3300031250 Bacteria 7174
216 Ga0265327_10000723 3300031251 Bacteria 51798
217 Ga0265316_10048559 3300031344 Bacteria 3349
218 Ga0265314_10000484 3300031711 Bacteria 52007
219 Ga0307413_10929717 3300031824 Bacteria 741
220 Ga0307410_10016537 3300031852 Bacteria 4403
221 Ga0307406_11380317 3300031901 Bacteria 617
222 Ga0307416_100115763 3300032002 Bacteria 2375
223 Ga0307415_100013593 3300032126 Bacteria 4756
224 Ga0373953_0170781 3300035117 Bacteria 936
225 Ga0316574_0279564 3300035398 Bacteria 1063
226 Ga0316574_0651467 3300035398 Bacteria 648
227 Ga0373933_0731023 3300035724 Bacteria 651
228 Ga0395900_0127654 3300037418 Bacteria 2607
229 Ga0395900_0859586 3300037418 Bacteria 832
230 Ga0395898_0002556 3300037466 Bacteria 21342
231 Ga0395898_0010927 3300037466 Bacteria 9470
232 Ga0395905_0097284 3300037471 Bacteria 2763
233 Ga0395905_1716403 3300037471 Bacteria 533
234 Ga0395901_0037726 3300038443 Bacteria 4997
235 Ga0395901_0099723 3300038443 Bacteria 3046
236 Ga0451807_0527994 3300041486 Bacteria 1031
237 Ga0451807_1623212 3300041486 Bacteria 876
238 Ga0451833_1008300 3300041491 Bacteria 1070
239 Ga0451847_0162868 3300041503 Bacteria 546
240 Ga0451849_1510230 3300041505 Bacteria 1008
241 Ga0451853_0045614 3300041512 Bacteria 625
242 Ga0451853_1286025 3300041512 Bacteria 993
243 Ga0451853_2168460 3300041512 Bacteria 540
244 Ga0451853_2295057 3300041512 Bacteria 591
245 Ga0451853_2500954 3300041512 Bacteria 519
246 Ga0466963_0130356 3300044694 Bacteria 1736
247 Ga0466958_0078583 3300045836 Bacteria 2028
248 Ga0466967_0011675 3300045976 Bacteria 6674
249 Ga0466967_0759431 3300045976 Unclassified 962
250 Ga0466967_0973862 3300045976 Bacteria 844
251 Ga0495592_0217873 3300046454 Bacteria 1278
252 Ga0495592_0496993 3300046454 Bacteria 757
253 Ga0495603_0066301 3300046455 Bacteria 2126
254 Ga0495591_081679 3300046458 Bacteria 823
255 Ga0495629_0000025 3300046459 Bacteria 135624
256 Ga0495629_0001779 3300046459 Bacteria 16906
257 Ga0495629_0452652 3300046459 Unclassified 869
258 Ga0495641_0008978 3300046461 Bacteria 6007
259 Ga0495641_0009617 3300046461 Bacteria 5723
260 Ga0495641_0025870 3300046461 Bacteria 2874
261 Ga0495641_0060516 3300046461 Bacteria 1711
262 Ga0495641_0506610 3300046461 Bacteria 550
263 Ga0495651_0311204 3300046462 Bacteria 1053
264 Ga0495653_0031504 3300046463 Bacteria 4214
265 Ga0495653_0426870 3300046463 Bacteria 838
266 Ga0495653_0680187 3300046463 Unclassified 626
267 Ga0495582_0041284 3300046473 Unclassified 2542
268 Ga0495662_0393984 3300046476 Unclassified 680
269 Ga0495594_0040804 3300046499 Unclassified 2541
270 Ga0495596_0176884 3300046500 Bacteria 830
271 Ga0495606_0000017 3300046507 Bacteria 284549
272 Ga0495610_0034248 3300046512 Bacteria 2617
273 Ga0495618_0534272 3300046514 Bacteria 704
274 Ga0495628_0000437 3300046516 Bacteria 37922
275 Ga0495628_0639452 3300046516 Bacteria 756
276 Ga0495628_0674901 3300046516 Bacteria 732
277 Ga0495630_0000034 3300046517 Bacteria 126055
278 Ga0495630_0004372 3300046517 Bacteria 9923
279 Ga0495630_0407793 3300046517 Bacteria 1041
280 Ga0495663_0297783 3300046525 Unclassified 580
281 Ga0495652_0008710 3300046529 Bacteria 9244
282 Ga0495652_0519155 3300046529 Bacteria 823
283 Ga0495587_0422833 3300046536 Bacteria 739
284 Ga0495645_0132645 3300046543 Bacteria 1744
285 Ga0495667_0000322 3300046559 Bacteria 30286
286 Ga0495667_0050252 3300046559 Bacteria 2753
287 Ga0495656_0000600 3300046615 Bacteria 11626
288 Ga0495656_0178281 3300046615 Bacteria 1043
289 Ga0495634_0000558 3300046642 Bacteria 36397
290 Ga0495634_0001012 3300046642 Bacteria 26406
291 Ga0495634_0004991 3300046642 Bacteria 10248
292 Ga0495634_0143751 3300046642 Bacteria 1513
293 Ga0495635_0057992 3300046663 Bacteria 2664
294 Ga0495635_0224945 3300046663 Bacteria 1268
295 Ga0495588_0000073 3300046674 Bacteria 219005
296 Ga0495588_0129313 3300046674 Bacteria 1332
297 Ga0495588_0753878 3300046674 Unclassified 509
298 Ga0495657_0346067 3300046675 Bacteria 880
299 Ga0495647_0000079 3300046681 Bacteria 23665
300 Ga0495647_0136511 3300046681 Bacteria 1043
301 Ga0495647_0294495 3300046681 Unclassified 730
302 Ga0495658_0002349 3300046683 Bacteria 9558
303 Ga0495658_0663214 3300046683 Unclassified 668
304 Ga0495658_0814722 3300046683 Archaea 598
305 Ga0495613_0000094 3300046689 Bacteria 86601
306 Ga0495613_0046202 3300046689 Bacteria 3220
307 Ga0495613_0229859 3300046689 Bacteria 1300
308 Ga0495624_0000220 3300046690 Bacteria 44376
309 Ga0495624_0157051 3300046690 Bacteria 1390
310 Ga0495589_0270028 3300046794 Unclassified 792
311 Ga0495600_0005499 3300046809 Bacteria 7645
312 Ga0495660_0403310 3300046810 Bacteria 598
313 Ga0495581_0112129 3300047315 Bacteria 1586
314 Ga0495604_0000293 3300047317 Bacteria 44767
315 Ga0495604_0058301 3300047317 Bacteria 2965
316 Ga0495672_0050776 3300047320 Bacteria 2446
317 Ga0495672_0053831 3300047320 Bacteria 2356
318 Ga0495676_0002271 3300047321 Bacteria 17047
319 Ga0495676_0076637 3300047321 Unclassified 2552
320 Ga0495676_0365283 3300047321 Bacteria 963
321 Ga0495676_0581806 3300047321 Bacteria 730
322 Ga0495680_0006019 3300047322 Bacteria 11345
323 Ga0495684_0234533 3300047471 Bacteria 1341
324 Ga0495593_0024905 3300047673 Bacteria 3312
325 Ga0495593_0391246 3300047673 Bacteria 695
326 Ga0495593_0613124 3300047673 Archaea 546
327 Ga0495602_0000041 3300048088 Bacteria 126954
328 Ga0495602_0036860 3300048088 Bacteria 4545
329 Ga0495602_0113032 3300048088 Bacteria 2202
330 Ga0495614_0454937 3300048089 Unclassified 606
331 Ga0496100_0000001 3300048903 Bacteria 530179
332 Ga0496100_0881009 3300048903 Unclassified 703
333 Ga0496100_1515562 3300048903 Unclassified 530
334 Ga0496101_0000028 3300048904 Bacteria 198664
335 Ga0496102_0000075 3300048905 Bacteria 147013
336 Ga0496102_0223829 3300048905 Bacteria 1774
337 Ga0496102_1437865 3300048905 Bacteria 608
338 Ga0496103_0000329 3300048906 Bacteria 43481
339 Ga0496104_0027822 3300048907 Bacteria 5233
340 Ga0496104_0113363 3300048907 Bacteria 2600
341 Ga0496105_0000005 3300048908 Bacteria 475797
342 Ga0496105_0146523 3300048908 Unclassified 1941
343 Ga0496106_0000055 3300048909 Bacteria 91570
344 Ga0496107_0000002 3300048910 Bacteria 320871
345 Ga0496107_0521039 3300048910 Bacteria 881
346 Ga0496107_0886958 3300048910 Unclassified 650
347 Ga0496108_0000005 3300048911 Bacteria 535059
348 Ga0496108_0000413 3300048911 Bacteria 34974
349 Ga0496108_1527332 3300048911 Unclassified 555
350 Ga0496109_0000002 3300048912 Bacteria 443393
351 Ga0496109_0000333 3300048912 Bacteria 44006
352 Ga0496109_0013316 3300048912 Bacteria 7127
353 Ga0496109_0083317 3300048912 Bacteria 2949
354 Ga0496109_0136198 3300048912 Bacteria 2295
355 Ga0496109_0705920 3300048912 Bacteria 946
356 Ga0496110_0000235 3300048913 Bacteria 35772
357 Ga0496110_0053987 3300048913 Bacteria 3534
358 Ga0496111_0000011 3300048914 Bacteria 88409
359 Ga0496111_0023479 3300048914 Bacteria 4330
360 Ga0496112_0005405 3300048915 Bacteria 11044
361 Ga0496113_0000001 3300048916 Bacteria 224977
362 Ga0496113_0033539 3300048916 Bacteria 3739
363 Ga0496113_0569111 3300048916 Unclassified 908
364 Ga0496114_0000003 3300048917 Bacteria 630981
365 Ga0496114_0326997 3300048917 Bacteria 1355
366 Ga0496115_0000016 3300048918 Bacteria 187067
367 Ga0496115_0000031 3300048918 Bacteria 138258
368 Ga0496115_0034932 3300048918 Bacteria 3975
369 Ga0496119_0014028 3300048922 Bacteria 6312
370 Ga0496120_0054476 3300048923 Bacteria 2266
371 Ga0496124_0157424 3300048927 Bacteria 1775
372 Ga0501031_0683051 3300049568 Bacteria 659
373 Ga0501036_0490197 3300049572 Bacteria 1023
374 Ga0501039_0380961 3300049575 Bacteria 1108
375 Ga0501040_0620285 3300049576 Bacteria 781
376 Ga0501040_0926288 3300049576 Unclassified 631
377 Ga0501041_0168049 3300049577 Bacteria 1372
378 Ga0501042_0197948 3300049578 Bacteria 1449
379 Ga0501046_0633732 3300049580 Unclassified 757
380 Ga0501048_1313082 3300049582 Bacteria 520
381 Ga0501068_0607621 3300049584 Bacteria 713
382 Ga0501069_0297806 3300049585 Bacteria 946
383 Ga0501069_0548926 3300049585 Unclassified 691
384 Ga0501070_1057072 3300049586 Bacteria 628
385 Ga0501070_1148735 3300049586 Bacteria 597
386 Ga0501071_0252638 3300049587 Unclassified 1331
387 Ga0501072_0039329 3300049588 Bacteria 3714
388 Ga0501072_0398354 3300049588 Bacteria 1092
389 Ga0501072_0869464 3300049588 Bacteria 705
390 Ga0501072_0871934 3300049588 Unclassified 704
391 Ga0501072_1040728 3300049588 Bacteria 638
392 Ga0501072_1070111 3300049588 Bacteria 628
393 Ga0501073_0110821 3300049589 Bacteria 1904
394 Ga0501073_0873753 3300049589 Bacteria 619
395 Ga0501074_0111311 3300049590 Bacteria 1959
396 Ga0501074_0331673 3300049590 Bacteria 1080
397 Ga0501074_0641548 3300049590 Unclassified 750
398 Ga0501074_0845555 3300049590 Unclassified 645
399 Ga0501075_0063897 3300049591 Unclassified 2776
400 Ga0501076_0642289 3300049592 Unclassified 876
401 Ga0501077_0087878 3300049593 Bacteria 1970
402 Ga0501079_0157648 3300049741 Unclassified 1769
403 Ga0501080_0006672 3300049742 Bacteria 10387
404 Ga0501081_0801392 3300049743 Unclassified 709
405 Ga0501083_0189346 3300049744 Bacteria 1343
406 Ga0501045_0180930 3300049824 Bacteria 1571
407 nmdc:mga03n38_55379_c1 3300050490 Bacteria 1786
408 nmdc:mga03n38_645464_c1 3300050490 Unclassified 606
409 nmdc:mga03n38_668197_c1 3300050490 Bacteria 597
410 nmdc:mga00v17_28412_c1 3300050491 Bacteria 3275
411 nmdc:mga00v17_59606_c1 3300050491 Bacteria 2342
412 nmdc:mga00v17_85861_c1 3300050491 Bacteria 1971
413 nmdc:mga0yw44_1019593_c1 3300050492 Bacteria 560
414 nmdc:mga0yw44_203781_c1 3300050492 Unclassified 1307
415 nmdc:mga0yw44_409995_c1 3300050492 Bacteria 917
416 nmdc:mga0yw44_505647_c1 3300050492 Bacteria 820
417 nmdc:mga0yw44_592255_c1 3300050492 Unclassified 753
418 nmdc:mga0yw44_685336_c1 3300050492 Unclassified 696
419 nmdc:mga0yw44_77397_c1 3300050492 Bacteria 2078
420 nmdc:mga0yw44_994593_c1 3300050492 Unclassified 568
421 nmdc:mga06z11_604071_c1 3300050494 Bacteria 667
422 nmdc:mga04h51_29806_c1 3300050495 Bacteria 1712
423 nmdc:mga04h51_353199_c1 3300050495 Bacteria 608
424 nmdc:mga05p37_1109693_c1 3300050507 Bacteria 827
425 nmdc:mga05p37_188856_c1 3300050507 Unclassified 2503
426 nmdc:mga05p37_2107324_c1 3300050507 Archaea 528
427 nmdc:mga05p37_828422_c1 3300050507 Archaea 1008
428 nmdc:mga0qj67_98605_c1 3300050509 Bacteria 2354
429 nmdc:mga06r32_154771_c1 3300050510 Bacteria 2273
430 nmdc:mga0a205_1135153_c1 3300050515 Unclassified 629
431 nmdc:mga0a205_872061_c1 3300050515 Unclassified 747
432 Ga0495601_0000017 3300053077 Bacteria 204209
433 Ga0495601_0028160 3300053077 Bacteria 3478
434 Ga0495601_0137921 3300053077 Bacteria 1590
435 Ga0495601_0393098 3300053077 Bacteria 899
436 Ga0495612_0009368 3300053078 Bacteria 3976
437 Ga0495612_0167665 3300053078 Bacteria 961
438 Ga0495655_0000005 3300053083 Bacteria 257472
439 Ga0495655_0000401 3300053083 Bacteria 7348
440 Ga0495595_0013646 3300053084 Bacteria 3434
441 Ga0495619_0000001 3300053085 Bacteria 586054
442 Ga0495619_0000413 3300053085 Bacteria 29033
443 Ga0495619_0004779 3300053085 Bacteria 8615
444 Ga0495619_0314175 3300053085 Bacteria 1085
445 Ga0495619_0483397 3300053085 Bacteria 852
446 Ga0495619_0774706 3300053085 Unclassified 650
447 Ga0495619_0913863 3300053085 Unclassified 590
448 Ga0500566_0008889 3300053094 Bacteria 5940
449 Ga0500628_000025 3300053129 Bacteria 62808
450 Ga0501084_0327394 3300054114 Bacteria 1294
451 Ga0501084_1165952 3300054114 Unclassified 646
452 Ga0501084_1189365 3300054114 Bacteria 640
453 Ga0501082_1655336 3300060353 Bacteria 559
454 Ga0530510_0367163 3300061734 Bacteria 1082
455 Ga0530510_0871567 3300061734 Bacteria 688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005338 Ga0068868_101306536 Ga0068868_1013065362 64
2 3300005549 Ga0070704_102133956 Ga0070704_1021339561 64
3 3300006852 Ga0075433_11611497 Ga0075433_116114971 64
4 3300006871 Ga0075434_100222854 Ga0075434_1002228543 64
5 3300009148 Ga0105243_10811439 Ga0105243_108114392 64
6 3300010375 Ga0105239_12119327 Ga0105239_121193272 64
7 3300013297 Ga0157378_11642021 Ga0157378_116420212 64
8 3300025935 Ga0207709_10331555 Ga0207709_103315552 64
9 3300026023 Ga0207677_11420702 Ga0207677_114207022 64
10 3300048903 Ga0496100_0881009 Ga0496100_0881009_73_276 64
11 3300048903 Ga0496100_1515562 Ga0496100_1515562_223_432 64
12 3300048905 Ga0496102_0223829 Ga0496102_0223829_213_422 64
13 3300048910 Ga0496107_0886958 Ga0496107_0886958_383_592 64
14 3300049585 Ga0501069_0297806 Ga0501069_0297806_157_360 64
15 3300050515 nmdc:mga0a205_872061_c1 nmdc:mga0a205_872061_c1_79_282 64
16 3300005545 Ga0070695_100145570 Ga0070695_1001455702 66
17 3300013102 Ga0157371_11602338 Ga0157371_116023381 66
18 3300046642 Ga0495634_0143751 Ga0495634_0143751_581_784 66
19 3300046663 Ga0495635_0057992 Ga0495635_0057992_727_930 66
20 3300053077 Ga0495601_0393098 Ga0495601_0393098_458_661 66
21 3300053085 Ga0495619_0004779 Ga0495619_0004779_4810_5013 66
22 3300002074 JGI24748J21848_1000307 JGI24748J21848_10003075 67
23 3300002239 JGI24034J26672_10000119 JGI24034J26672_100001195 67
24 3300002244 JGI24742J22300_10001957 JGI24742J22300_100019572 67
25 3300005341 Ga0070691_10025951 Ga0070691_100259515 67
26 3300005344 Ga0070661_100939961 Ga0070661_1009399612 67
27 3300005347 Ga0070668_101376163 Ga0070668_1013761632 67
28 3300005364 Ga0070673_100031795 Ga0070673_1000317956 67
29 3300005438 Ga0070701_10991896 Ga0070701_109918962 67
30 3300005539 Ga0068853_101189713 Ga0068853_1011897131 67
31 3300005544 Ga0070686_100336405 Ga0070686_1003364052 67
32 3300005546 Ga0070696_101228596 Ga0070696_1012285962 67
33 3300005564 Ga0070664_100521275 Ga0070664_1005212753 67
34 3300005614 Ga0068856_100000377 Ga0068856_10000037746 67
35 3300005618 Ga0068864_100000043 Ga0068864_10000004352 67
36 3300005718 Ga0068866_10012759 Ga0068866_100127596 67
37 3300005841 Ga0068863_100852496 Ga0068863_1008524962 67
38 3300005841 Ga0068863_101637795 Ga0068863_1016377952 67
39 3300005937 Ga0081455_10023910 Ga0081455_100239105 67
40 3300006038 Ga0075365_10420287 Ga0075365_104202872 67
41 3300006038 Ga0075365_10633515 Ga0075365_106335152 67
42 3300006038 Ga0075365_10699335 Ga0075365_106993352 67
43 3300006038 Ga0075365_10880592 Ga0075365_108805921 67
44 3300006042 Ga0075368_10046025 Ga0075368_100460252 67
45 3300006048 Ga0075363_100061011 Ga0075363_1000610112 67
46 3300006051 Ga0075364_10056496 Ga0075364_100564963 67
47 3300006051 Ga0075364_10386013 Ga0075364_103860132 67
48 3300006237 Ga0097621_101987150 Ga0097621_1019871502 67
49 3300006844 Ga0075428_100197443 Ga0075428_1001974431 67
50 3300006844 Ga0075428_102320552 Ga0075428_1023205522 67
51 3300006846 Ga0075430_100177755 Ga0075430_1001777553 67
52 3300006847 Ga0075431_100023812 Ga0075431_1000238122 67
53 3300006880 Ga0075429_101142895 Ga0075429_1011428952 67
54 3300006881 Ga0068865_100216839 Ga0068865_1002168392 67
55 3300009094 Ga0111539_10128832 Ga0111539_101288324 67
56 3300009094 Ga0111539_12146258 Ga0111539_121462582 67
57 3300009094 Ga0111539_13321703 Ga0111539_133217032 67
58 3300009098 Ga0105245_10308240 Ga0105245_103082402 67
59 3300009098 Ga0105245_11933173 Ga0105245_119331732 67
60 3300009101 Ga0105247_10881580 Ga0105247_108815801 67
61 3300009147 Ga0114129_10068723 Ga0114129_100687236 67
62 3300009147 Ga0114129_10709951 Ga0114129_107099511 67
63 3300009147 Ga0114129_11374182 Ga0114129_113741822 67
64 3300009148 Ga0105243_10508999 Ga0105243_105089993 67
65 3300009176 Ga0105242_10000034 Ga0105242_1000003436 67
66 3300009553 Ga0105249_10186539 Ga0105249_101865393 67
67 3300012491 Ga0157329_1012388 Ga0157329_10123882 67
68 3300013297 Ga0157378_13209417 Ga0157378_132094171 67
69 3300013308 Ga0157375_11936289 Ga0157375_119362891 67
70 3300014325 Ga0163163_10264988 Ga0163163_102649882 67
71 3300014325 Ga0163163_10379427 Ga0163163_103794272 67
72 3300014745 Ga0157377_10713493 Ga0157377_107134931 67
73 3300014969 Ga0157376_12403247 Ga0157376_124032471 67
74 3300025899 Ga0207642_10067087 Ga0207642_100670873 67
75 3300025900 Ga0207710_10000477 Ga0207710_1000047730 67
76 3300025920 Ga0207649_10952511 Ga0207649_109525112 67
77 3300025927 Ga0207687_10259620 Ga0207687_102596202 67
78 3300025927 Ga0207687_10831440 Ga0207687_108314402 67
79 3300025934 Ga0207686_10000223 Ga0207686_1000022336 67
80 3300025934 Ga0207686_10000667 Ga0207686_1000066719 67
81 3300025938 Ga0207704_10224281 Ga0207704_102242812 67
82 3300025944 Ga0207661_10588974 Ga0207661_105889742 67
83 3300025945 Ga0207679_10398005 Ga0207679_103980053 67
84 3300025960 Ga0207651_10018543 Ga0207651_100185432 67
85 3300025961 Ga0207712_10276940 Ga0207712_102769402 67
86 3300025972 Ga0207668_10400289 Ga0207668_104002892 67
87 3300025972 Ga0207668_11202642 Ga0207668_112026423 67
88 3300025972 Ga0207668_11610781 Ga0207668_116107812 67
89 3300026041 Ga0207639_10289387 Ga0207639_102893871 67
90 3300026075 Ga0207708_10046221 Ga0207708_100462213 67
91 3300026078 Ga0207702_10000085 Ga0207702_1000008557 67
92 3300026088 Ga0207641_10002678 Ga0207641_100026782 67
93 3300026088 Ga0207641_11260548 Ga0207641_112605482 67
94 3300026095 Ga0207676_10000042 Ga0207676_10000042115 67
95 3300027866 Ga0209813_10025044 Ga0209813_100250442 67
96 3300028556 Ga0265337_1000254 Ga0265337_10002545 67
97 3300028558 Ga0265326_10000079 Ga0265326_1000007941 67
98 3300028654 Ga0265322_10000004 Ga0265322_10000004151 67
99 3300028666 Ga0265336_10033026 Ga0265336_100330263 67
100 3300028800 Ga0265338_10560397 Ga0265338_105603971 67
101 3300029957 Ga0265324_10000747 Ga0265324_100007478 67
102 3300030521 Ga0307511_10285932 Ga0307511_102859322 67
103 3300031239 Ga0265328_10014255 Ga0265328_100142554 67
104 3300031240 Ga0265320_10000029 Ga0265320_10000029149 67
105 3300031242 Ga0265329_10006945 Ga0265329_100069455 67
106 3300031250 Ga0265331_10006096 Ga0265331_100060969 67
107 3300031251 Ga0265327_10000723 Ga0265327_1000072341 67
108 3300031344 Ga0265316_10048559 Ga0265316_100485592 67
109 3300031711 Ga0265314_10000484 Ga0265314_1000048441 67
110 3300031824 Ga0307413_10929717 Ga0307413_109297171 67
111 3300031852 Ga0307410_10016537 Ga0307410_100165373 67
112 3300032002 Ga0307416_100115763 Ga0307416_1001157633 67
113 3300032126 Ga0307415_100013593 Ga0307415_1000135936 67
114 3300035117 Ga0373953_0170781 Ga0373953_0170781_575_778 67
115 3300035398 Ga0316574_0651467 Ga0316574_0651467_343_549 67
116 3300035724 Ga0373933_0731023 Ga0373933_0731023_76_291 67
117 3300041486 Ga0451807_0527994 Ga0451807_0527994_237_440 67
118 3300041503 Ga0451847_0162868 Ga0451847_0162868_318_521 67
119 3300041505 Ga0451849_1510230 Ga0451849_1510230_491_694 67
120 3300041512 Ga0451853_2168460 Ga0451853_2168460_324_527 67
121 3300045836 Ga0466958_0078583 Ga0466958_0078583_456_659 67
122 3300046454 Ga0495592_0496993 Ga0495592_0496993_105_311 67
123 3300046458 Ga0495591_081679 Ga0495591_081679_443_646 67
124 3300046459 Ga0495629_0001779 Ga0495629_0001779_12558_12761 67
125 3300046459 Ga0495629_0452652 Ga0495629_0452652_22_225 67
126 3300046461 Ga0495641_0060516 Ga0495641_0060516_1356_1568 67
127 3300046462 Ga0495651_0311204 Ga0495651_0311204_492_695 67
128 3300046463 Ga0495653_0031504 Ga0495653_0031504_2948_3151 67
129 3300046463 Ga0495653_0680187 Ga0495653_0680187_58_264 67
130 3300046476 Ga0495662_0393984 Ga0495662_0393984_72_275 67
131 3300046500 Ga0495596_0176884 Ga0495596_0176884_568_771 67
132 3300046514 Ga0495618_0534272 Ga0495618_0534272_340_543 67
133 3300046516 Ga0495628_0674901 Ga0495628_0674901_353_559 67
134 3300046517 Ga0495630_0004372 Ga0495630_0004372_6058_6264 67
135 3300046517 Ga0495630_0407793 Ga0495630_0407793_36_239 67
136 3300046525 Ga0495663_0297783 Ga0495663_0297783_69_272 67
137 3300046529 Ga0495652_0519155 Ga0495652_0519155_41_244 67
138 3300046536 Ga0495587_0422833 Ga0495587_0422833_393_599 67
139 3300046559 Ga0495667_0000322 Ga0495667_0000322_17044_17250 67
140 3300046615 Ga0495656_0000600 Ga0495656_0000600_5437_5652 67
141 3300046615 Ga0495656_0178281 Ga0495656_0178281_294_497 67
142 3300046642 Ga0495634_0000558 Ga0495634_0000558_14891_15094 67
143 3300046642 Ga0495634_0004991 Ga0495634_0004991_7285_7488 67
144 3300046663 Ga0495635_0224945 Ga0495635_0224945_209_424 67
145 3300046674 Ga0495588_0753878 Ga0495588_0753878_81_287 67
146 3300046675 Ga0495657_0346067 Ga0495657_0346067_374_580 67
147 3300046681 Ga0495647_0294495 Ga0495647_0294495_118_321 67
148 3300046689 Ga0495613_0000094 Ga0495613_0000094_25430_25633 67
149 3300046689 Ga0495613_0229859 Ga0495613_0229859_589_792 67
150 3300046794 Ga0495589_0270028 Ga0495589_0270028_197_400 67
151 3300046809 Ga0495600_0005499 Ga0495600_0005499_6141_6344 67
152 3300047317 Ga0495604_0000293 Ga0495604_0000293_35301_35504 67
153 3300047317 Ga0495604_0058301 Ga0495604_0058301_373_576 67
154 3300047321 Ga0495676_0002271 Ga0495676_0002271_15446_15649 67
155 3300047322 Ga0495680_0006019 Ga0495680_0006019_5157_5363 67
156 3300047471 Ga0495684_0234533 Ga0495684_0234533_934_1140 67
157 3300047673 Ga0495593_0024905 Ga0495593_0024905_2987_3193 67
158 3300047673 Ga0495593_0391246 Ga0495593_0391246_38_241 67
159 3300047673 Ga0495593_0613124 Ga0495593_0613124_108_311 67
160 3300048088 Ga0495602_0000041 Ga0495602_0000041_58374_58577 67
161 3300048088 Ga0495602_0113032 Ga0495602_0113032_93_296 67
162 3300048903 Ga0496100_0000001 Ga0496100_0000001_145752_145955 67
163 3300048904 Ga0496101_0000028 Ga0496101_0000028_145741_145944 67
164 3300048905 Ga0496102_0000075 Ga0496102_0000075_30230_30433 67
165 3300048906 Ga0496103_0000329 Ga0496103_0000329_30456_30659 67
166 3300048907 Ga0496104_0027822 Ga0496104_0027822_4841_5044 67
167 3300048907 Ga0496104_0113363 Ga0496104_0113363_1635_1841 67
168 3300048908 Ga0496105_0000005 Ga0496105_0000005_102915_103151 67
169 3300048908 Ga0496105_0146523 Ga0496105_0146523_190_393 67
170 3300048909 Ga0496106_0000055 Ga0496106_0000055_38671_38874 67
171 3300048910 Ga0496107_0000002 Ga0496107_0000002_102533_102736 67
172 3300048910 Ga0496107_0521039 Ga0496107_0521039_570_773 67
173 3300048911 Ga0496108_0000005 Ga0496108_0000005_194430_194636 67
174 3300048911 Ga0496108_1527332 Ga0496108_1527332_108_311 67
175 3300048912 Ga0496109_0000002 Ga0496109_0000002_340456_340662 67
176 3300048912 Ga0496109_0083317 Ga0496109_0083317_2339_2542 67
177 3300048912 Ga0496109_0705920 Ga0496109_0705920_356_559 67
178 3300048916 Ga0496113_0033539 Ga0496113_0033539_245_448 67
179 3300048918 Ga0496115_0034932 Ga0496115_0034932_3662_3868 67
180 3300048922 Ga0496119_0014028 Ga0496119_0014028_3388_3624 67
181 3300048923 Ga0496120_0054476 Ga0496120_0054476_1459_1695 67
182 3300049568 Ga0501031_0683051 Ga0501031_0683051_159_365 67
183 3300049572 Ga0501036_0490197 Ga0501036_0490197_761_967 67
184 3300049575 Ga0501039_0380961 Ga0501039_0380961_170_373 67
185 3300049576 Ga0501040_0620285 Ga0501040_0620285_558_761 67
186 3300049576 Ga0501040_0926288 Ga0501040_0926288_101_304 67
187 3300049577 Ga0501041_0168049 Ga0501041_0168049_633_836 67
188 3300049578 Ga0501042_0197948 Ga0501042_0197948_411_614 67
189 3300049580 Ga0501046_0633732 Ga0501046_0633732_214_417 67
190 3300049582 Ga0501048_1313082 Ga0501048_1313082_57_260 67
191 3300049584 Ga0501068_0607621 Ga0501068_0607621_490_696 67
192 3300049585 Ga0501069_0548926 Ga0501069_0548926_466_672 67
193 3300049586 Ga0501070_1057072 Ga0501070_1057072_306_512 67
194 3300049586 Ga0501070_1148735 Ga0501070_1148735_271_477 67
195 3300049587 Ga0501071_0252638 Ga0501071_0252638_1033_1236 67
196 3300049588 Ga0501072_0039329 Ga0501072_0039329_807_1010 67
197 3300049588 Ga0501072_0398354 Ga0501072_0398354_398_601 67
198 3300049588 Ga0501072_0869464 Ga0501072_0869464_270_473 67
199 3300049588 Ga0501072_0871934 Ga0501072_0871934_143_346 67
200 3300049588 Ga0501072_1040728 Ga0501072_1040728_233_439 67
201 3300049588 Ga0501072_1070111 Ga0501072_1070111_280_483 67
202 3300049589 Ga0501073_0110821 Ga0501073_0110821_22_228 67
203 3300049590 Ga0501074_0111311 Ga0501074_0111311_804_1010 67
204 3300049590 Ga0501074_0331673 Ga0501074_0331673_682_885 67
205 3300049590 Ga0501074_0641548 Ga0501074_0641548_474_680 67
206 3300049590 Ga0501074_0845555 Ga0501074_0845555_222_425 67
207 3300049591 Ga0501075_0063897 Ga0501075_0063897_770_973 67
208 3300049592 Ga0501076_0642289 Ga0501076_0642289_221_424 67
209 3300049593 Ga0501077_0087878 Ga0501077_0087878_176_379 67
210 3300049741 Ga0501079_0157648 Ga0501079_0157648_487_690 67
211 3300049742 Ga0501080_0006672 Ga0501080_0006672_1456_1662 67
212 3300049743 Ga0501081_0801392 Ga0501081_0801392_441_644 67
213 3300049744 Ga0501083_0189346 Ga0501083_0189346_1112_1318 67
214 3300049824 Ga0501045_0180930 Ga0501045_0180930_220_423 67
215 3300050490 nmdc:mga03n38_55379_c1 nmdc:mga03n38_55379_c1_396_599 67
216 3300050490 nmdc:mga03n38_668197_c1 nmdc:mga03n38_668197_c1_190_393 67
217 3300050491 nmdc:mga00v17_85861_c1 nmdc:mga00v17_85861_c1_1561_1764 67
218 3300050492 nmdc:mga0yw44_1019593_c1 nmdc:mga0yw44_1019593_c1_252_458 67
219 3300050492 nmdc:mga0yw44_203781_c1 nmdc:mga0yw44_203781_c1_247_450 67
220 3300050492 nmdc:mga0yw44_409995_c1 nmdc:mga0yw44_409995_c1_695_898 67
221 3300050495 nmdc:mga04h51_29806_c1 nmdc:mga04h51_29806_c1_1261_1464 67
222 3300050507 nmdc:mga05p37_1109693_c1 nmdc:mga05p37_1109693_c1_43_246 67
223 3300050507 nmdc:mga05p37_188856_c1 nmdc:mga05p37_188856_c1_1518_1721 67
224 3300050509 nmdc:mga0qj67_98605_c1 nmdc:mga0qj67_98605_c1_643_846 67
225 3300050510 nmdc:mga06r32_154771_c1 nmdc:mga06r32_154771_c1_1460_1663 67
226 3300050515 nmdc:mga0a205_1135153_c1 nmdc:mga0a205_1135153_c1_275_478 67
227 3300053077 Ga0495601_0000017 Ga0495601_0000017_150024_150227 67
228 3300053077 Ga0495601_0028160 Ga0495601_0028160_229_435 67
229 3300053077 Ga0495601_0137921 Ga0495601_0137921_871_1074 67
230 3300053078 Ga0495612_0167665 Ga0495612_0167665_450_653 67
231 3300053083 Ga0495655_0000005 Ga0495655_0000005_128838_129041 67
232 3300053083 Ga0495655_0000401 Ga0495655_0000401_2604_2807 67
233 3300053084 Ga0495595_0013646 Ga0495595_0013646_472_675 67
234 3300053085 Ga0495619_0000413 Ga0495619_0000413_11761_11976 67
235 3300053085 Ga0495619_0314175 Ga0495619_0314175_418_624 67
236 3300053085 Ga0495619_0774706 Ga0495619_0774706_371_574 67
237 3300053094 Ga0500566_0008889 Ga0500566_0008889_4644_4847 67
238 3300053129 Ga0500628_000025 Ga0500628_000025_40107_40310 67
239 3300054114 Ga0501084_0327394 Ga0501084_0327394_322_525 67
240 3300054114 Ga0501084_1165952 Ga0501084_1165952_54_257 67
241 3300060353 Ga0501082_1655336 Ga0501082_1655336_224_427 67
242 3300061734 Ga0530510_0367163 Ga0530510_0367163_797_1000 67
243 3300061734 Ga0530510_0871567 Ga0530510_0871567_75_284 67
244 3300001979 JGI24740J21852_10012572 JGI24740J21852_100125725 68
245 3300005328 Ga0070676_11195002 Ga0070676_111950021 68
246 3300005329 Ga0070683_101858864 Ga0070683_1018588642 68
247 3300005331 Ga0070670_100058698 Ga0070670_1000586982 68
248 3300005335 Ga0070666_10494959 Ga0070666_104949593 68
249 3300005337 Ga0070682_100000556 Ga0070682_10000055612 68
250 3300005341 Ga0070691_10000074 Ga0070691_1000007421 68
251 3300005341 Ga0070691_10222437 Ga0070691_102224372 68
252 3300005341 Ga0070691_10494607 Ga0070691_104946072 68
253 3300005344 Ga0070661_100000004 Ga0070661_10000000465 68
254 3300005344 Ga0070661_101451168 Ga0070661_1014511682 68
255 3300005345 Ga0070692_10227161 Ga0070692_102271612 68
256 3300005347 Ga0070668_100544294 Ga0070668_1005442942 68
257 3300005354 Ga0070675_100000078 Ga0070675_10000007826 68
258 3300005356 Ga0070674_100000030 Ga0070674_10000003055 68
259 3300005365 Ga0070688_100001862 Ga0070688_1000018626 68
260 3300005365 Ga0070688_100002739 Ga0070688_1000027395 68
261 3300005367 Ga0070667_100133714 Ga0070667_1001337143 68
262 3300005438 Ga0070701_10940642 Ga0070701_109406422 68
263 3300005441 Ga0070700_100289426 Ga0070700_1002894263 68
264 3300005441 Ga0070700_100586339 Ga0070700_1005863392 68
265 3300005456 Ga0070678_100004618 Ga0070678_1000046188 68
266 3300005466 Ga0070685_10000189 Ga0070685_100001895 68
267 3300005466 Ga0070685_10002457 Ga0070685_100024575 68
268 3300005535 Ga0070684_100020411 Ga0070684_1000204115 68
269 3300005535 Ga0070684_101165193 Ga0070684_1011651932 68
270 3300005544 Ga0070686_100136141 Ga0070686_1001361413 68
271 3300005544 Ga0070686_101452221 Ga0070686_1014522211 68
272 3300005548 Ga0070665_100000682 Ga0070665_10000068240 68
273 3300005563 Ga0068855_100465422 Ga0068855_1004654222 68
274 3300005578 Ga0068854_100000062 Ga0068854_10000006245 68
275 3300005614 Ga0068856_100077139 Ga0068856_1000771393 68
276 3300005616 Ga0068852_100000093 Ga0068852_1000000935 68
277 3300005616 Ga0068852_100108127 Ga0068852_1001081274 68
278 3300005718 Ga0068866_10000382 Ga0068866_100003826 68
279 3300005718 Ga0068866_10066218 Ga0068866_100662183 68
280 3300005834 Ga0068851_10000297 Ga0068851_1000029720 68
281 3300005834 Ga0068851_10015205 Ga0068851_100152053 68
282 3300005842 Ga0068858_100000017 Ga0068858_100000017115 68
283 3300005937 Ga0081455_10095488 Ga0081455_100954882 68
284 3300005937 Ga0081455_10466250 Ga0081455_104662502 68
285 3300006038 Ga0075365_10002852 Ga0075365_100028528 68
286 3300006038 Ga0075365_10002884 Ga0075365_1000288415 68
287 3300006038 Ga0075365_10041723 Ga0075365_100417234 68
288 3300006038 Ga0075365_10554652 Ga0075365_105546522 68
289 3300006042 Ga0075368_10393650 Ga0075368_103936502 68
290 3300006042 Ga0075368_10475318 Ga0075368_104753181 68
291 3300006042 Ga0075368_10561931 Ga0075368_105619312 68
292 3300006048 Ga0075363_100480888 Ga0075363_1004808882 68
293 3300006048 Ga0075363_100504249 Ga0075363_1005042492 68
294 3300006051 Ga0075364_10021442 Ga0075364_100214425 68
295 3300006051 Ga0075364_10027559 Ga0075364_100275592 68
296 3300006175 Ga0070712_101955211 Ga0070712_1019552111 68
297 3300006237 Ga0097621_100184659 Ga0097621_1001846593 68
298 3300006358 Ga0068871_100307811 Ga0068871_1003078112 68
299 3300006914 Ga0075436_100745088 Ga0075436_1007450882 68
300 3300009098 Ga0105245_10001831 Ga0105245_1000183115 68
301 3300009098 Ga0105245_10005744 Ga0105245_100057444 68
302 3300009101 Ga0105247_10137206 Ga0105247_101372064 68
303 3300009147 Ga0114129_10621598 Ga0114129_106215982 68
304 3300009148 Ga0105243_10053059 Ga0105243_100530592 68
305 3300009148 Ga0105243_11794225 Ga0105243_117942252 68
306 3300009174 Ga0105241_10083959 Ga0105241_100839594 68
307 3300009174 Ga0105241_10120186 Ga0105241_101201863 68
308 3300009176 Ga0105242_10022832 Ga0105242_100228325 68
309 3300009176 Ga0105242_11920673 Ga0105242_119206731 68
310 3300009177 Ga0105248_10000008 Ga0105248_10000008366 68
311 3300009177 Ga0105248_10446267 Ga0105248_104462672 68
312 3300010375 Ga0105239_10043707 Ga0105239_100437074 68
313 3300010375 Ga0105239_11568049 Ga0105239_115680491 68
314 3300011119 Ga0105246_10690672 Ga0105246_106906722 68
315 3300013104 Ga0157370_10132387 Ga0157370_101323873 68
316 3300013105 Ga0157369_10000110 Ga0157369_1000011097 68
317 3300013297 Ga0157378_10001375 Ga0157378_1000137511 68
318 3300013297 Ga0157378_10031676 Ga0157378_100316765 68
319 3300013308 Ga0157375_10000765 Ga0157375_1000076536 68
320 3300013308 Ga0157375_10000885 Ga0157375_1000088511 68
321 3300020082 Ga0206353_11289487 Ga0206353_112894873 68
322 3300025321 Ga0207656_10000084 Ga0207656_100000849 68
323 3300025321 Ga0207656_10463700 Ga0207656_104637001 68
324 3300025899 Ga0207642_10005123 Ga0207642_100051233 68
325 3300025900 Ga0207710_10662480 Ga0207710_106624802 68
326 3300025903 Ga0207680_10025490 Ga0207680_100254903 68
327 3300025909 Ga0207705_10153233 Ga0207705_101532332 68
328 3300025911 Ga0207654_10040090 Ga0207654_100400903 68
329 3300025920 Ga0207649_10000003 Ga0207649_10000003194 68
330 3300025925 Ga0207650_10049183 Ga0207650_100491832 68
331 3300025926 Ga0207659_10000018 Ga0207659_10000018112 68
332 3300025927 Ga0207687_10000007 Ga0207687_10000007373 68
333 3300025927 Ga0207687_10003583 Ga0207687_100035834 68
334 3300025929 Ga0207664_10302769 Ga0207664_103027692 68
335 3300025934 Ga0207686_10045574 Ga0207686_100455741 68
336 3300025934 Ga0207686_10072382 Ga0207686_100723825 68
337 3300025935 Ga0207709_10024483 Ga0207709_100244833 68
338 3300025935 Ga0207709_11268017 Ga0207709_112680172 68
339 3300025937 Ga0207669_10000262 Ga0207669_1000026213 68
340 3300025941 Ga0207711_10000006 Ga0207711_10000006760 68
341 3300025941 Ga0207711_10315375 Ga0207711_103153753 68
342 3300025944 Ga0207661_10000247 Ga0207661_1000024730 68
343 3300025945 Ga0207679_10800857 Ga0207679_108008571 68
344 3300025949 Ga0207667_10405470 Ga0207667_104054702 68
345 3300025961 Ga0207712_11063448 Ga0207712_110634481 68
346 3300025972 Ga0207668_10239059 Ga0207668_102390592 68
347 3300025981 Ga0207640_10000074 Ga0207640_1000007444 68
348 3300025981 Ga0207640_10349471 Ga0207640_103494712 68
349 3300025986 Ga0207658_10205483 Ga0207658_102054833 68
350 3300026023 Ga0207677_10003263 Ga0207677_100032637 68
351 3300026035 Ga0207703_10000030 Ga0207703_10000030113 68
352 3300026035 Ga0207703_11254942 Ga0207703_112549421 68
353 3300026075 Ga0207708_10435811 Ga0207708_104358112 68
354 3300026078 Ga0207702_10012965 Ga0207702_100129654 68
355 3300026121 Ga0207683_10005878 Ga0207683_100058786 68
356 3300026121 Ga0207683_10387885 Ga0207683_103878852 68
357 3300026142 Ga0207698_10000440 Ga0207698_1000044019 68
358 3300026142 Ga0207698_10068547 Ga0207698_100685474 68
359 3300027866 Ga0209813_10319235 Ga0209813_103192352 68
360 3300028379 Ga0268266_10000731 Ga0268266_1000073142 68
361 3300028379 Ga0268266_10760683 Ga0268266_107606831 68
362 3300028379 Ga0268266_10831419 Ga0268266_108314191 68
363 3300031901 Ga0307406_11380317 Ga0307406_113803172 68
364 3300035398 Ga0316574_0279564 Ga0316574_0279564_542_751 68
365 3300037418 Ga0395900_0127654 Ga0395900_0127654_1722_1940 68
366 3300037418 Ga0395900_0859586 Ga0395900_0859586_174_392 68
367 3300037466 Ga0395898_0002556 Ga0395898_0002556_6265_6483 68
368 3300037466 Ga0395898_0010927 Ga0395898_0010927_1286_1504 68
369 3300037471 Ga0395905_0097284 Ga0395905_0097284_1096_1314 68
370 3300037471 Ga0395905_1716403 Ga0395905_1716403_195_413 68
371 3300038443 Ga0395901_0037726 Ga0395901_0037726_4310_4528 68
372 3300038443 Ga0395901_0099723 Ga0395901_0099723_1887_2105 68
373 3300041486 Ga0451807_1623212 Ga0451807_1623212_428_634 68
374 3300041491 Ga0451833_1008300 Ga0451833_1008300_484_690 68
375 3300041512 Ga0451853_0045614 Ga0451853_0045614_202_426 68
376 3300041512 Ga0451853_1286025 Ga0451853_1286025_193_399 68
377 3300041512 Ga0451853_2295057 Ga0451853_2295057_76_282 68
378 3300041512 Ga0451853_2500954 Ga0451853_2500954_158_367 68
379 3300044694 Ga0466963_0130356 Ga0466963_0130356_120_338 68
380 3300045976 Ga0466967_0011675 Ga0466967_0011675_5088_5300 68
381 3300045976 Ga0466967_0759431 Ga0466967_0759431_429_644 68
382 3300045976 Ga0466967_0973862 Ga0466967_0973862_64_285 68
383 3300046454 Ga0495592_0217873 Ga0495592_0217873_89_298 68
384 3300046455 Ga0495603_0066301 Ga0495603_0066301_479_706 68
385 3300046459 Ga0495629_0000025 Ga0495629_0000025_46653_46862 68
386 3300046461 Ga0495641_0008978 Ga0495641_0008978_5129_5338 68
387 3300046461 Ga0495641_0009617 Ga0495641_0009617_2343_2570 68
388 3300046461 Ga0495641_0025870 Ga0495641_0025870_885_1094 68
389 3300046461 Ga0495641_0506610 Ga0495641_0506610_279_506 68
390 3300046463 Ga0495653_0426870 Ga0495653_0426870_534_752 68
391 3300046473 Ga0495582_0041284 Ga0495582_0041284_54_281 68
392 3300046499 Ga0495594_0040804 Ga0495594_0040804_1838_2065 68
393 3300046507 Ga0495606_0000017 Ga0495606_0000017_223859_224068 68
394 3300046512 Ga0495610_0034248 Ga0495610_0034248_1201_1410 68
395 3300046516 Ga0495628_0000437 Ga0495628_0000437_4860_5069 68
396 3300046516 Ga0495628_0639452 Ga0495628_0639452_225_434 68
397 3300046517 Ga0495630_0000034 Ga0495630_0000034_53701_53910 68
398 3300046529 Ga0495652_0008710 Ga0495652_0008710_6331_6540 68
399 3300046543 Ga0495645_0132645 Ga0495645_0132645_341_550 68
400 3300046559 Ga0495667_0050252 Ga0495667_0050252_1469_1687 68
401 3300046642 Ga0495634_0001012 Ga0495634_0001012_7052_7261 68
402 3300046674 Ga0495588_0000073 Ga0495588_0000073_38919_39128 68
403 3300046674 Ga0495588_0129313 Ga0495588_0129313_857_1084 68
404 3300046681 Ga0495647_0000079 Ga0495647_0000079_20294_20503 68
405 3300046681 Ga0495647_0136511 Ga0495647_0136511_550_759 68
406 3300046683 Ga0495658_0002349 Ga0495658_0002349_975_1181 68
407 3300046683 Ga0495658_0663214 Ga0495658_0663214_57_284 68
408 3300046683 Ga0495658_0814722 Ga0495658_0814722_20_229 68
409 3300046689 Ga0495613_0046202 Ga0495613_0046202_1251_1469 68
410 3300046690 Ga0495624_0000220 Ga0495624_0000220_15461_15670 68
411 3300046690 Ga0495624_0157051 Ga0495624_0157051_479_706 68
412 3300046810 Ga0495660_0403310 Ga0495660_0403310_150_359 68
413 3300047315 Ga0495581_0112129 Ga0495581_0112129_789_1016 68
414 3300047320 Ga0495672_0050776 Ga0495672_0050776_1447_1668 68
415 3300047320 Ga0495672_0053831 Ga0495672_0053831_1495_1704 68
416 3300047321 Ga0495676_0076637 Ga0495676_0076637_1910_2137 68
417 3300047321 Ga0495676_0365283 Ga0495676_0365283_427_636 68
418 3300047321 Ga0495676_0581806 Ga0495676_0581806_78_305 68
419 3300048088 Ga0495602_0036860 Ga0495602_0036860_252_461 68
420 3300048089 Ga0495614_0454937 Ga0495614_0454937_211_438 68
421 3300048905 Ga0496102_1437865 Ga0496102_1437865_390_596 68
422 3300048911 Ga0496108_0000413 Ga0496108_0000413_8134_8352 68
423 3300048912 Ga0496109_0000333 Ga0496109_0000333_23195_23413 68
424 3300048912 Ga0496109_0013316 Ga0496109_0013316_1771_1980 68
425 3300048912 Ga0496109_0136198 Ga0496109_0136198_609_839 68
426 3300048913 Ga0496110_0000235 Ga0496110_0000235_11076_11285 68
427 3300048913 Ga0496110_0053987 Ga0496110_0053987_1772_1981 68
428 3300048914 Ga0496111_0000011 Ga0496111_0000011_61185_61394 68
429 3300048914 Ga0496111_0023479 Ga0496111_0023479_2206_2415 68
430 3300048915 Ga0496112_0005405 Ga0496112_0005405_6352_6561 68
431 3300048916 Ga0496113_0000001 Ga0496113_0000001_58575_58784 68
432 3300048916 Ga0496113_0569111 Ga0496113_0569111_123_353 68
433 3300048917 Ga0496114_0000003 Ga0496114_0000003_578710_578916 68
434 3300048917 Ga0496114_0326997 Ga0496114_0326997_586_792 68
435 3300048918 Ga0496115_0000016 Ga0496115_0000016_101868_102074 68
436 3300048918 Ga0496115_0000031 Ga0496115_0000031_72587_72793 68
437 3300048927 Ga0496124_0157424 Ga0496124_0157424_897_1106 68
438 3300049589 Ga0501073_0873753 Ga0501073_0873753_257_466 68
439 3300050490 nmdc:mga03n38_645464_c1 nmdc:mga03n38_645464_c1_161_370 68
440 3300050491 nmdc:mga00v17_28412_c1 nmdc:mga00v17_28412_c1_2596_2823 68
441 3300050491 nmdc:mga00v17_59606_c1 nmdc:mga00v17_59606_c1_232_459 68
442 3300050492 nmdc:mga0yw44_505647_c1 nmdc:mga0yw44_505647_c1_138_347 68
443 3300050492 nmdc:mga0yw44_592255_c1 nmdc:mga0yw44_592255_c1_287_499 68
444 3300050492 nmdc:mga0yw44_685336_c1 nmdc:mga0yw44_685336_c1_369_578 68
445 3300050492 nmdc:mga0yw44_77397_c1 nmdc:mga0yw44_77397_c1_1280_1507 68
446 3300050492 nmdc:mga0yw44_994593_c1 nmdc:mga0yw44_994593_c1_289_513 68
447 3300050494 nmdc:mga06z11_604071_c1 nmdc:mga06z11_604071_c1_74_283 68
448 3300050495 nmdc:mga04h51_353199_c1 nmdc:mga04h51_353199_c1_134_352 68
449 3300050507 nmdc:mga05p37_2107324_c1 nmdc:mga05p37_2107324_c1_128_352 68
450 3300050507 nmdc:mga05p37_828422_c1 nmdc:mga05p37_828422_c1_265_492 68
451 3300053078 Ga0495612_0009368 Ga0495612_0009368_1903_2109 68
452 3300053085 Ga0495619_0000001 Ga0495619_0000001_287848_288066 68
453 3300053085 Ga0495619_0483397 Ga0495619_0483397_178_387 68
454 3300053085 Ga0495619_0913863 Ga0495619_0913863_63_269 68
455 3300054114 Ga0501084_1189365 Ga0501084_1189365_337_546 68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xk0-assembly1.cif.gz_A solution structure of the tudor domain from drosophila polycomblike (pcl) 0.8697 8 65
6kco-assembly8.cif.gz_P shuguo pwwp in complex with ssdna 0.8686 8 65
6ie7-assembly1.cif.gz_A crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me2 0.8641 7 68
8h43-assembly3.cif.gz_C crystal structure of phf1 tudor domain in complex with hit 1 0.8637 9 68
6ie7-assembly3.cif.gz_C crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me2 0.8599 7 68
ID Description Score Start End Superfamily
af_Q9ZVT1_72_152_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8869 8 66 2.30.30.140
af_A0A0N7KQS4_223_284_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8824 10 66 2.30.30.140
2xk0A00 Mainly Beta;Roll;SH3 type barrels.; 0.8697 8 65 2.30.30.140
af_Q9VFP7_9_111_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8691 8 65 2.30.30.140
af_K7K6T0_75_151_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.864 7 66 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A7J9YY44-F1-model_v4 NlpC/P60 domain-containing protein 0.9302 8 68
AF-A0A7K0S257-F1-model_v4 Uncharacterized protein 0.9283 9 68
AF-A0A1M3BBJ3-F1-model_v4 Uncharacterized protein 0.9261 3 67
AF-D3F1R1-F1-model_v4 Uncharacterized protein 0.9234 9 67
AF-A0A7J9YY44-F1-model_v4 NlpC/P60 domain-containing protein 0.8891 8 68

Feature Viewer

pLDDT pTM Quality
82.56 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map