F447501

General Info

Members Datasets Scaffolds Average Seq Length
455 289 910 212

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10033200|JGI25404J52841_100332001
Length 247
Sequence VTFRGWPAEALEFYEGLEADNSKTYWTAHKTVYDDTVRRPMDELLAELEPEFGAGKVFRPYRDVRFSADKTPYKTHLGAWLERGGYIQLSATGLAAGRGMWMMSPEQLDRYRRAVAEERSGXELETVVAAVRKRGIDVMGHGVLRTAPRGYPRDHPRAELLRYKGLTAWRQWPVASWLGTATAKRRIVEFLHDARPLAEWLPPPPDRGVPARRAAAGRMARLPGSRGLTVRCGLSQDSVGRSPSQGS

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
111 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
156 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
157 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
158 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
223 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
239 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
257 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
262 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
267 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
268 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
273 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
274 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
275 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
276 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
277 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
278 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
285 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
286 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
287 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
288 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
289 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 1.1
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 3.08
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 7.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10033200 3300003659 Bacteria 1100
2 Ga0070658_10019508 3300005327 Bacteria 5429
3 Ga0070683_100010464 3300005329 Bacteria 7976
4 Ga0070683_100109077 3300005329 Bacteria 2611
5 Ga0068869_100034859 3300005334 Bacteria 3564
6 Ga0070680_100328002 3300005336 Bacteria 1300
7 Ga0070680_100413938 3300005336 Bacteria 1150
8 Ga0068868_100002027 3300005338 Bacteria 13925
9 Ga0070660_100014123 3300005339 Bacteria 5750
10 Ga0070660_100027844 3300005339 Bacteria 4222
11 Ga0070689_100342980 3300005340 Bacteria 1251
12 Ga0070691_10033442 3300005341 Bacteria 2419
13 Ga0070661_100030114 3300005344 Bacteria 3920
14 Ga0070692_10138425 3300005345 Bacteria 1375
15 Ga0070668_100326618 3300005347 Bacteria 1293
16 Ga0070675_100000500 3300005354 Bacteria 26911
17 Ga0070674_100091864 3300005356 Bacteria 2193
18 Ga0070659_100003337 3300005366 Bacteria 11424
19 Ga0070659_100182654 3300005366 Bacteria 1722
20 Ga0070667_100033506 3300005367 Bacteria 4294
21 Ga0070714_100043437 3300005435 Bacteria 3801
22 Ga0070714_100408889 3300005435 Bacteria 1284
23 Ga0070713_100131660 3300005436 Bacteria 2206
24 Ga0070710_10091449 3300005437 Unclassified 1795
25 Ga0070701_10091645 3300005438 Bacteria 1666
26 Ga0070711_100021639 3300005439 Bacteria 4160
27 Ga0070711_100317886 3300005439 Bacteria 1243
28 Ga0070700_100009423 3300005441 Bacteria 5359
29 Ga0070700_100260295 3300005441 Unclassified 1249
30 Ga0070708_100005761 3300005445 Bacteria 9832
31 Ga0070708_100298374 3300005445 Unclassified 1517
32 Ga0070708_101119615 3300005445 Bacteria 737
33 Ga0070678_100737347 3300005456 Bacteria 890
34 Ga0070662_100056011 3300005457 Bacteria 2862
35 Ga0070662_100366621 3300005457 Bacteria 1183
36 Ga0070681_10294239 3300005458 Bacteria 1533
37 Ga0070706_100094458 3300005467 Bacteria 2775
38 Ga0070707_100085123 3300005468 Bacteria 3055
39 Ga0070698_100007998 3300005471 Bacteria 11433
40 Ga0070698_100071036 3300005471 Bacteria 3492
41 Ga0070698_100226180 3300005471 Bacteria 1804
42 Ga0070698_100237740 3300005471 Bacteria 1755
43 Ga0070699_100051236 3300005518 Bacteria 3574
44 Ga0070699_100786110 3300005518 Bacteria 871
45 Ga0070679_100006502 3300005530 Bacteria 10897
46 Ga0070679_101010296 3300005530 Bacteria 776
47 Ga0070684_100003092 3300005535 Bacteria 12419
48 Ga0070684_100073237 3300005535 Bacteria 3018
49 Ga0070684_100138351 3300005535 Bacteria 2201
50 Ga0070684_100215594 3300005535 Bacteria 1750
51 Ga0070672_100143544 3300005543 Bacteria 1971
52 Ga0070693_100333496 3300005547 Bacteria 1033
53 Ga0070664_100000986 3300005564 Bacteria 22287
54 Ga0068857_100001211 3300005577 Bacteria 20120
55 Ga0068857_100128827 3300005577 Bacteria 2281
56 Ga0068857_100914090 3300005577 Bacteria 842
57 Ga0070702_100021964 3300005615 Bacteria 3367
58 Ga0068852_100534966 3300005616 Bacteria 1170
59 Ga0068861_100072695 3300005719 Bacteria 2669
60 Ga0068870_10076526 3300005840 Bacteria 1838
61 Ga0068858_100015872 3300005842 Bacteria 7080
62 Ga0068858_100193277 3300005842 Bacteria 1923
63 Ga0068860_100027924 3300005843 Bacteria 5434
64 Ga0068860_100168323 3300005843 Bacteria 2116
65 Ga0068862_100177915 3300005844 Bacteria 1908
66 Ga0081455_10003875 3300005937 Bacteria 17041
67 Ga0081455_10099640 3300005937 Bacteria 2336
68 Ga0081540_1001693 3300005983 Bacteria 18703
69 Ga0075365_10083346 3300006038 Bacteria 2169
70 Ga0070716_100231925 3300006173 Unclassified 1247
71 Ga0070712_100059549 3300006175 Bacteria 2690
72 Ga0075369_10010928 3300006186 Bacteria 3558
73 Ga0075428_100195774 3300006844 Bacteria 2186
74 Ga0075431_100122852 3300006847 Bacteria 2679
75 Ga0105247_10253668 3300009101 Bacteria 1203
76 Ga0114129_10179868 3300009147 Bacteria 2878
77 Ga0114129_10385260 3300009147 Bacteria 1851
78 Ga0114129_10966714 3300009147 Bacteria 1075
79 Ga0105243_10031924 3300009148 Bacteria 4064
80 Ga0105248_10705870 3300009177 Bacteria 1138
81 Ga0105238_10204508 3300009551 Bacteria 1950
82 Ga0105239_10533776 3300010375 Bacteria 1335
83 Ga0105246_10372565 3300011119 Bacteria 1177
84 Ga0157370_10574005 3300013104 Bacteria 1033
85 Ga0157369_10022123 3300013105 Bacteria 7103
86 Ga0157369_10068838 3300013105 Bacteria 3803
87 Ga0157372_10146352 3300013307 Bacteria 2724
88 Ga0157375_10123325 3300013308 Bacteria 2703
89 Ga0163163_10711347 3300014325 Bacteria 1068
90 Ga0157380_10128298 3300014326 Bacteria 2160
91 Ga0206354_11326585 3300020081 Bacteria 1142
92 Ga0206353_11061338 3300020082 Bacteria 6422
93 Ga0213875_10022138 3300021388 Bacteria 3041
94 Ga0224712_10005748 3300022467 Bacteria 3486
95 Ga0224712_10006177 3300022467 Bacteria 3392
96 Ga0228598_1041020 3300024227 Bacteria 914
97 Ga0209051_1056713 3300025303 Bacteria 1260
98 Ga0207699_10006824 3300025906 Bacteria 5552
99 Ga0207705_10014673 3300025909 Bacteria 5635
100 Ga0207654_10110069 3300025911 Bacteria 1712
101 Ga0207707_10147590 3300025912 Bacteria 2056
102 Ga0207693_10037180 3300025915 Bacteria 3837
103 Ga0207693_10073550 3300025915 Bacteria 2676
104 Ga0207663_10074139 3300025916 Bacteria 2205
105 Ga0207660_10346958 3300025917 Bacteria 1189
106 Ga0207657_10035945 3300025919 Bacteria 4437
107 Ga0207657_10036640 3300025919 Bacteria 4389
108 Ga0207652_10869451 3300025921 Bacteria 798
109 Ga0207646_10040278 3300025922 Bacteria 4202
110 Ga0207694_10765190 3300025924 Bacteria 815
111 Ga0207650_10161077 3300025925 Bacteria 1778
112 Ga0207650_10432879 3300025925 Bacteria 1093
113 Ga0207700_10015863 3300025928 Bacteria 4985
114 Ga0207700_10047105 3300025928 Bacteria 3193
115 Ga0207700_10475428 3300025928 Bacteria 1104
116 Ga0207664_10019735 3300025929 Bacteria 4988
117 Ga0207664_10351357 3300025929 Bacteria 1305
118 Ga0207690_10010688 3300025932 Bacteria 5469
119 Ga0207690_10033030 3300025932 Bacteria 3324
120 Ga0207706_10219530 3300025933 Bacteria 1665
121 Ga0207709_10316457 3300025935 Bacteria 1166
122 Ga0207704_10026741 3300025938 Bacteria 3170
123 Ga0207704_10524473 3300025938 Bacteria 959
124 Ga0207665_10733723 3300025939 Bacteria 778
125 Ga0207691_10220169 3300025940 Bacteria 1646
126 Ga0207691_10643467 3300025940 Bacteria 896
127 Ga0207711_10079584 3300025941 Bacteria 2861
128 Ga0207689_10004013 3300025942 Bacteria 13390
129 Ga0207661_10004263 3300025944 Bacteria 10012
130 Ga0207661_10343126 3300025944 Bacteria 1346
131 Ga0207679_10006572 3300025945 Bacteria 7350
132 Ga0207679_10938181 3300025945 Bacteria 792
133 Ga0207667_10986228 3300025949 Bacteria 830
134 Ga0207668_10270290 3300025972 Bacteria 1389
135 Ga0207658_10032940 3300025986 Unclassified 3693
136 Ga0207658_10103659 3300025986 Bacteria 2234
137 Ga0207677_10004469 3300026023 Bacteria 7511
138 Ga0207703_10273348 3300026035 Bacteria 1532
139 Ga0207678_10404940 3300026067 Unclassified 1181
140 Ga0207708_10052587 3300026075 Bacteria 3102
141 Ga0207708_10931316 3300026075 Bacteria 753
142 Ga0207702_10195505 3300026078 Bacteria 1872
143 Ga0207674_10003876 3300026116 Bacteria 18233
144 Ga0207674_10043192 3300026116 Bacteria 4649
145 Ga0207675_100109349 3300026118 Bacteria 2608
146 Ga0207428_10017846 3300027907 Bacteria 6083
147 Ga0268266_10322303 3300028379 Bacteria 1447
148 Ga0268265_10026498 3300028380 Bacteria 4126
149 Ga0268265_10170652 3300028380 Bacteria 1859
150 Ga0268264_10036234 3300028381 Bacteria 4063
151 Ga0268264_10324020 3300028381 Bacteria 1458
152 Ga0307515_10011698 3300028794 Bacteria 16610
153 Ga0307515_10044959 3300028794 Bacteria 6802
154 Ga0307512_10011587 3300030522 Bacteria 8348
155 Ga0265763_1001652 3300030763 Bacteria 1619
156 Ga0307513_10008091 3300031456 Bacteria 13496
157 Ga0307513_10037676 3300031456 Bacteria 5379
158 Ga0307509_10005125 3300031507 Bacteria 18416
159 Ga0307508_10002757 3300031616 Bacteria 18304
160 Ga0307508_10021928 3300031616 Bacteria 5811
161 Ga0307508_10025556 3300031616 Bacteria 5353
162 Ga0307508_10220611 3300031616 Bacteria 1496
163 Ga0307516_10058944 3300031730 Bacteria 3735
164 Ga0307516_10376747 3300031730 Bacteria 1081
165 Ga0307405_10358539 3300031731 Bacteria 1127
166 Ga0307413_10144750 3300031824 Bacteria 1648
167 Ga0307410_10201890 3300031852 Bacteria 1518
168 Ga0307406_10024385 3300031901 Bacteria 3613
169 Ga0307406_10332497 3300031901 Bacteria 1180
170 Ga0307412_10411508 3300031911 Bacteria 1104
171 Ga0307409_100006402 3300031995 Bacteria 6916
172 Ga0307409_100070394 3300031995 Bacteria 2776
173 Ga0307416_100910672 3300032002 Bacteria 980
174 Ga0307411_10100664 3300032005 Bacteria 2043
175 Ga0307415_100070435 3300032126 Bacteria 2455
176 Ga0307415_100430122 3300032126 Bacteria 1135
177 Ga0307507_10036770 3300033179 Bacteria 4998
178 Ga0307510_10189027 3300033180 Bacteria 1610
179 Ga0373934_0021322 3300035086 Bacteria 2495
180 Ga0373923_0020328 3300035111 Bacteria 2578
181 Ga0373932_0055106 3300035112 Bacteria 1192
182 Ga0373953_0010932 3300035117 Bacteria 3172
183 Ga0373954_0029886 3300035118 Bacteria 2512
184 Ga0373954_0170861 3300035118 Bacteria 1065
185 Ga0373956_0015527 3300035119 Bacteria 3190
186 Ga0373957_0001523 3300035120 Bacteria 6308
187 Ga0373955_0090916 3300035172 Unclassified 1739
188 Ga0373962_0003019 3300035242 Bacteria 4029
189 Ga0373924_0050388 3300035410 Unclassified 1724
190 Ga0373935_0011081 3300035692 Bacteria 5416
191 Ga0373935_0025861 3300035692 Bacteria 3618
192 Ga0373935_0258731 3300035692 Bacteria 1220
193 Ga0373933_0079807 3300035724 Bacteria 2004
194 Ga0373947_0006055 3300035725 Bacteria 7049
195 Ga0373937_0076535 3300036401 Bacteria 3090
196 Ga0373925_0009209 3300037068 Bacteria 7187
197 Ga0373925_0010724 3300037068 Bacteria 6646
198 Ga0395899_0074869 3300037312 Bacteria 2473
199 Ga0395899_0085263 3300037312 Bacteria 2295
200 Ga0395900_0008596 3300037418 Bacteria 10491
201 Ga0395900_0012337 3300037418 Bacteria 8743
202 Ga0395900_0068819 3300037418 Bacteria 3638
203 Ga0395900_0069621 3300037418 Bacteria 3616
204 Ga0395900_0144012 3300037418 Bacteria 2438
205 Ga0395898_0002827 3300037466 Bacteria 19891
206 Ga0395898_0003667 3300037466 Bacteria 17067
207 Ga0395898_0027202 3300037466 Bacteria 5745
208 Ga0395898_0140182 3300037466 Bacteria 2315
209 Ga0395898_0400674 3300037466 Bacteria 1308
210 Ga0395905_0009412 3300037471 Bacteria 9552
211 Ga0395905_0043706 3300037471 Bacteria 4203
212 Ga0395905_0053428 3300037471 Bacteria 3781
213 Ga0395905_0287422 3300037471 Bacteria 1531
214 Ga0436364_0095977 3300037853 Bacteria 1282
215 Ga0436364_1245595 3300037853 Bacteria 3237
216 Ga0395901_0018621 3300038443 Bacteria 7092
217 Ga0395901_0026395 3300038443 Bacteria 5963
218 Ga0395901_0027670 3300038443 Bacteria 5828
219 Ga0395901_0105380 3300038443 Bacteria 2959
220 Ga0451837_1125836 3300041494 Bacteria 1723
221 Ga0466969_0350725 3300044656 Bacteria 668
222 Ga0466972_0013410 3300044658 Bacteria 4115
223 Ga0466965_0219396 3300044683 Bacteria 1013
224 Ga0466966_0019366 3300044684 Bacteria 4478
225 Ga0466966_0095742 3300044684 Bacteria 1839
226 Ga0466966_0159868 3300044684 Unclassified 1372
227 Ga0466961_0004577 3300044693 Bacteria 8683
228 Ga0466961_0063475 3300044693 Bacteria 2347
229 Ga0466961_0129429 3300044693 Bacteria 1582
230 Ga0466961_0158439 3300044693 Bacteria 1411
231 Ga0466961_0270398 3300044693 Bacteria 1041
232 Ga0466963_0044438 3300044694 Bacteria 2924
233 Ga0466963_0193641 3300044694 Bacteria 1420
234 Ga0466963_0303342 3300044694 Bacteria 1123
235 Ga0466971_0008099 3300044719 Bacteria 4583
236 Ga0466971_0073348 3300044719 Bacteria 1555
237 Ga0466968_0139231 3300044735 Bacteria 1109
238 Ga0466968_0349817 3300044735 Bacteria 718
239 Ga0466970_0007018 3300044765 Bacteria 5638
240 Ga0466970_0390640 3300044765 Bacteria 793
241 Ga0466957_0186560 3300044842 Bacteria 1356
242 Ga0466959_0018760 3300045049 Bacteria 5081
243 Ga0466959_0056595 3300045049 Unclassified 2861
244 Ga0466958_0013834 3300045836 Bacteria 4601
245 Ga0466958_0048562 3300045836 Bacteria 2565
246 Ga0466958_0064597 3300045836 Bacteria 2233
247 Ga0466958_0292296 3300045836 Bacteria 1045
248 Ga0466958_0319948 3300045836 Bacteria 997
249 Ga0466967_0006470 3300045976 Bacteria 8295
250 Ga0466967_0034191 3300045976 Bacteria 4312
251 Ga0466967_0087353 3300045976 Bacteria 2827
252 Ga0466967_1124831 3300045976 Bacteria 782
253 Ga0495627_035308 3300046453 Bacteria 1559
254 Ga0495592_0110276 3300046454 Bacteria 1948
255 Ga0495592_0226933 3300046454 Unclassified 1245
256 Ga0495603_0058289 3300046455 Bacteria 2284
257 Ga0495629_0000972 3300046459 Bacteria 23076
258 Ga0495629_0116181 3300046459 Bacteria 1865
259 Ga0495638_0068745 3300046460 Bacteria 2171
260 Ga0495651_0036575 3300046462 Bacteria 3822
261 Ga0495651_0170037 3300046462 Bacteria 1553
262 Ga0495653_0010111 3300046463 Bacteria 7720
263 Ga0495653_0084366 3300046463 Bacteria 2340
264 Ga0495580_0644674 3300046472 Bacteria 697
265 Ga0495582_0000274 3300046473 Bacteria 28739
266 Ga0495664_0134229 3300046477 Bacteria 1499
267 Ga0495607_0102262 3300046501 Bacteria 1533
268 Ga0495608_0015948 3300046511 Bacteria 5201
269 Ga0495618_0031346 3300046514 Bacteria 3325
270 Ga0495628_0142535 3300046516 Bacteria 1828
271 Ga0495630_0364898 3300046517 Bacteria 1106
272 Ga0495632_0067740 3300046519 Bacteria 1721
273 Ga0495643_0006729 3300046522 Bacteria 7523
274 Ga0495666_0163193 3300046526 Bacteria 1032
275 Ga0495652_0182748 3300046529 Unclassified 1607
276 Ga0495665_0002852 3300046531 Bacteria 9338
277 Ga0495665_0038699 3300046531 Bacteria 2542
278 Ga0495640_0046137 3300046533 Bacteria 3021
279 Ga0495586_0115659 3300046535 Bacteria 1495
280 Ga0495645_0046545 3300046543 Bacteria 3161
281 Ga0495622_0052916 3300046557 Bacteria 1884
282 Ga0495633_0141874 3300046558 Bacteria 1111
283 Ga0495667_0027332 3300046559 Bacteria 3845
284 Ga0495667_0161552 3300046559 Bacteria 1441
285 Ga0495656_0027150 3300046615 Bacteria 2285
286 Ga0495656_0113195 3300046615 Bacteria 1272
287 Ga0495634_0036787 3300046642 Bacteria 3346
288 Ga0495634_0234071 3300046642 Bacteria 1129
289 Ga0495635_0033999 3300046663 Bacteria 3536
290 Ga0495588_0310863 3300046674 Bacteria 829
291 Ga0495657_0038208 3300046675 Bacteria 3305
292 Ga0495599_0060104 3300046678 Bacteria 2376
293 Ga0495623_0056376 3300046679 Bacteria 2474
294 Ga0495646_0008390 3300046680 Bacteria 6567
295 Ga0495647_0135618 3300046681 Bacteria 1046
296 Ga0495658_0012122 3300046683 Bacteria 4355
297 Ga0495613_0007160 3300046689 Bacteria 8307
298 Ga0495613_0206472 3300046689 Bacteria 1383
299 Ga0495624_0168175 3300046690 Unclassified 1338
300 Ga0495600_0071699 3300046809 Unclassified 2263
301 Ga0495660_0039137 3300046810 Bacteria 2634
302 Ga0495581_0000177 3300047315 Bacteria 29096
303 Ga0495581_0002988 3300047315 Bacteria 9689
304 Ga0495604_0046101 3300047317 Bacteria 3399
305 Ga0495674_0232112 3300047319 Bacteria 1522
306 Ga0495676_0212655 3300047321 Bacteria 1337
307 Ga0495676_0255804 3300047321 Bacteria 1193
308 Ga0495680_0343615 3300047322 Bacteria 1040
309 Ga0495675_0019682 3300047444 Bacteria 4289
310 Ga0495679_020873 3300047446 Bacteria 2274
311 Ga0495685_000097 3300047447 Bacteria 31828
312 Ga0495681_0004590 3300047470 Bacteria 9403
313 Ga0495684_0017444 3300047471 Bacteria 5527
314 Ga0495593_0277422 3300047673 Bacteria 838
315 Ga0495602_0113965 3300048088 Bacteria 2190
316 Ga0496105_0190924 3300048908 Bacteria 1675
317 Ga0496108_0069174 3300048911 Bacteria 2979
318 Ga0496108_1138866 3300048911 Bacteria 662
319 Ga0496109_0044824 3300048912 Bacteria 4013
320 Ga0496109_0084924 3300048912 Bacteria 2921
321 Ga0496109_0107827 3300048912 Bacteria 2588
322 Ga0496109_0180167 3300048912 Bacteria 1984
323 Ga0496110_0045590 3300048913 Bacteria 3833
324 Ga0496110_0187523 3300048913 Bacteria 1878
325 Ga0496111_0039304 3300048914 Bacteria 3392
326 Ga0496112_0122150 3300048915 Bacteria 2575
327 Ga0496112_0232279 3300048915 Bacteria 1799
328 Ga0496113_0514538 3300048916 Bacteria 961
329 Ga0496114_0054628 3300048917 Bacteria 3331
330 Ga0496126_0170641 3300048929 Bacteria 1853
331 Ga0501031_0015490 3300049568 Bacteria 4950
332 Ga0501031_0032949 3300049568 Bacteria 3378
333 Ga0501032_0326812 3300049569 Bacteria 989
334 Ga0501032_0650697 3300049569 Bacteria 669
335 Ga0501033_0156961 3300049570 Unclassified 1639
336 Ga0501033_0331415 3300049570 Bacteria 1068
337 Ga0501033_0337183 3300049570 Bacteria 1057
338 Ga0501034_0176978 3300049571 Bacteria 2099
339 Ga0501036_0322968 3300049572 Unclassified 1289
340 Ga0501037_0019889 3300049573 Bacteria 4955
341 Ga0501037_0055119 3300049573 Bacteria 2907
342 Ga0501037_0461421 3300049573 Unclassified 865
343 Ga0501038_0000215 3300049574 Bacteria 49658
344 Ga0501038_0103441 3300049574 Unclassified 2368
345 Ga0501038_0163744 3300049574 Bacteria 1805
346 Ga0501039_0055115 3300049575 Bacteria 3078
347 Ga0501039_0199462 3300049575 Bacteria 1573
348 Ga0501040_0070838 3300049576 Unclassified 2406
349 Ga0501040_0105835 3300049576 Bacteria 1965
350 Ga0501041_0221005 3300049577 Bacteria 1188
351 Ga0501041_0356589 3300049577 Bacteria 924
352 Ga0501042_0038896 3300049578 Bacteria 3378
353 Ga0501042_0238595 3300049578 Bacteria 1312
354 Ga0501042_0345938 3300049578 Bacteria 1075
355 Ga0501042_0636731 3300049578 Unclassified 775
356 Ga0501043_0009121 3300049579 Bacteria 7804
357 Ga0501043_0280778 3300049579 Unclassified 1276
358 Ga0501043_0395633 3300049579 Bacteria 1044
359 Ga0501046_0186178 3300049580 Bacteria 1550
360 Ga0501046_0314596 3300049580 Bacteria 1141
361 Ga0501047_0003729 3300049581 Bacteria 14348
362 Ga0501047_0324191 3300049581 Bacteria 1380
363 Ga0501048_0000571 3300049582 Bacteria 26167
364 Ga0501048_0050073 3300049582 Bacteria 2975
365 Ga0501048_0285964 3300049582 Bacteria 1172
366 Ga0501048_0361781 3300049582 Bacteria 1035
367 Ga0501068_0019597 3300049584 Bacteria 3931
368 Ga0501068_0129378 3300049584 Bacteria 1578
369 Ga0501069_0268852 3300049585 Unclassified 996
370 Ga0501070_0119674 3300049586 Bacteria 2176
371 Ga0501070_0305486 3300049586 Unclassified 1295
372 Ga0501071_0033170 3300049587 Unclassified 3669
373 Ga0501071_0052250 3300049587 Bacteria 2946
374 Ga0501071_0085259 3300049587 Bacteria 2316
375 Ga0501071_0406580 3300049587 Bacteria 1039
376 Ga0501072_0080598 3300049588 Unclassified 2579
377 Ga0501072_0128163 3300049588 Bacteria 2022
378 Ga0501072_0435667 3300049588 Bacteria 1038
379 Ga0501072_0569677 3300049588 Bacteria 894
380 Ga0501073_0278308 3300049589 Unclassified 1154
381 Ga0501073_0301098 3300049589 Bacteria 1106
382 Ga0501074_0036034 3300049590 Bacteria 3584
383 Ga0501074_0074936 3300049590 Bacteria 2430
384 Ga0501074_0162770 3300049590 Unclassified 1593
385 Ga0501074_0433329 3300049590 Bacteria 932
386 Ga0501075_0001462 3300049591 Bacteria 15371
387 Ga0501075_0015472 3300049591 Bacteria 5476
388 Ga0501075_0342393 3300049591 Bacteria 1139
389 Ga0501075_0542482 3300049591 Unclassified 887
390 Ga0501076_0007775 3300049592 Bacteria 7814
391 Ga0501076_0020006 3300049592 Bacteria 5120
392 Ga0501077_0074529 3300049593 Unclassified 2149
393 Ga0501077_0149026 3300049593 Unclassified 1484
394 Ga0501077_0337894 3300049593 Bacteria 960
395 Ga0501079_0031742 3300049741 Bacteria 4058
396 Ga0501079_0061665 3300049741 Bacteria 2893
397 Ga0501079_0276641 3300049741 Unclassified 1312
398 Ga0501080_0054550 3300049742 Bacteria 3721
399 Ga0501083_0051532 3300049744 Bacteria 2767
400 Ga0501035_0049778 3300049822 Bacteria 3755
401 Ga0501035_0103579 3300049822 Bacteria 2496
402 Ga0501035_0378410 3300049822 Bacteria 1181
403 Ga0501044_0025594 3300049823 Bacteria 6256
404 Ga0501045_0058822 3300049824 Bacteria 2815
405 Ga0501045_0161179 3300049824 Bacteria 1669
406 Ga0501045_0770926 3300049824 Unclassified 708
407 nmdc:mga03n38_65318_c1 3300050490 Bacteria 1668
408 nmdc:mga0yw44_44358_c1 3300050492 Bacteria 2659
409 nmdc:mga05p37_1291160_c1 3300050507 Bacteria 745
410 nmdc:mga05p37_219657_c1 3300050507 Bacteria 2294
411 nmdc:mga09592_156956_c1 3300050508 Bacteria 1964
412 nmdc:mga09592_83336_c1 3300050508 Bacteria 2725
413 nmdc:mga06r32_228178_c1 3300050510 Bacteria 1850
414 nmdc:mga06r32_2846_c3 3300050510 Bacteria 3220
415 nmdc:mga06r32_580323_c1 3300050510 Bacteria 1093
416 nmdc:mga0sz30_17883_c2 3300050516 Bacteria 1373
417 Ga0495601_0094031 3300053077 Unclassified 1931
418 Ga0495619_0185980 3300053085 Bacteria 1437
419 Ga0495619_0204202 3300053085 Bacteria 1368
420 Ga0500578_0037476 3300053086 Bacteria 3114
421 Ga0500578_0153688 3300053086 Bacteria 1432
422 Ga0500651_0119835 3300053093 Bacteria 1598
423 Ga0500566_0140770 3300053094 Bacteria 1280
424 Ga0500641_0053048 3300053096 Bacteria 1673
425 Ga0500641_0055812 3300053096 Bacteria 1636
426 Ga0500650_0265198 3300053098 Bacteria 767
427 Ga0500560_009741 3300053107 Bacteria 2375
428 Ga0500569_056387 3300053109 Bacteria 1201
429 Ga0500569_083989 3300053109 Bacteria 1022
430 Ga0500652_002711 3300053131 Bacteria 5348
431 Ga0500652_003572 3300053131 Bacteria 4718
432 Ga0500658_0056997 3300053134 Bacteria 1614
433 Ga0500658_0111502 3300053134 Bacteria 1204
434 Ga0500559_0011524 3300053136 Bacteria 3776
435 Ga0500561_0000545 3300053137 Bacteria 6059
436 Ga0500573_0010952 3300053140 Bacteria 5069
437 Ga0500579_114272 3300053143 Bacteria 1342
438 Ga0500579_153556 3300053143 Bacteria 995
439 Ga0500600_0015514 3300053149 Bacteria 4623
440 Ga0500616_0129406 3300053153 Bacteria 1194
441 Ga0500633_0091351 3300053160 Bacteria 1112
442 Ga0500633_0130804 3300053160 Bacteria 936
443 Ga0500634_0190892 3300053161 Bacteria 910
444 Ga0500645_000056 3300053730 Bacteria 92126
445 Ga0500587_016269 3300053739 Bacteria 949
446 Ga0501084_0141945 3300054114 Bacteria 2022
447 Ga0501082_0046347 3300060353 Bacteria 3747
448 Ga0530510_0110021 3300061734 Bacteria 2017
449 Ga0530510_0199551 3300061734 Bacteria 1485
450 2623588863 2622736626 Bacteria 7181580
451 2738706332 2738541274 Bacteria 6909446
452 2739204115 2738543005 Bacteria 5278128
453 2739328822 2738543028 Bacteria 6917070
454 2868094405 2868088558 Bacteria 7609351
455 2902804112 2902799365 Bacteria 5419524
456 JGI25404J52841_10033200
457 Ga0070658_10019508
458 Ga0070683_100010464
459 Ga0070683_100109077
460 Ga0068869_100034859
461 Ga0070680_100328002
462 Ga0070680_100413938
463 Ga0068868_100002027
464 Ga0070660_100014123
465 Ga0070660_100027844
466 Ga0070689_100342980
467 Ga0070691_10033442
468 Ga0070661_100030114
469 Ga0070692_10138425
470 Ga0070668_100326618
471 Ga0070675_100000500
472 Ga0070674_100091864
473 Ga0070659_100003337
474 Ga0070659_100182654
475 Ga0070667_100033506
476 Ga0070714_100043437
477 Ga0070714_100408889
478 Ga0070713_100131660
479 Ga0070710_10091449
480 Ga0070701_10091645
481 Ga0070711_100021639
482 Ga0070711_100317886
483 Ga0070700_100009423
484 Ga0070700_100260295
485 Ga0070708_100005761
486 Ga0070708_100298374
487 Ga0070708_101119615
488 Ga0070678_100737347
489 Ga0070662_100056011
490 Ga0070662_100366621
491 Ga0070681_10294239
492 Ga0070706_100094458
493 Ga0070707_100085123
494 Ga0070698_100007998
495 Ga0070698_100071036
496 Ga0070698_100226180
497 Ga0070698_100237740
498 Ga0070699_100051236
499 Ga0070699_100786110
500 Ga0070679_100006502
501 Ga0070679_101010296
502 Ga0070684_100003092
503 Ga0070684_100073237
504 Ga0070684_100138351
505 Ga0070684_100215594
506 Ga0070672_100143544
507 Ga0070693_100333496
508 Ga0070664_100000986
509 Ga0068857_100001211
510 Ga0068857_100128827
511 Ga0068857_100914090
512 Ga0070702_100021964
513 Ga0068852_100534966
514 Ga0068861_100072695
515 Ga0068870_10076526
516 Ga0068858_100015872
517 Ga0068858_100193277
518 Ga0068860_100027924
519 Ga0068860_100168323
520 Ga0068862_100177915
521 Ga0081455_10003875
522 Ga0081455_10099640
523 Ga0081540_1001693
524 Ga0075365_10083346
525 Ga0070716_100231925
526 Ga0070712_100059549
527 Ga0075369_10010928
528 Ga0075428_100195774
529 Ga0075431_100122852
530 Ga0105247_10253668
531 Ga0114129_10179868
532 Ga0114129_10385260
533 Ga0114129_10966714
534 Ga0105243_10031924
535 Ga0105248_10705870
536 Ga0105238_10204508
537 Ga0105239_10533776
538 Ga0105246_10372565
539 Ga0157370_10574005
540 Ga0157369_10022123
541 Ga0157369_10068838
542 Ga0157372_10146352
543 Ga0157375_10123325
544 Ga0163163_10711347
545 Ga0157380_10128298
546 Ga0206354_11326585
547 Ga0206353_11061338
548 Ga0213875_10022138
549 Ga0224712_10005748
550 Ga0224712_10006177
551 Ga0228598_1041020
552 Ga0209051_1056713
553 Ga0207699_10006824
554 Ga0207705_10014673
555 Ga0207654_10110069
556 Ga0207707_10147590
557 Ga0207693_10037180
558 Ga0207693_10073550
559 Ga0207663_10074139
560 Ga0207660_10346958
561 Ga0207657_10035945
562 Ga0207657_10036640
563 Ga0207652_10869451
564 Ga0207646_10040278
565 Ga0207694_10765190
566 Ga0207650_10161077
567 Ga0207650_10432879
568 Ga0207700_10015863
569 Ga0207700_10047105
570 Ga0207700_10475428
571 Ga0207664_10019735
572 Ga0207664_10351357
573 Ga0207690_10010688
574 Ga0207690_10033030
575 Ga0207706_10219530
576 Ga0207709_10316457
577 Ga0207704_10026741
578 Ga0207704_10524473
579 Ga0207665_10733723
580 Ga0207691_10220169
581 Ga0207691_10643467
582 Ga0207711_10079584
583 Ga0207689_10004013
584 Ga0207661_10004263
585 Ga0207661_10343126
586 Ga0207679_10006572
587 Ga0207679_10938181
588 Ga0207667_10986228
589 Ga0207668_10270290
590 Ga0207658_10032940
591 Ga0207658_10103659
592 Ga0207677_10004469
593 Ga0207703_10273348
594 Ga0207678_10404940
595 Ga0207708_10052587
596 Ga0207708_10931316
597 Ga0207702_10195505
598 Ga0207674_10003876
599 Ga0207674_10043192
600 Ga0207675_100109349
601 Ga0207428_10017846
602 Ga0268266_10322303
603 Ga0268265_10026498
604 Ga0268265_10170652
605 Ga0268264_10036234
606 Ga0268264_10324020
607 Ga0307515_10011698
608 Ga0307515_10044959
609 Ga0307512_10011587
610 Ga0265763_1001652
611 Ga0307513_10008091
612 Ga0307513_10037676
613 Ga0307509_10005125
614 Ga0307508_10002757
615 Ga0307508_10021928
616 Ga0307508_10025556
617 Ga0307508_10220611
618 Ga0307516_10058944
619 Ga0307516_10376747
620 Ga0307405_10358539
621 Ga0307413_10144750
622 Ga0307410_10201890
623 Ga0307406_10024385
624 Ga0307406_10332497
625 Ga0307412_10411508
626 Ga0307409_100006402
627 Ga0307409_100070394
628 Ga0307416_100910672
629 Ga0307411_10100664
630 Ga0307415_100070435
631 Ga0307415_100430122
632 Ga0307507_10036770
633 Ga0307510_10189027
634 Ga0373934_0021322
635 Ga0373923_0020328
636 Ga0373932_0055106
637 Ga0373953_0010932
638 Ga0373954_0029886
639 Ga0373954_0170861
640 Ga0373956_0015527
641 Ga0373957_0001523
642 Ga0373955_0090916
643 Ga0373962_0003019
644 Ga0373924_0050388
645 Ga0373935_0011081
646 Ga0373935_0025861
647 Ga0373935_0258731
648 Ga0373933_0079807
649 Ga0373947_0006055
650 Ga0373937_0076535
651 Ga0373925_0009209
652 Ga0373925_0010724
653 Ga0395899_0074869
654 Ga0395899_0085263
655 Ga0395900_0008596
656 Ga0395900_0012337
657 Ga0395900_0068819
658 Ga0395900_0069621
659 Ga0395900_0144012
660 Ga0395898_0002827
661 Ga0395898_0003667
662 Ga0395898_0027202
663 Ga0395898_0140182
664 Ga0395898_0400674
665 Ga0395905_0009412
666 Ga0395905_0043706
667 Ga0395905_0053428
668 Ga0395905_0287422
669 Ga0436364_0095977
670 Ga0436364_1245595
671 Ga0395901_0018621
672 Ga0395901_0026395
673 Ga0395901_0027670
674 Ga0395901_0105380
675 Ga0451837_1125836
676 Ga0466969_0350725
677 Ga0466972_0013410
678 Ga0466965_0219396
679 Ga0466966_0019366
680 Ga0466966_0095742
681 Ga0466966_0159868
682 Ga0466961_0004577
683 Ga0466961_0063475
684 Ga0466961_0129429
685 Ga0466961_0158439
686 Ga0466961_0270398
687 Ga0466963_0044438
688 Ga0466963_0193641
689 Ga0466963_0303342
690 Ga0466971_0008099
691 Ga0466971_0073348
692 Ga0466968_0139231
693 Ga0466968_0349817
694 Ga0466970_0007018
695 Ga0466970_0390640
696 Ga0466957_0186560
697 Ga0466959_0018760
698 Ga0466959_0056595
699 Ga0466958_0013834
700 Ga0466958_0048562
701 Ga0466958_0064597
702 Ga0466958_0292296
703 Ga0466958_0319948
704 Ga0466967_0006470
705 Ga0466967_0034191
706 Ga0466967_0087353
707 Ga0466967_1124831
708 Ga0495627_035308
709 Ga0495592_0110276
710 Ga0495592_0226933
711 Ga0495603_0058289
712 Ga0495629_0000972
713 Ga0495629_0116181
714 Ga0495638_0068745
715 Ga0495651_0036575
716 Ga0495651_0170037
717 Ga0495653_0010111
718 Ga0495653_0084366
719 Ga0495580_0644674
720 Ga0495582_0000274
721 Ga0495664_0134229
722 Ga0495607_0102262
723 Ga0495608_0015948
724 Ga0495618_0031346
725 Ga0495628_0142535
726 Ga0495630_0364898
727 Ga0495632_0067740
728 Ga0495643_0006729
729 Ga0495666_0163193
730 Ga0495652_0182748
731 Ga0495665_0002852
732 Ga0495665_0038699
733 Ga0495640_0046137
734 Ga0495586_0115659
735 Ga0495645_0046545
736 Ga0495622_0052916
737 Ga0495633_0141874
738 Ga0495667_0027332
739 Ga0495667_0161552
740 Ga0495656_0027150
741 Ga0495656_0113195
742 Ga0495634_0036787
743 Ga0495634_0234071
744 Ga0495635_0033999
745 Ga0495588_0310863
746 Ga0495657_0038208
747 Ga0495599_0060104
748 Ga0495623_0056376
749 Ga0495646_0008390
750 Ga0495647_0135618
751 Ga0495658_0012122
752 Ga0495613_0007160
753 Ga0495613_0206472
754 Ga0495624_0168175
755 Ga0495600_0071699
756 Ga0495660_0039137
757 Ga0495581_0000177
758 Ga0495581_0002988
759 Ga0495604_0046101
760 Ga0495674_0232112
761 Ga0495676_0212655
762 Ga0495676_0255804
763 Ga0495680_0343615
764 Ga0495675_0019682
765 Ga0495679_020873
766 Ga0495685_000097
767 Ga0495681_0004590
768 Ga0495684_0017444
769 Ga0495593_0277422
770 Ga0495602_0113965
771 Ga0496105_0190924
772 Ga0496108_0069174
773 Ga0496108_1138866
774 Ga0496109_0044824
775 Ga0496109_0084924
776 Ga0496109_0107827
777 Ga0496109_0180167
778 Ga0496110_0045590
779 Ga0496110_0187523
780 Ga0496111_0039304
781 Ga0496112_0122150
782 Ga0496112_0232279
783 Ga0496113_0514538
784 Ga0496114_0054628
785 Ga0496126_0170641
786 Ga0501031_0015490
787 Ga0501031_0032949
788 Ga0501032_0326812
789 Ga0501032_0650697
790 Ga0501033_0156961
791 Ga0501033_0331415
792 Ga0501033_0337183
793 Ga0501034_0176978
794 Ga0501036_0322968
795 Ga0501037_0019889
796 Ga0501037_0055119
797 Ga0501037_0461421
798 Ga0501038_0000215
799 Ga0501038_0103441
800 Ga0501038_0163744
801 Ga0501039_0055115
802 Ga0501039_0199462
803 Ga0501040_0070838
804 Ga0501040_0105835
805 Ga0501041_0221005
806 Ga0501041_0356589
807 Ga0501042_0038896
808 Ga0501042_0238595
809 Ga0501042_0345938
810 Ga0501042_0636731
811 Ga0501043_0009121
812 Ga0501043_0280778
813 Ga0501043_0395633
814 Ga0501046_0186178
815 Ga0501046_0314596
816 Ga0501047_0003729
817 Ga0501047_0324191
818 Ga0501048_0000571
819 Ga0501048_0050073
820 Ga0501048_0285964
821 Ga0501048_0361781
822 Ga0501068_0019597
823 Ga0501068_0129378
824 Ga0501069_0268852
825 Ga0501070_0119674
826 Ga0501070_0305486
827 Ga0501071_0033170
828 Ga0501071_0052250
829 Ga0501071_0085259
830 Ga0501071_0406580
831 Ga0501072_0080598
832 Ga0501072_0128163
833 Ga0501072_0435667
834 Ga0501072_0569677
835 Ga0501073_0278308
836 Ga0501073_0301098
837 Ga0501074_0036034
838 Ga0501074_0074936
839 Ga0501074_0162770
840 Ga0501074_0433329
841 Ga0501075_0001462
842 Ga0501075_0015472
843 Ga0501075_0342393
844 Ga0501075_0542482
845 Ga0501076_0007775
846 Ga0501076_0020006
847 Ga0501077_0074529
848 Ga0501077_0149026
849 Ga0501077_0337894
850 Ga0501079_0031742
851 Ga0501079_0061665
852 Ga0501079_0276641
853 Ga0501080_0054550
854 Ga0501083_0051532
855 Ga0501035_0049778
856 Ga0501035_0103579
857 Ga0501035_0378410
858 Ga0501044_0025594
859 Ga0501045_0058822
860 Ga0501045_0161179
861 Ga0501045_0770926
862 nmdc:mga03n38_65318_c1
863 nmdc:mga0yw44_44358_c1
864 nmdc:mga05p37_1291160_c1
865 nmdc:mga05p37_219657_c1
866 nmdc:mga09592_156956_c1
867 nmdc:mga09592_83336_c1
868 nmdc:mga06r32_228178_c1
869 nmdc:mga06r32_2846_c3
870 nmdc:mga06r32_580323_c1
871 nmdc:mga0sz30_17883_c2
872 Ga0495601_0094031
873 Ga0495619_0185980
874 Ga0495619_0204202
875 Ga0500578_0037476
876 Ga0500578_0153688
877 Ga0500651_0119835
878 Ga0500566_0140770
879 Ga0500641_0053048
880 Ga0500641_0055812
881 Ga0500650_0265198
882 Ga0500560_009741
883 Ga0500569_056387
884 Ga0500569_083989
885 Ga0500652_002711
886 Ga0500652_003572
887 Ga0500658_0056997
888 Ga0500658_0111502
889 Ga0500559_0011524
890 Ga0500561_0000545
891 Ga0500573_0010952
892 Ga0500579_114272
893 Ga0500579_153556
894 Ga0500600_0015514
895 Ga0500616_0129406
896 Ga0500633_0091351
897 Ga0500633_0130804
898 Ga0500634_0190892
899 Ga0500645_000056
900 Ga0500587_016269
901 Ga0501084_0141945
902 Ga0501082_0046347
903 Ga0530510_0110021
904 Ga0530510_0199551
905 2623588863
906 2738706332
907 2739204115
908 2739328822
909 2868094405
910 2902804112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

9

200

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.5744 1 199
3cxj-assembly1.cif.gz_A crystal structure of an uncharacterized protein from methanothermobacter thermautotrophicus 0.5644 42 199
3mqz-assembly1.cif.gz_A crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba. 0.5602 33 197
1ua7-assembly1.cif.gz_A crystal structure analysis of alpha-amylase from bacillus subtilis complexed with acarbose 0.5505 54 99
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.5462 1 199
ID Description Score Start End Superfamily
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5895 4 199 3.30.930.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5747 1 196 3.30.930.20
af_A0A2R8QR39_23_279_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.5677 123 199 3.30.70.270
3cxjC00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.5665 37 196 3.30.1460.10
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5653 4 199 3.30.930.20
ID Description Score Start End GO Terms
AF-A0A6L9SBB2-F1-model_v4 DUF2461 domain-containing protein 0.995 1 199
AF-A0A3C1DVV9-F1-model_v4 TIGR02453 family protein 0.9922 86 199
AF-A0A285QJB5-F1-model_v4 TIGR02453 family protein 0.9908 1 199
AF-A0A522P447-F1-model_v4 DUF2461 domain-containing protein 0.9817 1 199
AF-A0A522B3W2-F1-model_v4 DUF2461 family protein 0.9809 2 78

Map