F447463

General Info

Members Datasets Scaffolds Average Seq Length
454 261 908 321

Family's Representative Sequence

Representative Sequence 3300049587|Ga0501071_0197026|Ga0501071_0197026_43_1134
Length 358
Sequence VPRRYAAPRVSISSLLCRSERRRYITDRQGPEALARKTREDCMQSIFRALAAVAVLALAGTASAQQYPSKPVRIVVPFPPGGVTDTATRMIAQRLSERLGQQFYIENISGAGGNIGMGNAAKSPGDGYTILVASSSIVVNPNLYSKVPYDLDKDFIPVTKAGGTPNSWVVNPEFPAKTMQELIDLIKKNPGKYSVGSPGTGTTPSLSIEMLKLALELNFVTVPFKGGGPMTQSLLGGHTPIVNYVNLIKAGKLRALAVTAKKRSVALPEVPTLDEIGIKGQEAETMTGVFVPAGTPKAVVDLLQKEISAAVNSPDIKEKLLAAGIEASGNSQAEFAAYVKEEVAKWKKVIEDAKISKI

Samples

Sample ID Description Type Environment
1 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
159 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
160 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
161 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
162 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
231 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
232 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
233 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
239 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
240 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
246 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
247 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
248 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
249 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
250 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
251 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
252 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2643221658 Variovorax sp. Root411 Isolate Unclassified
260 2858950400 Achromobacter sp. K91 Isolate Unclassified
261 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0
Rhizoplane 6.83
Rhizosphere 87
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501071_0197026 3300049587 Bacteria 1512
2 Ga0065715_10021860 3300005293 Bacteria 2132
3 Ga0070658_10006510 3300005327 Bacteria 9471
4 Ga0070658_10016553 3300005327 Bacteria 5900
5 Ga0070690_100002189 3300005330 Bacteria 10448
6 Ga0070690_100160418 3300005330 Bacteria 1541
7 Ga0070670_100019957 3300005331 Bacteria 5754
8 Ga0070670_100039825 3300005331 Bacteria 4041
9 Ga0070670_100047285 3300005331 Bacteria 3702
10 Ga0070670_100321151 3300005331 Bacteria 1357
11 Ga0070677_10030552 3300005333 Bacteria 2052
12 Ga0068869_100001488 3300005334 Bacteria 13873
13 Ga0068869_100006797 3300005334 Bacteria 7272
14 Ga0070666_10058423 3300005335 Bacteria 2608
15 Ga0070680_100001207 3300005336 Bacteria 18617
16 Ga0068868_100007380 3300005338 Bacteria 7831
17 Ga0068868_100071843 3300005338 Bacteria 2760
18 Ga0068868_100493071 3300005338 Bacteria 1072
19 Ga0070660_100009029 3300005339 Bacteria 6995
20 Ga0070689_100000710 3300005340 Bacteria 20266
21 Ga0070689_100001348 3300005340 Bacteria 15595
22 Ga0070689_100116859 3300005340 Bacteria 2127
23 Ga0070691_10003922 3300005341 Bacteria 6732
24 Ga0070687_100000139 3300005343 Bacteria 25149
25 Ga0070661_100089582 3300005344 Bacteria 2278
26 Ga0070692_10000784 3300005345 Bacteria 10494
27 Ga0070668_100031200 3300005347 Bacteria 4054
28 Ga0070668_100063191 3300005347 Bacteria 2869
29 Ga0070668_100153395 3300005347 Bacteria 1865
30 Ga0070669_100016982 3300005353 Bacteria 5197
31 Ga0070669_100060950 3300005353 Bacteria 2772
32 Ga0070669_100125876 3300005353 Bacteria 1961
33 Ga0070669_100205294 3300005353 Bacteria 1552
34 Ga0070675_100018165 3300005354 Bacteria 5597
35 Ga0070675_100044541 3300005354 Bacteria 3628
36 Ga0070674_100023886 3300005356 Bacteria 3963
37 Ga0070673_100077277 3300005364 Bacteria 2690
38 Ga0070673_100219188 3300005364 Bacteria 1646
39 Ga0070673_100299778 3300005364 Bacteria 1415
40 Ga0070659_100091597 3300005366 Bacteria 2437
41 Ga0070667_100020434 3300005367 Bacteria 5497
42 Ga0070713_100000065 3300005436 Bacteria 66969
43 Ga0070701_10003112 3300005438 Bacteria 6506
44 Ga0070705_100002167 3300005440 Bacteria 9973
45 Ga0070700_100000374 3300005441 Bacteria 22955
46 Ga0070700_100023705 3300005441 Bacteria 3593
47 Ga0070694_100002696 3300005444 Bacteria 10528
48 Ga0070663_100152543 3300005455 Bacteria 1773
49 Ga0070678_100060783 3300005456 Bacteria 2783
50 Ga0070678_100309069 3300005456 Bacteria 1346
51 Ga0070662_100291177 3300005457 Bacteria 1324
52 Ga0070681_10027631 3300005458 Bacteria 5704
53 Ga0070681_10253290 3300005458 Bacteria 1673
54 Ga0068867_100001934 3300005459 Bacteria 14435
55 Ga0068867_100003946 3300005459 Bacteria 10437
56 Ga0068867_100031998 3300005459 Bacteria 3801
57 Ga0070679_100006070 3300005530 Bacteria 11241
58 Ga0070679_100424947 3300005530 Bacteria 1274
59 Ga0070697_100104381 3300005536 Bacteria 2356
60 Ga0068853_100045933 3300005539 Bacteria 3743
61 Ga0068853_100100334 3300005539 Bacteria 2559
62 Ga0070672_100082379 3300005543 Bacteria 2581
63 Ga0070672_100244578 3300005543 Bacteria 1510
64 Ga0070686_100000949 3300005544 Bacteria 16715
65 Ga0070686_100100579 3300005544 Bacteria 1952
66 Ga0070695_100002635 3300005545 Bacteria 10370
67 Ga0070696_100001256 3300005546 Bacteria 16481
68 Ga0070696_100239265 3300005546 Bacteria 1368
69 Ga0070693_100000301 3300005547 Bacteria 22835
70 Ga0070704_100000823 3300005549 Bacteria 15400
71 Ga0070704_100098366 3300005549 Bacteria 2198
72 Ga0068855_100007129 3300005563 Bacteria 13561
73 Ga0068855_100122460 3300005563 Bacteria 2976
74 Ga0068857_100016954 3300005577 Bacteria 6383
75 Ga0068857_100549324 3300005577 Bacteria 1088
76 Ga0068854_100001145 3300005578 Bacteria 15933
77 Ga0068856_100094724 3300005614 Bacteria 2973
78 Ga0070702_100001218 3300005615 Bacteria 10409
79 Ga0070702_100295207 3300005615 Bacteria 1119
80 Ga0068852_100071537 3300005616 Bacteria 3046
81 Ga0068859_100001966 3300005617 Bacteria 20979
82 Ga0068859_100085563 3300005617 Bacteria 3198
83 Ga0068859_100224869 3300005617 Bacteria 1965
84 Ga0068859_100236401 3300005617 Bacteria 1916
85 Ga0068859_100264106 3300005617 Bacteria 1813
86 Ga0068864_100025624 3300005618 Bacteria 4969
87 Ga0068864_100063943 3300005618 Bacteria 3190
88 Ga0068866_10000686 3300005718 Bacteria 15410
89 Ga0068866_10074226 3300005718 Bacteria 1808
90 Ga0068866_10153694 3300005718 Bacteria 1335
91 Ga0068861_100002765 3300005719 Bacteria 11507
92 Ga0068861_100005626 3300005719 Bacteria 8501
93 Ga0068861_100168604 3300005719 Bacteria 1813
94 Ga0068861_100284335 3300005719 Bacteria 1426
95 Ga0068863_100185953 3300005841 Bacteria 1995
96 Ga0068863_100250985 3300005841 Bacteria 1709
97 Ga0068858_100011596 3300005842 Bacteria 8312
98 Ga0068858_100143353 3300005842 Bacteria 2243
99 Ga0068860_100001553 3300005843 Bacteria 24740
100 Ga0068860_100019154 3300005843 Bacteria 6646
101 Ga0068860_100029754 3300005843 Bacteria 5254
102 Ga0068860_100036796 3300005843 Bacteria 4688
103 Ga0068860_100056827 3300005843 Bacteria 3719
104 Ga0068860_100140908 3300005843 Bacteria 2317
105 Ga0068860_100219551 3300005843 Bacteria 1846
106 Ga0068862_100002945 3300005844 Bacteria 14879
107 Ga0068862_100087130 3300005844 Bacteria 2716
108 Ga0068862_100181225 3300005844 Bacteria 1891
109 Ga0068862_100520495 3300005844 Bacteria 1132
110 Ga0081538_10008218 3300005981 Bacteria 8900
111 Ga0075368_10015317 3300006042 Bacteria 2843
112 Ga0075366_10013282 3300006195 Bacteria 4684
113 Ga0075366_10056593 3300006195 Bacteria 2329
114 Ga0075366_10100159 3300006195 Bacteria 1739
115 Ga0075366_10175915 3300006195 Bacteria 1299
116 Ga0097621_100001734 3300006237 Bacteria 14923
117 Ga0068871_100002999 3300006358 Bacteria 11581
118 Ga0075428_100022455 3300006844 Bacteria 6987
119 Ga0075428_100359244 3300006844 Bacteria 1563
120 Ga0075428_100706413 3300006844 Bacteria 1074
121 Ga0075430_100044069 3300006846 Bacteria 3773
122 Ga0075430_100062849 3300006846 Bacteria 3118
123 Ga0075433_10015857 3300006852 Bacteria 6194
124 Ga0075434_100005211 3300006871 Bacteria 11807
125 Ga0075429_100033263 3300006880 Bacteria 4480
126 Ga0075429_100044344 3300006880 Bacteria 3869
127 Ga0075429_100338953 3300006880 Bacteria 1316
128 Ga0068865_100007250 3300006881 Bacteria 6813
129 Ga0068865_100011526 3300006881 Bacteria 5539
130 Ga0075436_100002719 3300006914 Bacteria 12163
131 Ga0097620_100001966 3300006931 Bacteria 20979
132 Ga0097620_100224902 3300006931 Bacteria 1965
133 Ga0097620_100236386 3300006931 Bacteria 1916
134 Ga0097620_100264108 3300006931 Bacteria 1813
135 Ga0075435_100002719 3300007076 Bacteria 11807
136 Ga0075435_100052714 3300007076 Bacteria 3278
137 Ga0105240_10089547 3300009093 Bacteria 3764
138 Ga0111539_10007216 3300009094 Bacteria 14244
139 Ga0111539_10017228 3300009094 Bacteria 8942
140 Ga0111539_10141534 3300009094 Bacteria 2816
141 Ga0111539_10157710 3300009094 Bacteria 2655
142 Ga0111539_10175860 3300009094 Bacteria 2501
143 Ga0111539_10631148 3300009094 Bacteria 1248
144 Ga0105245_10005544 3300009098 Bacteria 11088
145 Ga0105247_10015912 3300009101 Bacteria 4504
146 Ga0114129_10033036 3300009147 Bacteria 7312
147 Ga0114129_10101428 3300009147 Bacteria 3982
148 Ga0114129_10154282 3300009147 Bacteria 3142
149 Ga0114129_10216784 3300009147 Bacteria 2584
150 Ga0105243_10005297 3300009148 Bacteria 10082
151 Ga0105243_10029777 3300009148 Bacteria 4201
152 Ga0105242_10003162 3300009176 Bacteria 12860
153 Ga0105242_10071914 3300009176 Bacteria 2871
154 Ga0105242_10428024 3300009176 Bacteria 1242
155 Ga0105248_10013855 3300009177 Bacteria 8870
156 Ga0105248_10149596 3300009177 Bacteria 2634
157 Ga0105238_10002698 3300009551 Bacteria 17659
158 Ga0105249_10006042 3300009553 Bacteria 10491
159 Ga0105249_10044544 3300009553 Bacteria 4035
160 Ga0105239_10092684 3300010375 Bacteria 3335
161 Ga0105239_10513262 3300010375 Bacteria 1363
162 Ga0105246_10080084 3300011119 Bacteria 2324
163 Ga0157369_10000338 3300013105 Bacteria 62072
164 Ga0157378_10001982 3300013297 Bacteria 18324
165 Ga0157378_10004157 3300013297 Bacteria 12783
166 Ga0163162_10019644 3300013306 Bacteria 6633
167 Ga0163162_10038121 3300013306 Bacteria 4797
168 Ga0163162_10065664 3300013306 Bacteria 3676
169 Ga0163162_10155571 3300013306 Bacteria 2406
170 Ga0157372_10026425 3300013307 Bacteria 6317
171 Ga0157375_10013514 3300013308 Bacteria 7269
172 Ga0157375_10149912 3300013308 Bacteria 2467
173 Ga0163163_10029275 3300014325 Bacteria 5298
174 Ga0163163_10149711 3300014325 Bacteria 2378
175 Ga0157380_10001825 3300014326 Bacteria 14066
176 Ga0157380_10020083 3300014326 Bacteria 4989
177 Ga0157380_10278598 3300014326 Bacteria 1529
178 Ga0157380_10296857 3300014326 Bacteria 1486
179 Ga0157379_10002838 3300014968 Bacteria 14609
180 Ga0157379_10100768 3300014968 Bacteria 2592
181 Ga0157379_10109276 3300014968 Bacteria 2483
182 Ga0157376_10005917 3300014969 Bacteria 8586
183 Ga0209758_1000435 3300025297 Bacteria 70539
184 Ga0207653_10020748 3300025885 Bacteria 2082
185 Ga0207682_10044536 3300025893 Bacteria 1819
186 Ga0207682_10061804 3300025893 Bacteria 1569
187 Ga0207642_10000676 3300025899 Bacteria 10513
188 Ga0207688_10062316 3300025901 Bacteria 2102
189 Ga0207688_10163501 3300025901 Bacteria 1321
190 Ga0207645_10150920 3300025907 Bacteria 1517
191 Ga0207705_10030958 3300025909 Bacteria 3818
192 Ga0207705_10323918 3300025909 Unclassified 1184
193 Ga0207684_10376175 3300025910 Bacteria 1222
194 Ga0207707_10116023 3300025912 Bacteria 2340
195 Ga0207707_10327134 3300025912 Bacteria 1323
196 Ga0207660_10008693 3300025917 Bacteria 6567
197 Ga0207660_10027142 3300025917 Bacteria 3904
198 Ga0207662_10000214 3300025918 Bacteria 26908
199 Ga0207662_10093342 3300025918 Bacteria 1854
200 Ga0207657_10025903 3300025919 Bacteria 5400
201 Ga0207652_10025923 3300025921 Bacteria 4878
202 Ga0207652_10430176 3300025921 Bacteria 1190
203 Ga0207681_10038961 3300025923 Bacteria 3152
204 Ga0207681_10069923 3300025923 Bacteria 2443
205 Ga0207681_10201872 3300025923 Bacteria 1527
206 Ga0207694_10040535 3300025924 Bacteria 3585
207 Ga0207650_10023635 3300025925 Bacteria 4362
208 Ga0207650_10056308 3300025925 Bacteria 2921
209 Ga0207650_10187222 3300025925 Bacteria 1652
210 Ga0207650_10287112 3300025925 Bacteria 1341
211 Ga0207659_10183149 3300025926 Bacteria 1661
212 Ga0207687_10008429 3300025927 Bacteria 6741
213 Ga0207700_10000046 3300025928 Bacteria 87971
214 Ga0207686_10003090 3300025934 Bacteria 8966
215 Ga0207686_10015836 3300025934 Bacteria 4225
216 Ga0207709_10001040 3300025935 Bacteria 20505
217 Ga0207670_10003264 3300025936 Bacteria 8597
218 Ga0207670_10005799 3300025936 Bacteria 6816
219 Ga0207669_10004135 3300025937 Bacteria 6361
220 Ga0207704_10002773 3300025938 Bacteria 7910
221 Ga0207704_10085583 3300025938 Bacteria 2053
222 Ga0207691_10095943 3300025940 Bacteria 2652
223 Ga0207691_10099185 3300025940 Bacteria 2601
224 Ga0207691_10105907 3300025940 Bacteria 2505
225 Ga0207711_10020792 3300025941 Bacteria 5477
226 Ga0207689_10001553 3300025942 Bacteria 21776
227 Ga0207689_10006200 3300025942 Bacteria 10593
228 Ga0207689_10031885 3300025942 Bacteria 4383
229 Ga0207667_10057474 3300025949 Bacteria 4083
230 Ga0207651_10091915 3300025960 Bacteria 2224
231 Ga0207712_10102495 3300025961 Bacteria 2131
232 Ga0207668_10216561 3300025972 Bacteria 1535
233 Ga0207668_10234509 3300025972 Bacteria 1481
234 Ga0207640_10001880 3300025981 Bacteria 11254
235 Ga0207640_10251770 3300025981 Bacteria 1371
236 Ga0207677_10001427 3300026023 Bacteria 12708
237 Ga0207677_10060823 3300026023 Bacteria 2613
238 Ga0207703_10023505 3300026035 Bacteria 4842
239 Ga0207703_10032174 3300026035 Bacteria 4151
240 Ga0207703_10323082 3300026035 Bacteria 1414
241 Ga0207639_10027403 3300026041 Bacteria 4152
242 Ga0207708_10000743 3300026075 Bacteria 24451
243 Ga0207708_10039719 3300026075 Bacteria 3586
244 Ga0207702_10022433 3300026078 Bacteria 5233
245 Ga0207702_10096953 3300026078 Bacteria 2594
246 Ga0207641_10049425 3300026088 Bacteria 3554
247 Ga0207641_10185592 3300026088 Bacteria 1908
248 Ga0207648_10002022 3300026089 Bacteria 22142
249 Ga0207648_10004018 3300026089 Bacteria 15269
250 Ga0207648_10004216 3300026089 Bacteria 14857
251 Ga0207676_10009835 3300026095 Bacteria 6802
252 Ga0207676_10015670 3300026095 Bacteria 5476
253 Ga0207676_10024604 3300026095 Bacteria 4458
254 Ga0207676_10055382 3300026095 Bacteria 3113
255 Ga0207675_100001028 3300026118 Bacteria 27641
256 Ga0207675_100001190 3300026118 Bacteria 25909
257 Ga0207675_100022446 3300026118 Bacteria 5878
258 Ga0207675_100204452 3300026118 Bacteria 1897
259 Ga0207675_100308698 3300026118 Bacteria 1542
260 Ga0207683_10038097 3300026121 Bacteria 4188
261 Ga0207683_10044872 3300026121 Bacteria 3865
262 Ga0207683_10166124 3300026121 Bacteria 1997
263 Ga0207683_10203354 3300026121 Bacteria 1801
264 Ga0207698_10096351 3300026142 Bacteria 2438
265 Ga0207428_10008109 3300027907 Bacteria 9521
266 Ga0207428_10047906 3300027907 Bacteria 3431
267 Ga0207428_10077488 3300027907 Bacteria 2602
268 Ga0207428_10150409 3300027907 Bacteria 1772
269 Ga0268265_10033819 3300028380 Bacteria 3720
270 Ga0268265_10070914 3300028380 Bacteria 2711
271 Ga0268265_10146253 3300028380 Bacteria 1986
272 Ga0268264_10001435 3300028381 Bacteria 22296
273 Ga0268264_10002576 3300028381 Bacteria 15873
274 Ga0268264_10013469 3300028381 Bacteria 6734
275 Ga0268264_10025838 3300028381 Bacteria 4795
276 Ga0265338_10006542 3300028800 Bacteria 14807
277 Ga0307511_10000350 3300030521 Bacteria 48849
278 Ga0265325_10000337 3300031241 Bacteria 33222
279 Ga0265339_10000133 3300031249 Bacteria 60726
280 Ga0265313_10000491 3300031595 Bacteria 41687
281 Ga0307413_10114168 3300031824 Bacteria 1815
282 Ga0307413_10324351 3300031824 Bacteria 1178
283 Ga0307412_10214577 3300031911 Bacteria 1471
284 Ga0307416_100129743 3300032002 Bacteria 2267
285 Ga0307414_10102189 3300032004 Bacteria 2160
286 Ga0307411_10049153 3300032005 Bacteria 2739
287 Ga0373952_0018355 3300035092 Bacteria 1447
288 Ga0373932_0013092 3300035112 Bacteria 2056
289 Ga0373932_0051233 3300035112 Bacteria 1226
290 Ga0373939_0004274 3300035114 Bacteria 3373
291 Ga0373941_0100709 3300035115 Bacteria 1005
292 Ga0373960_0009946 3300035121 Bacteria 2314
293 Ga0373960_0018191 3300035121 Bacteria 1829
294 Ga0373962_0033465 3300035242 Bacteria 1419
295 Ga0373931_0023605 3300035691 Bacteria 3107
296 Ga0373937_0021212 3300036401 Bacteria 5830
297 Ga0436365_0276109 3300039437 Bacteria 10349
298 Ga0439453_0004839 3300041408 Bacteria 2023
299 Ga0439443_003198 3300042003 Bacteria 2041
300 Ga0450898_033881 3300042134 Bacteria 947
301 Ga0450904_003898 3300042139 Bacteria 1578
302 Ga0439435_0001732 3300042436 Bacteria 4136
303 Ga0439444_0008573 3300042437 Bacteria 1595
304 Ga0439464_0006978 3300042439 Bacteria 2948
305 Ga0451577_0068282 3300042876 Bacteria 3170
306 Ga0451577_0095639 3300042876 Bacteria 2652
307 Ga0451576_0007459 3300045051 Bacteria 13056
308 Ga0451576_0039411 3300045051 Bacteria 5000
309 Ga0451576_0360134 3300045051 Bacteria 1523
310 Ga0495592_0001018 3300046454 Bacteria 19443
311 Ga0495653_0099981 3300046463 Bacteria 2103
312 Ga0495580_0188387 3300046472 Bacteria 1424
313 Ga0495662_0015218 3300046476 Bacteria 3737
314 Ga0495608_0001394 3300046511 Bacteria 17183
315 Ga0495628_0119689 3300046516 Bacteria 2021
316 Ga0495628_0127059 3300046516 Bacteria 1952
317 Ga0495630_0006178 3300046517 Bacteria 8495
318 Ga0495666_0018847 3300046526 Bacteria 3428
319 Ga0495642_0013314 3300046528 Bacteria 3180
320 Ga0495640_0005697 3300046533 Bacteria 9902
321 Ga0495587_0046908 3300046536 Bacteria 2563
322 Ga0495598_0012623 3300046537 Bacteria 2078
323 Ga0495598_0052454 3300046537 Bacteria 1232
324 Ga0495645_0109238 3300046543 Bacteria 1958
325 Ga0495667_0103695 3300046559 Bacteria 1839
326 Ga0495634_0003881 3300046642 Bacteria 11876
327 Ga0495659_0029045 3300046664 Bacteria 1918
328 Ga0495599_0030391 3300046678 Bacteria 3389
329 Ga0495647_0044509 3300046681 Bacteria 1703
330 Ga0495658_0025277 3300046683 Bacteria 3172
331 Ga0495613_0004658 3300046689 Bacteria 10286
332 Ga0495670_0033380 3300046691 Bacteria 2561
333 Ga0495600_0006210 3300046809 Bacteria 7247
334 Ga0495604_0041928 3300047317 Bacteria 3588
335 Ga0495680_0003602 3300047322 Bacteria 15163
336 Ga0495684_0107986 3300047471 Bacteria 2102
337 Ga0496100_0015330 3300048903 Bacteria 4475
338 Ga0496101_0003653 3300048904 Bacteria 9601
339 Ga0496101_0140471 3300048904 Bacteria 1840
340 Ga0496102_0028992 3300048905 Bacteria 4948
341 Ga0496103_0139188 3300048906 Bacteria 1552
342 Ga0496104_0007508 3300048907 Bacteria 9639
343 Ga0496104_0102989 3300048907 Bacteria 2734
344 Ga0496104_0219357 3300048907 Unclassified 1814
345 Ga0496106_0004583 3300048909 Bacteria 10253
346 Ga0496107_0009729 3300048910 Bacteria 6667
347 Ga0496107_0235196 3300048910 Bacteria 1363
348 Ga0496108_0002505 3300048911 Bacteria 14700
349 Ga0496108_0068314 3300048911 Bacteria 2998
350 Ga0496108_0478614 3300048911 Bacteria 1088
351 Ga0496109_0007132 3300048912 Bacteria 9441
352 Ga0496109_0021405 3300048912 Bacteria 5716
353 Ga0496109_0081164 3300048912 Bacteria 2988
354 Ga0496109_0259660 3300048912 Bacteria 1636
355 Ga0496110_0002847 3300048913 Bacteria 13056
356 Ga0496110_0003290 3300048913 Bacteria 12332
357 Ga0496111_0006684 3300048914 Bacteria 7504
358 Ga0496111_0007361 3300048914 Bacteria 7207
359 Ga0496112_0001484 3300048915 Bacteria 18045
360 Ga0496112_0011900 3300048915 Bacteria 7970
361 Ga0496112_0097564 3300048915 Bacteria 2909
362 Ga0496113_0014796 3300048916 Bacteria 5336
363 Ga0496113_0029768 3300048916 Bacteria 3946
364 Ga0496114_0029347 3300048917 Bacteria 4520
365 Ga0496114_0183035 3300048917 Bacteria 1830
366 Ga0496115_0062358 3300048918 Bacteria 3007
367 Ga0496115_0230688 3300048918 Bacteria 1526
368 Ga0501032_0237101 3300049569 Bacteria 1185
369 Ga0501033_0030715 3300049570 Bacteria 4036
370 Ga0501033_0067348 3300049570 Bacteria 2633
371 Ga0501034_0058198 3300049571 Bacteria 3884
372 Ga0501034_0214187 3300049571 Bacteria 1881
373 Ga0501036_0012150 3300049572 Bacteria 7134
374 Ga0501036_0088004 3300049572 Bacteria 2625
375 Ga0501036_0328577 3300049572 Bacteria 1278
376 Ga0501038_0007196 3300049574 Bacteria 10286
377 Ga0501038_0060548 3300049574 Bacteria 3240
378 Ga0501039_0012183 3300049575 Bacteria 6555
379 Ga0501039_0015482 3300049575 Bacteria 5839
380 Ga0501040_0073737 3300049576 Bacteria 2359
381 Ga0501040_0197608 3300049576 Bacteria 1428
382 Ga0501042_0067114 3300049578 Bacteria 2564
383 Ga0501046_0021692 3300049580 Bacteria 5297
384 Ga0501047_0042254 3300049581 Bacteria 4405
385 Ga0501048_0013808 3300049582 Bacteria 5990
386 Ga0501048_0026936 3300049582 Bacteria 4183
387 Ga0501068_0047483 3300049584 Bacteria 2590
388 Ga0501068_0148029 3300049584 Bacteria 1474
389 Ga0501069_0008460 3300049585 Bacteria 5410
390 Ga0501072_0005974 3300049588 Bacteria 9283
391 Ga0501072_0006098 3300049588 Bacteria 9197
392 Ga0501073_0014721 3300049589 Bacteria 5682
393 Ga0501074_0006680 3300049590 Bacteria 8327
394 Ga0501074_0317587 3300049590 Bacteria 1106
395 Ga0501075_0002840 3300049591 Bacteria 11617
396 Ga0501075_0244370 3300049591 Bacteria 1368
397 Ga0501076_0000088 3300049592 Bacteria 48517
398 Ga0501077_0056937 3300049593 Bacteria 2482
399 Ga0501080_0023330 3300049742 Bacteria 5737
400 Ga0501080_0082092 3300049742 Bacteria 2994
401 Ga0501081_0014987 3300049743 Bacteria 5116
402 Ga0501083_0167678 3300049744 Bacteria 1435
403 Ga0501035_0485365 3300049822 Bacteria 1019
404 Ga0501044_0000193 3300049823 Bacteria 76794
405 nmdc:mga03683_94315_c1 3300050489 Bacteria 1308
406 nmdc:mga0yw44_42769_c1 3300050492 Bacteria 2702
407 nmdc:mga0k408_74326_c1 3300050493 Bacteria 1986
408 nmdc:mga07m45_12165_c1 3300050496 Bacteria 4541
409 nmdc:mga07m45_65927_c1 3300050496 Bacteria 2057
410 nmdc:mga05p37_134721_c1 3300050507 Bacteria 3030
411 nmdc:mga05p37_25007_c1 3300050507 Bacteria 7259
412 nmdc:mga09592_161112_c1 3300050508 Bacteria 1938
413 nmdc:mga09592_77392_c1 3300050508 Bacteria 2830
414 nmdc:mga0qj67_225877_c1 3300050509 Bacteria 1519
415 nmdc:mga0qj67_461540_c1 3300050509 Bacteria 1022
416 nmdc:mga0qj67_49519_c1 3300050509 Bacteria 3321
417 nmdc:mga0qj67_87584_c1 3300050509 Bacteria 2499
418 nmdc:mga06r32_25300_c1 3300050510 Bacteria 5522
419 nmdc:mga06r32_53534_c1 3300050510 Bacteria 2782
420 nmdc:mga08y16_113038_c1 3300050511 Bacteria 2827
421 nmdc:mga08y16_235174_c1 3300050511 Bacteria 1895
422 nmdc:mga08y16_27754_c1 3300050511 Bacteria 5966
423 nmdc:mga08y16_568867_c1 3300050511 Bacteria 1145
424 nmdc:mga08y16_80447_c1 3300050511 Bacteria 3397
425 nmdc:mga08y16_84816_c1 3300050511 Bacteria 3302
426 nmdc:mga0n895_15661_c1 3300050512 Bacteria 6925
427 nmdc:mga0n895_352468_c1 3300050512 Bacteria 1490
428 nmdc:mga0rr50_26377_c1 3300050513 Bacteria 4053
429 nmdc:mga0rr50_51347_c1 3300050513 Bacteria 3059
430 nmdc:mga08x19_754_c1 3300050514 Bacteria 20709
431 nmdc:mga0a205_853_c1 3300050515 Bacteria 24942
432 nmdc:mga0sz30_13819_c1 3300050516 Bacteria 3168
433 Ga0495601_0007555 3300053077 Bacteria 6380
434 Ga0495619_0188638 3300053085 Bacteria 1427
435 Ga0500646_0001795 3300053090 Bacteria 5653
436 Ga0500641_0084703 3300053096 Bacteria 1349
437 Ga0500555_003944 3300053103 Bacteria 4221
438 Ga0500594_0002616 3300053118 Bacteria 3910
439 Ga0500595_016245 3300053119 Bacteria 2777
440 Ga0500655_001910 3300053133 Bacteria 3874
441 Ga0500658_0114046 3300053134 Bacteria 1192
442 Ga0500568_0005515 3300053139 Bacteria 6518
443 Ga0500568_0035250 3300053139 Bacteria 2043
444 Ga0500604_0000535 3300053151 Bacteria 10450
445 Ga0500645_014187 3300053730 Bacteria 2542
446 Ga0501084_0005003 3300054114 Bacteria 10839
447 Ga0501084_0030467 3300054114 Bacteria 4512
448 Ga0501082_0015512 3300060353 Bacteria 6559
449 Ga0501082_0021884 3300060353 Bacteria 5511
450 Ga0501082_0100405 3300060353 Bacteria 2503
451 Ga0530510_0000514 3300061734 Bacteria 24670
452 2644328260 2643221658 Bacteria 6064537
453 2858951505 2858950400 Bacteria 6783797
454 2902407448 2902405164 Bacteria 6784948
455 Ga0501071_0197026
456 Ga0065715_10021860
457 Ga0070658_10006510
458 Ga0070658_10016553
459 Ga0070690_100002189
460 Ga0070690_100160418
461 Ga0070670_100019957
462 Ga0070670_100039825
463 Ga0070670_100047285
464 Ga0070670_100321151
465 Ga0070677_10030552
466 Ga0068869_100001488
467 Ga0068869_100006797
468 Ga0070666_10058423
469 Ga0070680_100001207
470 Ga0068868_100007380
471 Ga0068868_100071843
472 Ga0068868_100493071
473 Ga0070660_100009029
474 Ga0070689_100000710
475 Ga0070689_100001348
476 Ga0070689_100116859
477 Ga0070691_10003922
478 Ga0070687_100000139
479 Ga0070661_100089582
480 Ga0070692_10000784
481 Ga0070668_100031200
482 Ga0070668_100063191
483 Ga0070668_100153395
484 Ga0070669_100016982
485 Ga0070669_100060950
486 Ga0070669_100125876
487 Ga0070669_100205294
488 Ga0070675_100018165
489 Ga0070675_100044541
490 Ga0070674_100023886
491 Ga0070673_100077277
492 Ga0070673_100219188
493 Ga0070673_100299778
494 Ga0070659_100091597
495 Ga0070667_100020434
496 Ga0070713_100000065
497 Ga0070701_10003112
498 Ga0070705_100002167
499 Ga0070700_100000374
500 Ga0070700_100023705
501 Ga0070694_100002696
502 Ga0070663_100152543
503 Ga0070678_100060783
504 Ga0070678_100309069
505 Ga0070662_100291177
506 Ga0070681_10027631
507 Ga0070681_10253290
508 Ga0068867_100001934
509 Ga0068867_100003946
510 Ga0068867_100031998
511 Ga0070679_100006070
512 Ga0070679_100424947
513 Ga0070697_100104381
514 Ga0068853_100045933
515 Ga0068853_100100334
516 Ga0070672_100082379
517 Ga0070672_100244578
518 Ga0070686_100000949
519 Ga0070686_100100579
520 Ga0070695_100002635
521 Ga0070696_100001256
522 Ga0070696_100239265
523 Ga0070693_100000301
524 Ga0070704_100000823
525 Ga0070704_100098366
526 Ga0068855_100007129
527 Ga0068855_100122460
528 Ga0068857_100016954
529 Ga0068857_100549324
530 Ga0068854_100001145
531 Ga0068856_100094724
532 Ga0070702_100001218
533 Ga0070702_100295207
534 Ga0068852_100071537
535 Ga0068859_100001966
536 Ga0068859_100085563
537 Ga0068859_100224869
538 Ga0068859_100236401
539 Ga0068859_100264106
540 Ga0068864_100025624
541 Ga0068864_100063943
542 Ga0068866_10000686
543 Ga0068866_10074226
544 Ga0068866_10153694
545 Ga0068861_100002765
546 Ga0068861_100005626
547 Ga0068861_100168604
548 Ga0068861_100284335
549 Ga0068863_100185953
550 Ga0068863_100250985
551 Ga0068858_100011596
552 Ga0068858_100143353
553 Ga0068860_100001553
554 Ga0068860_100019154
555 Ga0068860_100029754
556 Ga0068860_100036796
557 Ga0068860_100056827
558 Ga0068860_100140908
559 Ga0068860_100219551
560 Ga0068862_100002945
561 Ga0068862_100087130
562 Ga0068862_100181225
563 Ga0068862_100520495
564 Ga0081538_10008218
565 Ga0075368_10015317
566 Ga0075366_10013282
567 Ga0075366_10056593
568 Ga0075366_10100159
569 Ga0075366_10175915
570 Ga0097621_100001734
571 Ga0068871_100002999
572 Ga0075428_100022455
573 Ga0075428_100359244
574 Ga0075428_100706413
575 Ga0075430_100044069
576 Ga0075430_100062849
577 Ga0075433_10015857
578 Ga0075434_100005211
579 Ga0075429_100033263
580 Ga0075429_100044344
581 Ga0075429_100338953
582 Ga0068865_100007250
583 Ga0068865_100011526
584 Ga0075436_100002719
585 Ga0097620_100001966
586 Ga0097620_100224902
587 Ga0097620_100236386
588 Ga0097620_100264108
589 Ga0075435_100002719
590 Ga0075435_100052714
591 Ga0105240_10089547
592 Ga0111539_10007216
593 Ga0111539_10017228
594 Ga0111539_10141534
595 Ga0111539_10157710
596 Ga0111539_10175860
597 Ga0111539_10631148
598 Ga0105245_10005544
599 Ga0105247_10015912
600 Ga0114129_10033036
601 Ga0114129_10101428
602 Ga0114129_10154282
603 Ga0114129_10216784
604 Ga0105243_10005297
605 Ga0105243_10029777
606 Ga0105242_10003162
607 Ga0105242_10071914
608 Ga0105242_10428024
609 Ga0105248_10013855
610 Ga0105248_10149596
611 Ga0105238_10002698
612 Ga0105249_10006042
613 Ga0105249_10044544
614 Ga0105239_10092684
615 Ga0105239_10513262
616 Ga0105246_10080084
617 Ga0157369_10000338
618 Ga0157378_10001982
619 Ga0157378_10004157
620 Ga0163162_10019644
621 Ga0163162_10038121
622 Ga0163162_10065664
623 Ga0163162_10155571
624 Ga0157372_10026425
625 Ga0157375_10013514
626 Ga0157375_10149912
627 Ga0163163_10029275
628 Ga0163163_10149711
629 Ga0157380_10001825
630 Ga0157380_10020083
631 Ga0157380_10278598
632 Ga0157380_10296857
633 Ga0157379_10002838
634 Ga0157379_10100768
635 Ga0157379_10109276
636 Ga0157376_10005917
637 Ga0209758_1000435
638 Ga0207653_10020748
639 Ga0207682_10044536
640 Ga0207682_10061804
641 Ga0207642_10000676
642 Ga0207688_10062316
643 Ga0207688_10163501
644 Ga0207645_10150920
645 Ga0207705_10030958
646 Ga0207705_10323918
647 Ga0207684_10376175
648 Ga0207707_10116023
649 Ga0207707_10327134
650 Ga0207660_10008693
651 Ga0207660_10027142
652 Ga0207662_10000214
653 Ga0207662_10093342
654 Ga0207657_10025903
655 Ga0207652_10025923
656 Ga0207652_10430176
657 Ga0207681_10038961
658 Ga0207681_10069923
659 Ga0207681_10201872
660 Ga0207694_10040535
661 Ga0207650_10023635
662 Ga0207650_10056308
663 Ga0207650_10187222
664 Ga0207650_10287112
665 Ga0207659_10183149
666 Ga0207687_10008429
667 Ga0207700_10000046
668 Ga0207686_10003090
669 Ga0207686_10015836
670 Ga0207709_10001040
671 Ga0207670_10003264
672 Ga0207670_10005799
673 Ga0207669_10004135
674 Ga0207704_10002773
675 Ga0207704_10085583
676 Ga0207691_10095943
677 Ga0207691_10099185
678 Ga0207691_10105907
679 Ga0207711_10020792
680 Ga0207689_10001553
681 Ga0207689_10006200
682 Ga0207689_10031885
683 Ga0207667_10057474
684 Ga0207651_10091915
685 Ga0207712_10102495
686 Ga0207668_10216561
687 Ga0207668_10234509
688 Ga0207640_10001880
689 Ga0207640_10251770
690 Ga0207677_10001427
691 Ga0207677_10060823
692 Ga0207703_10023505
693 Ga0207703_10032174
694 Ga0207703_10323082
695 Ga0207639_10027403
696 Ga0207708_10000743
697 Ga0207708_10039719
698 Ga0207702_10022433
699 Ga0207702_10096953
700 Ga0207641_10049425
701 Ga0207641_10185592
702 Ga0207648_10002022
703 Ga0207648_10004018
704 Ga0207648_10004216
705 Ga0207676_10009835
706 Ga0207676_10015670
707 Ga0207676_10024604
708 Ga0207676_10055382
709 Ga0207675_100001028
710 Ga0207675_100001190
711 Ga0207675_100022446
712 Ga0207675_100204452
713 Ga0207675_100308698
714 Ga0207683_10038097
715 Ga0207683_10044872
716 Ga0207683_10166124
717 Ga0207683_10203354
718 Ga0207698_10096351
719 Ga0207428_10008109
720 Ga0207428_10047906
721 Ga0207428_10077488
722 Ga0207428_10150409
723 Ga0268265_10033819
724 Ga0268265_10070914
725 Ga0268265_10146253
726 Ga0268264_10001435
727 Ga0268264_10002576
728 Ga0268264_10013469
729 Ga0268264_10025838
730 Ga0265338_10006542
731 Ga0307511_10000350
732 Ga0265325_10000337
733 Ga0265339_10000133
734 Ga0265313_10000491
735 Ga0307413_10114168
736 Ga0307413_10324351
737 Ga0307412_10214577
738 Ga0307416_100129743
739 Ga0307414_10102189
740 Ga0307411_10049153
741 Ga0373952_0018355
742 Ga0373932_0013092
743 Ga0373932_0051233
744 Ga0373939_0004274
745 Ga0373941_0100709
746 Ga0373960_0009946
747 Ga0373960_0018191
748 Ga0373962_0033465
749 Ga0373931_0023605
750 Ga0373937_0021212
751 Ga0436365_0276109
752 Ga0439453_0004839
753 Ga0439443_003198
754 Ga0450898_033881
755 Ga0450904_003898
756 Ga0439435_0001732
757 Ga0439444_0008573
758 Ga0439464_0006978
759 Ga0451577_0068282
760 Ga0451577_0095639
761 Ga0451576_0007459
762 Ga0451576_0039411
763 Ga0451576_0360134
764 Ga0495592_0001018
765 Ga0495653_0099981
766 Ga0495580_0188387
767 Ga0495662_0015218
768 Ga0495608_0001394
769 Ga0495628_0119689
770 Ga0495628_0127059
771 Ga0495630_0006178
772 Ga0495666_0018847
773 Ga0495642_0013314
774 Ga0495640_0005697
775 Ga0495587_0046908
776 Ga0495598_0012623
777 Ga0495598_0052454
778 Ga0495645_0109238
779 Ga0495667_0103695
780 Ga0495634_0003881
781 Ga0495659_0029045
782 Ga0495599_0030391
783 Ga0495647_0044509
784 Ga0495658_0025277
785 Ga0495613_0004658
786 Ga0495670_0033380
787 Ga0495600_0006210
788 Ga0495604_0041928
789 Ga0495680_0003602
790 Ga0495684_0107986
791 Ga0496100_0015330
792 Ga0496101_0003653
793 Ga0496101_0140471
794 Ga0496102_0028992
795 Ga0496103_0139188
796 Ga0496104_0007508
797 Ga0496104_0102989
798 Ga0496104_0219357
799 Ga0496106_0004583
800 Ga0496107_0009729
801 Ga0496107_0235196
802 Ga0496108_0002505
803 Ga0496108_0068314
804 Ga0496108_0478614
805 Ga0496109_0007132
806 Ga0496109_0021405
807 Ga0496109_0081164
808 Ga0496109_0259660
809 Ga0496110_0002847
810 Ga0496110_0003290
811 Ga0496111_0006684
812 Ga0496111_0007361
813 Ga0496112_0001484
814 Ga0496112_0011900
815 Ga0496112_0097564
816 Ga0496113_0014796
817 Ga0496113_0029768
818 Ga0496114_0029347
819 Ga0496114_0183035
820 Ga0496115_0062358
821 Ga0496115_0230688
822 Ga0501032_0237101
823 Ga0501033_0030715
824 Ga0501033_0067348
825 Ga0501034_0058198
826 Ga0501034_0214187
827 Ga0501036_0012150
828 Ga0501036_0088004
829 Ga0501036_0328577
830 Ga0501038_0007196
831 Ga0501038_0060548
832 Ga0501039_0012183
833 Ga0501039_0015482
834 Ga0501040_0073737
835 Ga0501040_0197608
836 Ga0501042_0067114
837 Ga0501046_0021692
838 Ga0501047_0042254
839 Ga0501048_0013808
840 Ga0501048_0026936
841 Ga0501068_0047483
842 Ga0501068_0148029
843 Ga0501069_0008460
844 Ga0501072_0005974
845 Ga0501072_0006098
846 Ga0501073_0014721
847 Ga0501074_0006680
848 Ga0501074_0317587
849 Ga0501075_0002840
850 Ga0501075_0244370
851 Ga0501076_0000088
852 Ga0501077_0056937
853 Ga0501080_0023330
854 Ga0501080_0082092
855 Ga0501081_0014987
856 Ga0501083_0167678
857 Ga0501035_0485365
858 Ga0501044_0000193
859 nmdc:mga03683_94315_c1
860 nmdc:mga0yw44_42769_c1
861 nmdc:mga0k408_74326_c1
862 nmdc:mga07m45_12165_c1
863 nmdc:mga07m45_65927_c1
864 nmdc:mga05p37_134721_c1
865 nmdc:mga05p37_25007_c1
866 nmdc:mga09592_161112_c1
867 nmdc:mga09592_77392_c1
868 nmdc:mga0qj67_225877_c1
869 nmdc:mga0qj67_461540_c1
870 nmdc:mga0qj67_49519_c1
871 nmdc:mga0qj67_87584_c1
872 nmdc:mga06r32_25300_c1
873 nmdc:mga06r32_53534_c1
874 nmdc:mga08y16_113038_c1
875 nmdc:mga08y16_235174_c1
876 nmdc:mga08y16_27754_c1
877 nmdc:mga08y16_568867_c1
878 nmdc:mga08y16_80447_c1
879 nmdc:mga08y16_84816_c1
880 nmdc:mga0n895_15661_c1
881 nmdc:mga0n895_352468_c1
882 nmdc:mga0rr50_26377_c1
883 nmdc:mga0rr50_51347_c1
884 nmdc:mga08x19_754_c1
885 nmdc:mga0a205_853_c1
886 nmdc:mga0sz30_13819_c1
887 Ga0495601_0007555
888 Ga0495619_0188638
889 Ga0500646_0001795
890 Ga0500641_0084703
891 Ga0500555_003944
892 Ga0500594_0002616
893 Ga0500595_016245
894 Ga0500655_001910
895 Ga0500658_0114046
896 Ga0500568_0005515
897 Ga0500568_0035250
898 Ga0500604_0000535
899 Ga0500645_014187
900 Ga0501084_0005003
901 Ga0501084_0030467
902 Ga0501082_0015512
903 Ga0501082_0021884
904 Ga0501082_0100405
905 Ga0530510_0000514
906 2644328260
907 2858951505
908 2902407448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

87

355

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9522 27 321
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.946 27 321
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9413 26 321
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9382 26 321
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9303 29 318
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9397 123 240 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9223 26 321 3.40.190.150
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.92 25 321 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9183 123 242 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9171 26 321 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A536SZA0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9858 21 322
AF-A0A1F4BK11-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9732 79 289
AF-A0A1W2A5T4-F1-model_v4 Tripartite-type tricarboxylate transporter, receptor component TctC 0.9681 22 321
AF-A0A1F4DK31-F1-model_v4 LacI family transcriptional regulator 0.9677 21 321
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9675 52 321

Map