metagRoot

F447380

General Info

Members	Datasets	Scaffolds	Average Seq Length
454	219	454	431

Family's Representative Sequence

Representative Sequence	3300013105\|Ga0157369_10018713\|Ga0157369_100187134
Length	510
Sequence	LELPAFDDELPHETTSKENIIAAKRKTFFINGPRNKFQIVNESIRRFAMLSRSRRLRFVRVSDKLNSPIAQTNSSSAQSLARRLSLFDATMLVMGGIIGTGIFMNPYVVAQRVHTPALVLGAWLVGGCIALLGGFIWAELADRMPTAGGQYAYLRDAYDPLVSFLYGWVLLLVIQTGGMAAVTVTFSRYFLELTGRHAGEWQIAFVALSVLTIINCMGVRAGGTVQSGLMVLKIAAIALLVFAGAFLVHGHVQWKPVLDQPVSGGLFSSFGAAMVPVVFAFGGWHTATFASAEMKAPRRDLPRALIMGVIAVALLYLSVNXXXXHALGVSALANTPAPASAVMRMALGQRGATIIALAIAISTLGFLSQSVLTAPRVYFAMAQDRLFFRQLAWVHPRTQAPVLAIAIQSVWTMVILLTGGYDKILNYVTSMDVLFWAFTAGSLFILRRRDSSRSAFSMPGHPYTTALFCVVCLAVVGNTLYTYPENTLIGFAILAAGVPMYYIWRRTLRA

Samples

	Sample ID	Description	Type	Environment
1	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
4	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
5	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
6	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
7	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
8	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
9	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
10	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
11	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
12	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
13	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
14	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
15	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
16	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
17	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
18	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
19	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
20	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
21	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
22	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
23	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
24	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
28	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
29	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
30	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
31	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
32	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
47	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
48	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
49	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
56	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
57	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
62	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
63	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
64	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
65	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
66	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
67	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
68	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
69	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
70	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
71	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
72	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
73	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
75	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
76	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
78	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
79	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
80	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
81	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
82	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
83	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
84	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
85	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
86	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
87	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
88	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
89	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
90	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
91	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
92	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
93	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
94	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
95	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
96	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
148	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
149	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
150	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
151	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
152	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
153	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
154	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
155	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
156	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
157	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
158	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
159	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
160	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
161	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
162	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
163	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
164	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
165	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
167	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
168	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
169	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
170	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
171	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
172	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
173	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
174	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
175	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
176	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
177	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
178	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
179	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
180	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
181	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
182	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
183	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
184	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
185	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
186	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
187	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
188	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
189	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
190	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
191	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
192	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
193	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
194	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
195	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
196	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
197	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
198	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
199	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
200	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
201	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
202	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
203	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
204	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
205	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
206	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
207	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
208	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
209	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
210	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
211	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
212	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
213	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
214	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
215	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
216	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
217	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
218	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
219	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0.88
Nodule	0
Rhizoplane	2.64
Rhizosphere	95.37
Stem	0
Stem Tuber	0
Unclassified	1.1

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10004254	3300001979	Bacteria	6167
2	JGI24739J22299_10001795	3300001989	Bacteria	8170
3	JGI24739J22299_10002106	3300001989	Bacteria	7621
4	JGI24737J22298_10000419	3300001990	Bacteria	14540
5	JGI24738J21930_10000456	3300002075	Bacteria	11594
6	Ga0065712_10074837	3300005290	Bacteria	3996
7	Ga0065715_10116660	3300005293	Bacteria	2373
8	Ga0070658_10065055	3300005327	Bacteria	2975
9	Ga0070658_10067341	3300005327	Bacteria	2926
10	Ga0070658_10124625	3300005327	Bacteria	2143
11	Ga0070676_10000962	3300005328	Bacteria	14326
12	Ga0070676_10020752	3300005328	Bacteria	3672
13	Ga0070683_100021802	3300005329	Bacteria	5719
14	Ga0070683_100209656	3300005329	Bacteria	1851
15	Ga0070690_100028212	3300005330	Bacteria	3476
16	Ga0070670_100058462	3300005331	Bacteria	3310
17	Ga0070670_100067723	3300005331	Bacteria	3063
18	Ga0068869_100000249	3300005334	Bacteria	28378
19	Ga0068869_100048112	3300005334	Bacteria	3082
20	Ga0070666_10000853	3300005335	Bacteria	18463
21	Ga0070680_100000384	3300005336	Bacteria	29982
22	Ga0070680_100005554	3300005336	Bacteria	9544
23	Ga0070680_100084339	3300005336	Bacteria	2624
24	Ga0070680_100102557	3300005336	Bacteria	2376
25	Ga0070682_100061260	3300005337	Unclassified	2381
26	Ga0068868_100000113	3300005338	Bacteria	50799
27	Ga0070660_100023068	3300005339	Bacteria	4608
28	Ga0070660_100025786	3300005339	Bacteria	4372
29	Ga0070660_100072476	3300005339	Bacteria	2692
30	Ga0070660_100093480	3300005339	Bacteria	2375
31	Ga0070691_10000966	3300005341	Bacteria	11743
32	Ga0070661_100092609	3300005344	Bacteria	2239
33	Ga0070692_10087702	3300005345	Bacteria	1686
34	Ga0070668_100018349	3300005347	Bacteria	5252
35	Ga0070668_100168602	3300005347	Bacteria	1781
36	Ga0070669_100000155	3300005353	Bacteria	61710
37	Ga0070669_100031918	3300005353	Bacteria	3805
38	Ga0070669_100036775	3300005353	Bacteria	3549
39	Ga0070671_100003933	3300005355	Bacteria	11687
40	Ga0070671_100007800	3300005355	Bacteria	8551
41	Ga0070673_100000177	3300005364	Bacteria	31060
42	Ga0070673_100065928	3300005364	Bacteria	2891
43	Ga0070659_100000305	3300005366	Bacteria	38108
44	Ga0070659_100016610	3300005366	Bacteria	5528
45	Ga0070659_100024764	3300005366	Bacteria	4603
46	Ga0070667_100002102	3300005367	Bacteria	17561
47	Ga0070667_100060400	3300005367	Bacteria	3207
48	Ga0070709_10000041	3300005434	Bacteria	105988
49	Ga0070714_100013043	3300005435	Bacteria	6649
50	Ga0070714_100157375	3300005435	Bacteria	2052
51	Ga0070713_100010301	3300005436	Bacteria	6749
52	Ga0070710_10019990	3300005437	Bacteria	3469
53	Ga0070711_100000051	3300005439	Bacteria	73775
54	Ga0070711_100012252	3300005439	Bacteria	5351
55	Ga0070711_100021487	3300005439	Bacteria	4175
56	Ga0070700_100000090	3300005441	Bacteria	61626
57	Ga0070700_100135282	3300005441	Bacteria	1668
58	Ga0070662_100000133	3300005457	Bacteria	41884
59	Ga0070662_100042776	3300005457	Bacteria	3237
60	Ga0070662_100165707	3300005457	Bacteria	1731
61	Ga0070681_10002906	3300005458	Bacteria	15850
62	Ga0070681_10118937	3300005458	Bacteria	2578
63	Ga0068867_100001645	3300005459	Bacteria	15522
64	Ga0068867_100001817	3300005459	Bacteria	14865
65	Ga0070685_10001726	3300005466	Bacteria	11469
66	Ga0070706_100000012	3300005467	Bacteria	195040
67	Ga0070706_100003274	3300005467	Bacteria	16019
68	Ga0070706_100015555	3300005467	Bacteria	7028
69	Ga0070707_100129582	3300005468	Bacteria	2452
70	Ga0070707_100130786	3300005468	Bacteria	2441
71	Ga0070698_100000714	3300005471	Bacteria	35621
72	Ga0070698_100055982	3300005471	Bacteria	3997
73	Ga0070699_100002827	3300005518	Bacteria	15494
74	Ga0070679_100000495	3300005530	Bacteria	33587
75	Ga0070684_100015605	3300005535	Bacteria	6194
76	Ga0070697_100000498	3300005536	Bacteria	29802
77	Ga0070697_100110776	3300005536	Unclassified	2287
78	Ga0070697_100155112	3300005536	Unclassified	1932
79	Ga0068853_100001365	3300005539	Bacteria	17608
80	Ga0068853_100006076	3300005539	Bacteria	9558
81	Ga0068853_100016680	3300005539	Bacteria	6050
82	Ga0068853_100023480	3300005539	Bacteria	5163
83	Ga0068853_100067376	3300005539	Bacteria	3110
84	Ga0068853_100165596	3300005539	Bacteria	1997
85	Ga0070672_100000437	3300005543	Bacteria	24334
86	Ga0070693_100006808	3300005547	Bacteria	5552
87	Ga0070665_100000265	3300005548	Bacteria	85729
88	Ga0070665_100000495	3300005548	Bacteria	56309
89	Ga0070665_100000995	3300005548	Bacteria	35932
90	Ga0068855_100000753	3300005563	Bacteria	39796
91	Ga0070664_100004040	3300005564	Bacteria	11785
92	Ga0070664_100025084	3300005564	Bacteria	4939
93	Ga0070664_100047423	3300005564	Bacteria	3629
94	Ga0070664_100104575	3300005564	Bacteria	2465
95	Ga0070664_100182288	3300005564	Bacteria	1867
96	Ga0068857_100002400	3300005577	Bacteria	15273
97	Ga0068857_100004566	3300005577	Bacteria	11718
98	Ga0068857_100026484	3300005577	Bacteria	5112
99	Ga0068857_100043885	3300005577	Bacteria	3965
100	Ga0068857_100146653	3300005577	Bacteria	2135
101	Ga0068854_100000206	3300005578	Bacteria	39747
102	Ga0068854_100029092	3300005578	Bacteria	3822
103	Ga0068856_100079969	3300005614	Bacteria	3242
104	Ga0068852_100004086	3300005616	Bacteria	10269
105	Ga0068852_100005891	3300005616	Bacteria	8813
106	Ga0068852_100050771	3300005616	Bacteria	3556
107	Ga0068859_100001723	3300005617	Bacteria	22290
108	Ga0068859_100008667	3300005617	Bacteria	10279
109	Ga0068859_100020895	3300005617	Bacteria	6570
110	Ga0068859_100081118	3300005617	Bacteria	3286
111	Ga0068859_100097292	3300005617	Bacteria	2996
112	Ga0068859_100108273	3300005617	Bacteria	2840
113	Ga0068859_100127913	3300005617	Bacteria	2611
114	Ga0068864_100000428	3300005618	Bacteria	36392
115	Ga0068864_100013518	3300005618	Bacteria	6768
116	Ga0068861_100030418	3300005719	Bacteria	3957
117	Ga0068851_10013119	3300005834	Bacteria	3921
118	Ga0068863_100000634	3300005841	Bacteria	35566
119	Ga0068863_100027190	3300005841	Bacteria	5456
120	Ga0068863_100147375	3300005841	Bacteria	2251
121	Ga0068858_100002105	3300005842	Bacteria	20206
122	Ga0068858_100057681	3300005842	Bacteria	3589
123	Ga0068858_100118340	3300005842	Bacteria	2476
124	Ga0068860_100002325	3300005843	Bacteria	19958
125	Ga0068860_100003985	3300005843	Bacteria	15149
126	Ga0068860_100008486	3300005843	Bacteria	10239
127	Ga0068862_100018881	3300005844	Bacteria	5745
128	Ga0068862_100056723	3300005844	Bacteria	3357
129	Ga0068862_100124997	3300005844	Bacteria	2270
130	Ga0068862_100174565	3300005844	Bacteria	1926
131	Ga0081539_10001840	3300005985	Bacteria	33465
132	Ga0081539_10013466	3300005985	Bacteria	6159
133	Ga0070717_10139549	3300006028	Bacteria	2090
134	Ga0070715_10008538	3300006163	Unclassified	3574
135	Ga0070716_100019402	3300006173	Bacteria	3553
136	Ga0070712_100012255	3300006175	Bacteria	5450
137	Ga0075362_10033722	3300006177	Bacteria	2228
138	Ga0068871_100045287	3300006358	Bacteria	3540
139	Ga0075431_100096104	3300006847	Unclassified	3059
140	Ga0075434_100032154	3300006871	Bacteria	5173
141	Ga0068865_100002437	3300006881	Bacteria	10995
142	Ga0068865_100127731	3300006881	Unclassified	1900
143	Ga0075436_100005524	3300006914	Bacteria	8688
144	Ga0075436_100039587	3300006914	Unclassified	3253
145	Ga0097620_100001723	3300006931	Bacteria	22290
146	Ga0097620_100008667	3300006931	Bacteria	10279
147	Ga0097620_100020896	3300006931	Bacteria	6570
148	Ga0097620_100081118	3300006931	Bacteria	3286
149	Ga0097620_100097289	3300006931	Bacteria	2996
150	Ga0097620_100108270	3300006931	Bacteria	2840
151	Ga0097620_100127913	3300006931	Bacteria	2611
152	Ga0105240_10017562	3300009093	Bacteria	9639
153	Ga0105240_10079641	3300009093	Bacteria	4031
154	Ga0105240_10100484	3300009093	Bacteria	3520
155	Ga0105240_10182690	3300009093	Bacteria	2473
156	Ga0105240_10220697	3300009093	Unclassified	2209
157	Ga0105245_10000325	3300009098	Bacteria	44936
158	Ga0105245_10043411	3300009098	Unclassified	4010
159	Ga0114129_10002730	3300009147	Bacteria	24606
160	Ga0114129_10031340	3300009147	Bacteria	7517
161	Ga0114129_10034566	3300009147	Bacteria	7141
162	Ga0114129_10222149	3300009147	Unclassified	2548
163	Ga0105243_10020783	3300009148	Bacteria	4981
164	Ga0105243_10170323	3300009148	Archaea	1885
165	Ga0105241_10153740	3300009174	Bacteria	1885
166	Ga0105242_10146375	3300009176	Unclassified	2055
167	Ga0105248_10001472	3300009177	Bacteria	26219
168	Ga0105248_10012006	3300009177	Bacteria	9553
169	Ga0105248_10148915	3300009177	Bacteria	2641
170	Ga0105237_10061054	3300009545	Bacteria	3770
171	Ga0105238_10053333	3300009551	Bacteria	4063
172	Ga0105238_10056727	3300009551	Bacteria	3928
173	Ga0105238_10135567	3300009551	Bacteria	2439
174	Ga0157373_10008548	3300013100	Bacteria	7605
175	Ga0157373_10017790	3300013100	Bacteria	5175
176	Ga0157373_10020704	3300013100	Bacteria	4777
177	Ga0157373_10023438	3300013100	Bacteria	4475
178	Ga0157373_10028364	3300013100	Bacteria	4037
179	Ga0157370_10101284	3300013104	Bacteria	2698
180	Ga0157370_10158073	3300013104	Bacteria	2109
181	Ga0157369_10001722	3300013105	Bacteria	26646
182	Ga0157369_10018713	3300013105	Bacteria	7767
183	Ga0157369_10094394	3300013105	Bacteria	3193
184	Ga0157378_10000385	3300013297	Bacteria	43624
185	Ga0157378_10000922	3300013297	Bacteria	27059
186	Ga0163162_10003059	3300013306	Bacteria	15983
187	Ga0163162_10023035	3300013306	Bacteria	6142
188	Ga0157372_10004258	3300013307	Bacteria	15306
189	Ga0157372_10015552	3300013307	Bacteria	8154
190	Ga0157372_10016955	3300013307	Bacteria	7820
191	Ga0157372_10036692	3300013307	Bacteria	5403
192	Ga0157372_10128244	3300013307	Bacteria	2917
193	Ga0157375_10021468	3300013308	Bacteria	5922
194	Ga0163163_10030062	3300014325	Bacteria	5230
195	Ga0157380_10025023	3300014326	Bacteria	4523
196	Ga0157380_10039167	3300014326	Bacteria	3685
197	Ga0157377_10031669	3300014745	Bacteria	2875
198	Ga0157379_10012979	3300014968	Bacteria	7291
199	Ga0157379_10030775	3300014968	Bacteria	4780
200	Ga0213872_10006081	3300021361	Bacteria	6106
201	Ga0213876_10000031	3300021384	Bacteria	213087
202	Ga0213876_10000160	3300021384	Bacteria	70306
203	Ga0207697_10000109	3300025315	Bacteria	38398
204	Ga0207656_10041300	3300025321	Bacteria	1959
205	Ga0207688_10000437	3300025901	Bacteria	19709
206	Ga0207688_10005020	3300025901	Bacteria	7194
207	Ga0207680_10007545	3300025903	Bacteria	5313
208	Ga0207680_10025830	3300025903	Bacteria	3245
209	Ga0207647_10000999	3300025904	Bacteria	21927
210	Ga0207647_10001452	3300025904	Bacteria	18194
211	Ga0207699_10000003	3300025906	Bacteria	577076
212	Ga0207645_10001179	3300025907	Bacteria	21601
213	Ga0207645_10008994	3300025907	Bacteria	6935
214	Ga0207705_10008203	3300025909	Bacteria	7641
215	Ga0207684_10000028	3300025910	Bacteria	306450
216	Ga0207707_10056654	3300025912	Bacteria	3410
217	Ga0207695_10153770	3300025913	Bacteria	2237
218	Ga0207695_10234641	3300025913	Bacteria	1737
219	Ga0207695_10298511	3300025913	Bacteria	1502
220	Ga0207693_10018250	3300025915	Bacteria	5589
221	Ga0207663_10000003	3300025916	Bacteria	458807
222	Ga0207663_10126850	3300025916	Bacteria	1757
223	Ga0207660_10000603	3300025917	Bacteria	24273
224	Ga0207660_10042533	3300025917	Bacteria	3190
225	Ga0207660_10139952	3300025917	Bacteria	1850
226	Ga0207657_10005161	3300025919	Bacteria	13700
227	Ga0207657_10018679	3300025919	Bacteria	6608
228	Ga0207649_10015240	3300025920	Bacteria	4318
229	Ga0207649_10042898	3300025920	Bacteria	2762
230	Ga0207652_10010487	3300025921	Bacteria	7458
231	Ga0207652_10083713	3300025921	Bacteria	2793
232	Ga0207652_10195580	3300025921	Unclassified	1819
233	Ga0207681_10042235	3300025923	Bacteria	3044
234	Ga0207694_10020241	3300025924	Bacteria	5031
235	Ga0207694_10067683	3300025924	Bacteria	2788
236	Ga0207687_10010009	3300025927	Bacteria	6203
237	Ga0207687_10010223	3300025927	Bacteria	6129
238	Ga0207700_10215643	3300025928	Unclassified	1625
239	Ga0207664_10055653	3300025929	Bacteria	3139
240	Ga0207664_10124160	3300025929	Bacteria	2165
241	Ga0207644_10136233	3300025931	Bacteria	1885
242	Ga0207690_10003663	3300025932	Bacteria	9146
243	Ga0207690_10058864	3300025932	Bacteria	2601
244	Ga0207706_10000300	3300025933	Bacteria	53727
245	Ga0207706_10045614	3300025933	Bacteria	3883
246	Ga0207706_10122383	3300025933	Bacteria	2288
247	Ga0207706_10216797	3300025933	Bacteria	1677
248	Ga0207709_10058866	3300025935	Bacteria	2389
249	Ga0207704_10052478	3300025938	Bacteria	2472
250	Ga0207665_10027844	3300025939	Bacteria	3733
251	Ga0207665_10078831	3300025939	Bacteria	2263
252	Ga0207691_10000294	3300025940	Bacteria	49457
253	Ga0207711_10016086	3300025941	Bacteria	6208
254	Ga0207711_10022837	3300025941	Bacteria	5235
255	Ga0207711_10103298	3300025941	Bacteria	2524
256	Ga0207689_10000900	3300025942	Bacteria	28541
257	Ga0207689_10141706	3300025942	Bacteria	1980
258	Ga0207661_10035311	3300025944	Bacteria	3895
259	Ga0207679_10033338	3300025945	Bacteria	3622
260	Ga0207679_10035318	3300025945	Bacteria	3536
261	Ga0207667_10002705	3300025949	Bacteria	21934
262	Ga0207667_10020666	3300025949	Bacteria	7315
263	Ga0207667_10038716	3300025949	Bacteria	5087
264	Ga0207667_10099668	3300025949	Bacteria	2997
265	Ga0207667_10120695	3300025949	Bacteria	2701
266	Ga0207667_10167836	3300025949	Bacteria	2256
267	Ga0207651_10005717	3300025960	Bacteria	6420
268	Ga0207668_10000021	3300025972	Bacteria	137592
269	Ga0207668_10042469	3300025972	Bacteria	3079
270	Ga0207640_10000884	3300025981	Bacteria	16999
271	Ga0207658_10005047	3300025986	Bacteria	9087
272	Ga0207703_10007475	3300026035	Bacteria	8679
273	Ga0207703_10049055	3300026035	Bacteria	3412
274	Ga0207703_10076606	3300026035	Bacteria	2775
275	Ga0207639_10006885	3300026041	Bacteria	7742
276	Ga0207639_10007623	3300026041	Bacteria	7383
277	Ga0207639_10040034	3300026041	Unclassified	3496
278	Ga0207639_10041873	3300026041	Bacteria	3430
279	Ga0207639_10042460	3300026041	Bacteria	3408
280	Ga0207639_10053757	3300026041	Bacteria	3074
281	Ga0207678_10014225	3300026067	Bacteria	6996
282	Ga0207678_10041259	3300026067	Bacteria	4001
283	Ga0207678_10240160	3300026067	Unclassified	1552
284	Ga0207708_10000095	3300026075	Bacteria	67730
285	Ga0207641_10012662	3300026088	Bacteria	6916
286	Ga0207641_10032090	3300026088	Bacteria	4360
287	Ga0207648_10001537	3300026089	Bacteria	25401
288	Ga0207648_10008749	3300026089	Bacteria	9757
289	Ga0207676_10000492	3300026095	Bacteria	33222
290	Ga0207676_10197877	3300026095	Bacteria	1773
291	Ga0207674_10000023	3300026116	Bacteria	157752
292	Ga0207674_10001709	3300026116	Bacteria	28102
293	Ga0207674_10005725	3300026116	Bacteria	14735
294	Ga0207674_10014471	3300026116	Bacteria	8712
295	Ga0207674_10110791	3300026116	Bacteria	2720
296	Ga0207675_100046717	3300026118	Bacteria	4046
297	Ga0207675_100079959	3300026118	Bacteria	3064
298	Ga0207675_100095000	3300026118	Bacteria	2804
299	Ga0207698_10003528	3300026142	Bacteria	9434
300	Ga0207698_10054544	3300026142	Bacteria	3076
301	Ga0207698_10123140	3300026142	Bacteria	2199
302	Ga0207698_10221460	3300026142	Bacteria	1710
303	Ga0268266_10000187	3300028379	Bacteria	110229
304	Ga0268266_10000318	3300028379	Bacteria	76400
305	Ga0268266_10001881	3300028379	Bacteria	23712
306	Ga0268266_10047250	3300028379	Bacteria	3687
307	Ga0268265_10000789	3300028380	Bacteria	30232
308	Ga0268265_10032580	3300028380	Unclassified	3779
309	Ga0268265_10060759	3300028380	Bacteria	2897
310	Ga0268264_10002322	3300028381	Bacteria	16822
311	Ga0268264_10004293	3300028381	Bacteria	12162
312	Ga0265322_10000184	3300028654	Bacteria	28703
313	Ga0265338_10048199	3300028800	Unclassified	3880
314	Ga0265320_10010444	3300031240	Bacteria	5533
315	Ga0265313_10037332	3300031595	Unclassified	2431
316	Ga0307413_10014089	3300031824	Bacteria	4046
317	Ga0307410_10017696	3300031852	Bacteria	4288
318	Ga0307410_10038505	3300031852	Bacteria	3133
319	Ga0307409_100007636	3300031995	Bacteria	6487
320	Ga0307409_100010609	3300031995	Bacteria	5742
321	Ga0307409_100100765	3300031995	Bacteria	2395
322	Ga0307411_10061433	3300032005	Bacteria	2501
323	Ga0307411_10072011	3300032005	Bacteria	2345
324	Ga0373959_0012229	3300034820	Bacteria	1528
325	Ga0373926_0008779	3300035083	Bacteria	3364
326	Ga0373923_0010101	3300035111	Bacteria	3425
327	Ga0373957_0005111	3300035120	Bacteria	4050
328	Ga0373957_0040408	3300035120	Bacteria	1754
329	Ga0373924_0000058	3300035410	Bacteria	28551
330	Ga0373935_0000413	3300035692	Bacteria	22221
331	Ga0373935_0041618	3300035692	Bacteria	2887
332	Ga0373927_0001716	3300035695	Bacteria	16370
333	Ga0373927_0011274	3300035695	Bacteria	5950
334	Ga0373927_0030541	3300035695	Unclassified	3515
335	Ga0373933_0259024	3300035724	Bacteria	1121
336	Ga0373947_0009977	3300035725	Bacteria	5453
337	Ga0373947_0014191	3300035725	Unclassified	4568
338	Ga0373947_0146603	3300035725	Bacteria	1518
339	Ga0373937_0000569	3300036401	Bacteria	32728
340	Ga0373937_0007336	3300036401	Bacteria	9546
341	Ga0373937_0018974	3300036401	Bacteria	6151
342	Ga0373937_0028276	3300036401	Bacteria	5072
343	Ga0373937_0110624	3300036401	Bacteria	2555
344	Ga0373925_0017592	3300037068	Bacteria	5185
345	Ga0373925_0099121	3300037068	Bacteria	2237
346	Ga0395899_0015046	3300037312	Bacteria	5898
347	Ga0395899_0023950	3300037312	Bacteria	4619
348	Ga0395899_0094484	3300037312	Unclassified	2163
349	Ga0395900_0002008	3300037418	Bacteria	22966
350	Ga0395900_0002613	3300037418	Bacteria	19679
351	Ga0395900_0007137	3300037418	Bacteria	11577
352	Ga0395900_0029758	3300037418	Bacteria	5604
353	Ga0395900_0040442	3300037418	Bacteria	4805
354	Ga0395900_0079058	3300037418	Bacteria	3379
355	Ga0395900_0091091	3300037418	Bacteria	3133
356	Ga0395900_0104921	3300037418	Bacteria	2904
357	Ga0395900_0106498	3300037418	Unclassified	2880
358	Ga0395900_0186074	3300037418	Bacteria	2108
359	Ga0395900_0192452	3300037418	Bacteria	2068
360	Ga0395898_0016301	3300037466	Bacteria	7605
361	Ga0395898_0132300	3300037466	Unclassified	2389
362	Ga0395898_0136416	3300037466	Unclassified	2349
363	Ga0395898_0224782	3300037466	Bacteria	1790
364	Ga0395898_0234684	3300037466	Bacteria	1749
365	Ga0395898_0389661	3300037466	Unclassified	1329
366	Ga0395905_0000218	3300037471	Bacteria	87745
367	Ga0395905_0002082	3300037471	Bacteria	22753
368	Ga0395905_0003854	3300037471	Bacteria	15814
369	Ga0395905_0009372	3300037471	Bacteria	9574
370	Ga0395905_0010977	3300037471	Bacteria	8766
371	Ga0395905_0054053	3300037471	Bacteria	3758
372	Ga0395905_0061120	3300037471	Bacteria	3523
373	Ga0395905_0063243	3300037471	Bacteria	3462
374	Ga0395905_0078059	3300037471	Bacteria	3102
375	Ga0395905_0079096	3300037471	Bacteria	3081
376	Ga0395905_0111552	3300037471	Bacteria	2568
377	Ga0395905_0237264	3300037471	Bacteria	1704
378	Ga0395901_0002884	3300038443	Bacteria	17345
379	Ga0395901_0016335	3300038443	Bacteria	7560
380	Ga0395901_0017066	3300038443	Bacteria	7400
381	Ga0395901_0162820	3300038443	Unclassified	2342
382	Ga0395901_0181244	3300038443	Bacteria	2209
383	Ga0395901_0208327	3300038443	Bacteria	2047
384	Ga0395901_0243794	3300038443	Unclassified	1873
385	Ga0436365_0882969	3300039437	Bacteria	184313
386	Ga0436365_1352252	3300039437	Bacteria	6516
387	Ga0436365_1621207	3300039437	Bacteria	143212
388	Ga0436361_0002110	3300039447	Bacteria	36452
389	Ga0436361_0327584	3300039447	Unclassified	2118
390	Ga0439458_0000393	3300042157	Bacteria	10965
391	Ga0453683_0035530	3300044673	Unclassified	3140
392	Ga0466966_0046264	3300044684	Bacteria	2779
393	Ga0466961_0002409	3300044693	Bacteria	11623
394	Ga0466963_0010123	3300044694	Bacteria	5701
395	Ga0466963_0015710	3300044694	Bacteria	4696
396	Ga0466963_0031778	3300044694	Unclassified	3414
397	Ga0466963_0169121	3300044694	Unclassified	1523
398	Ga0466957_0000088	3300044842	Bacteria	36833
399	Ga0466957_0011375	3300044842	Bacteria	5132
400	Ga0466960_0083537	3300044901	Unclassified	1614
401	Ga0466958_0065920	3300045836	Bacteria	2210
402	Ga0466967_0019046	3300045976	Bacteria	5509
403	Ga0466967_0142226	3300045976	Bacteria	2236
404	Ga0466967_0165138	3300045976	Bacteria	2080
405	Ga0466967_0173967	3300045976	Bacteria	2027
406	Ga0466967_0245082	3300045976	Unclassified	1710
407	Ga0466967_0254923	3300045976	Unclassified	1677
408	Ga0495580_0004829	3300046472	Bacteria	11283
409	Ga0495582_0049120	3300046473	Bacteria	2323
410	Ga0495608_0075342	3300046511	Bacteria	2199
411	Ga0495642_0024326	3300046528	Bacteria	2396
412	Ga0495652_0075553	3300046529	Bacteria	2798
413	Ga0495665_0059223	3300046531	Unclassified	2021
414	Ga0495623_0022991	3300046679	Bacteria	4025
415	Ga0495658_0030203	3300046683	Unclassified	2941
416	Ga0495669_0021077	3300046684	Bacteria	2826
417	Ga0495604_0010356	3300047317	Bacteria	7383
418	Ga0495672_0074995	3300047320	Unclassified	1903
419	Ga0495675_0059060	3300047444	Bacteria	2432
420	Ga0495675_0156723	3300047444	Bacteria	1404
421	Ga0495677_0010754	3300047445	Bacteria	3353
422	Ga0495684_0003519	3300047471	Bacteria	12252
423	Ga0495602_0024460	3300048088	Bacteria	5859
424	Ga0496102_0005962	3300048905	Bacteria	10380
425	Ga0496104_0091679	3300048907	Bacteria	2905
426	Ga0496105_0001364	3300048908	Bacteria	17172
427	Ga0496106_0019022	3300048909	Bacteria	5091
428	Ga0496110_0084853	3300048913	Bacteria	2827
429	Ga0496112_0007469	3300048915	Bacteria	9700
430	Ga0496112_0034805	3300048915	Bacteria	4902
431	Ga0496112_0097122	3300048915	Unclassified	2917
432	Ga0496113_0003466	3300048916	Bacteria	9448
433	Ga0496113_0039770	3300048916	Bacteria	3463
434	Ga0496113_0061177	3300048916	Bacteria	2841
435	Ga0496114_0092179	3300048917	Bacteria	2574
436	Ga0501034_0200191	3300049571	Bacteria	1956
437	Ga0501069_0009717	3300049585	Bacteria	5082
438	Ga0501217_008696	3300049661	Unclassified	2198
439	Ga0501227_002903	3300049665	Bacteria	3759
440	nmdc:mga03683_33321_c1	3300050489	Bacteria	2077
441	nmdc:mga05p37_112187_c1	3300050507	Bacteria	3353
442	nmdc:mga05p37_14958_c1	3300050507	Bacteria	9315
443	nmdc:mga05p37_151400_c1	3300050507	Bacteria	2837
444	nmdc:mga09592_19027_c1	3300050508	Bacteria	5635
445	nmdc:mga0qj67_77943_c1	3300050509	Unclassified	2652
446	nmdc:mga06r32_265163_c1	3300050510	Bacteria	1705
447	nmdc:mga0n895_13809_c1	3300050512	Bacteria	7305
448	nmdc:mga0n895_236936_c1	3300050512	Bacteria	1852
449	nmdc:mga0n895_53454_c1	3300050512	Bacteria	3968
450	nmdc:mga08x19_46_c1	3300050514	Bacteria	145818
451	Ga0495601_0007188	3300053077	Bacteria	6533
452	Ga0495619_0002004	3300053085	Bacteria	13548
453	Ga0500628_000418	3300053129	Bacteria	8097
454	Ga0500587_007321	3300053739	Bacteria	1439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049665	Ga0501227_002903	Ga0501227_002903_1806_2843	323
2	3300035724	Ga0373933_0259024	Ga0373933_0259024_11_1072	336
3	3300044694	Ga0466963_0169121	Ga0466963_0169121_311_1510	342
4	3300005618	Ga0068864_100013518	Ga0068864_1000135185	355
5	3300026041	Ga0207639_10040034	Ga0207639_100400344	355
6	3300026116	Ga0207674_10000023	Ga0207674_1000002381	355
7	3300006175	Ga0070712_100012255	Ga0070712_1000122552	359
8	3300025906	Ga0207699_10000003	Ga0207699_10000003129	359
9	3300025915	Ga0207693_10018250	Ga0207693_100182502	359
10	3300005366	Ga0070659_100024764	Ga0070659_1000247641	365
11	3300005458	Ga0070681_10118937	Ga0070681_101189371	365
12	3300026095	Ga0207676_10197877	Ga0207676_101978772	365
13	3300005339	Ga0070660_100072476	Ga0070660_1000724762	368
14	3300005457	Ga0070662_100165707	Ga0070662_1001657072	368
15	3300005539	Ga0068853_100016680	Ga0068853_1000166803	368
16	3300005564	Ga0070664_100104575	Ga0070664_1001045751	368
17	3300014325	Ga0163163_10030062	Ga0163163_100300624	368
18	3300025949	Ga0207667_10120695	Ga0207667_101206952	376
19	3300005290	Ga0065712_10074837	Ga0065712_100748373	377
20	3300044694	Ga0466963_0015710	Ga0466963_0015710_3400_4668	377
21	3300048917	Ga0496114_0092179	Ga0496114_0092179_1097_2434	377
22	3300005842	Ga0068858_100057681	Ga0068858_1000576813	378
23	3300006871	Ga0075434_100032154	Ga0075434_1000321542	378
24	3300013306	Ga0163162_10003059	Ga0163162_100030591	378
25	3300037418	Ga0395900_0002613	Ga0395900_0002613_2202_3473	378
26	3300037471	Ga0395905_0003854	Ga0395905_0003854_3322_4593	378
27	3300005439	Ga0070711_100000051	Ga0070711_10000005113	379
28	3300025916	Ga0207663_10000003	Ga0207663_10000003171	379
29	3300005434	Ga0070709_10000041	Ga0070709_100000418	380
30	3300005330	Ga0070690_100028212	Ga0070690_1000282122	383
31	3300026067	Ga0207678_10240160	Ga0207678_102401601	384
32	3300013307	Ga0157372_10016955	Ga0157372_100169552	386
33	3300014968	Ga0157379_10030775	Ga0157379_100307753	386
34	3300026035	Ga0207703_10076606	Ga0207703_100766062	387
35	3300005441	Ga0070700_100000090	Ga0070700_10000009011	388
36	3300005617	Ga0068859_100008667	Ga0068859_1000086673	388
37	3300006914	Ga0075436_100005524	Ga0075436_1000055246	388
38	3300006931	Ga0097620_100008667	Ga0097620_1000086673	388
39	3300009177	Ga0105248_10012006	Ga0105248_100120067	388
40	3300025941	Ga0207711_10022837	Ga0207711_100228373	388
41	3300026075	Ga0207708_10000095	Ga0207708_1000009539	388
42	3300044842	Ga0466957_0011375	Ga0466957_0011375_3099_4451	388
43	3300013100	Ga0157373_10020704	Ga0157373_100207044	389
44	3300025933	Ga0207706_10216797	Ga0207706_102167972	389
45	3300009093	Ga0105240_10182690	Ga0105240_101826902	390
46	3300025949	Ga0207667_10020666	Ga0207667_100206664	390
47	3300037466	Ga0395898_0389661	Ga0395898_0389661_11_1255	390
48	3300005467	Ga0070706_100015555	Ga0070706_1000155556	391
49	3300005536	Ga0070697_100155112	Ga0070697_1001551122	391
50	3300028380	Ga0268265_10032580	Ga0268265_100325801	391
51	3300050507	nmdc:mga05p37_14958_c1	nmdc:mga05p37_14958_c1_4626_5954	391
52	3300050512	nmdc:mga0n895_53454_c1	nmdc:mga0n895_53454_c1_1476_2804	391
53	3300050514	nmdc:mga08x19_46_c1	nmdc:mga08x19_46_c1_140274_141542	391
54	3300053739	Ga0500587_007321	Ga0500587_007321_133_1374	391
55	3300009147	Ga0114129_10002730	Ga0114129_100027306	392
56	3300009147	Ga0114129_10034566	Ga0114129_100345664	392
57	3300050507	nmdc:mga05p37_112187_c1	nmdc:mga05p37_112187_c1_395_1735	392
58	3300005518	Ga0070699_100002827	Ga0070699_1000028279	393
59	3300013105	Ga0157369_10094394	Ga0157369_100943941	394
60	3300034820	Ga0373959_0012229	Ga0373959_0012229_182_1438	394
61	3300037418	Ga0395900_0029758	Ga0395900_0029758_4190_5518	394
62	3300037471	Ga0395905_0079096	Ga0395905_0079096_727_2055	394
63	3300025913	Ga0207695_10153770	Ga0207695_101537701	395
64	3300025921	Ga0207652_10083713	Ga0207652_100837132	395
65	3300045976	Ga0466967_0245082	Ga0466967_0245082_237_1580	395
66	3300005468	Ga0070707_100129582	Ga0070707_1001295822	396
67	3300005536	Ga0070697_100110776	Ga0070697_1001107762	396
68	3300005985	Ga0081539_10013466	Ga0081539_100134664	396
69	3300037312	Ga0395899_0094484	Ga0395899_0094484_749_2077	396
70	3300037418	Ga0395900_0091091	Ga0395900_0091091_1195_2523	396
71	3300038443	Ga0395901_0016335	Ga0395901_0016335_5038_6366	396
72	3300045976	Ga0466967_0173967	Ga0466967_0173967_123_1394	396
73	3300005336	Ga0070680_100000384	Ga0070680_10000038416	397
74	3300005336	Ga0070680_100102557	Ga0070680_1001025572	397
75	3300005353	Ga0070669_100036775	Ga0070669_1000367753	397
76	3300005439	Ga0070711_100012252	Ga0070711_1000122526	397
77	3300005530	Ga0070679_100000495	Ga0070679_1000004958	397
78	3300005616	Ga0068852_100050771	Ga0068852_1000507714	397
79	3300009093	Ga0105240_10100484	Ga0105240_101004843	397
80	3300013307	Ga0157372_10036692	Ga0157372_100366924	397
81	3300025912	Ga0207707_10056654	Ga0207707_100566543	397
82	3300025917	Ga0207660_10000603	Ga0207660_100006036	397
83	3300025921	Ga0207652_10010487	Ga0207652_100104872	397
84	3300025921	Ga0207652_10195580	Ga0207652_101955801	397
85	3300025927	Ga0207687_10010223	Ga0207687_100102236	397
86	3300031852	Ga0307410_10038505	Ga0307410_100385053	397
87	3300031995	Ga0307409_100100765	Ga0307409_1001007651	397
88	3300035083	Ga0373926_0008779	Ga0373926_0008779_1660_2922	397
89	3300035120	Ga0373957_0040408	Ga0373957_0040408_441_1703	397
90	3300035695	Ga0373927_0001716	Ga0373927_0001716_2635_3897	397
91	3300035725	Ga0373947_0009977	Ga0373947_0009977_1774_3036	397
92	3300036401	Ga0373937_0000569	Ga0373937_0000569_15639_16901	397
93	3300037068	Ga0373925_0017592	Ga0373925_0017592_1600_2862	397
94	3300037418	Ga0395900_0106498	Ga0395900_0106498_1147_2466	397
95	3300037466	Ga0395898_0132300	Ga0395898_0132300_119_1438	397
96	3300044694	Ga0466963_0010123	Ga0466963_0010123_3805_5070	397
97	3300046679	Ga0495623_0022991	Ga0495623_0022991_393_1655	397
98	3300047444	Ga0495675_0156723	Ga0495675_0156723_113_1378	397
99	3300050512	nmdc:mga0n895_236936_c1	nmdc:mga0n895_236936_c1_58_1320	397
100	3300005468	Ga0070707_100130786	Ga0070707_1001307862	398
101	3300005564	Ga0070664_100047423	Ga0070664_1000474232	398
102	3300025945	Ga0207679_10035318	Ga0207679_100353182	398
103	3300045976	Ga0466967_0142226	Ga0466967_0142226_639_1913	398
104	3300005341	Ga0070691_10000966	Ga0070691_100009665	399
105	3300005539	Ga0068853_100023480	Ga0068853_1000234803	399
106	3300005577	Ga0068857_100002400	Ga0068857_1000024005	399
107	3300005578	Ga0068854_100029092	Ga0068854_1000290923	399
108	3300005834	Ga0068851_10013119	Ga0068851_100131194	399
109	3300009093	Ga0105240_10079641	Ga0105240_100796413	399
110	3300009545	Ga0105237_10061054	Ga0105237_100610542	399
111	3300009551	Ga0105238_10056727	Ga0105238_100567273	399
112	3300013307	Ga0157372_10128244	Ga0157372_101282442	399
113	3300014326	Ga0157380_10025023	Ga0157380_100250232	399
114	3300025321	Ga0207656_10041300	Ga0207656_100413002	399
115	3300025904	Ga0207647_10001452	Ga0207647_100014522	399
116	3300025909	Ga0207705_10008203	Ga0207705_100082037	399
117	3300025919	Ga0207657_10005161	Ga0207657_100051614	399
118	3300025924	Ga0207694_10020241	Ga0207694_100202413	399
119	3300025932	Ga0207690_10003663	Ga0207690_100036634	399
120	3300025933	Ga0207706_10122383	Ga0207706_101223833	399
121	3300025949	Ga0207667_10002705	Ga0207667_1000270513	399
122	3300026041	Ga0207639_10042460	Ga0207639_100424603	399
123	3300026067	Ga0207678_10041259	Ga0207678_100412593	399
124	3300026116	Ga0207674_10005725	Ga0207674_1000572510	399
125	3300050510	nmdc:mga06r32_265163_c1	nmdc:mga06r32_265163_c1_20_1288	399
126	3300009148	Ga0105243_10170323	Ga0105243_101703232	400
127	3300037312	Ga0395899_0015046	Ga0395899_0015046_912_2192	400
128	3300038443	Ga0395901_0017066	Ga0395901_0017066_5336_6616	400
129	3300047445	Ga0495677_0010754	Ga0495677_0010754_982_2319	400
130	3300005329	Ga0070683_100209656	Ga0070683_1002096562	401
131	3300005335	Ga0070666_10000853	Ga0070666_100008538	401
132	3300005336	Ga0070680_100084339	Ga0070680_1000843392	401
133	3300005844	Ga0068862_100124997	Ga0068862_1001249972	401
134	3300009093	Ga0105240_10017562	Ga0105240_100175623	401
135	3300025903	Ga0207680_10007545	Ga0207680_100075453	401
136	3300025917	Ga0207660_10139952	Ga0207660_101399521	401
137	3300025944	Ga0207661_10035311	Ga0207661_100353112	401
138	3300009098	Ga0105245_10043411	Ga0105245_100434113	402
139	3300009147	Ga0114129_10031340	Ga0114129_100313406	402
140	3300048908	Ga0496105_0001364	Ga0496105_0001364_1252_2529	402
141	3300050507	nmdc:mga05p37_151400_c1	nmdc:mga05p37_151400_c1_504_1862	402
142	3300050508	nmdc:mga09592_19027_c1	nmdc:mga09592_19027_c1_3462_4796	402
143	3300021384	Ga0213876_10000031	Ga0213876_1000003129	403
144	3300039437	Ga0436365_0882969	Ga0436365_0882969_34036_35370	403
145	3300009174	Ga0105241_10153740	Ga0105241_101537402	404
146	3300045976	Ga0466967_0019046	Ga0466967_0019046_22_1341	404
147	3300049661	Ga0501217_008696	Ga0501217_008696_258_1589	404
148	3300006847	Ga0075431_100096104	Ga0075431_1000961042	405
149	3300009147	Ga0114129_10222149	Ga0114129_102221492	405
150	3300035725	Ga0373947_0146603	Ga0373947_0146603_58_1398	405
151	3300050509	nmdc:mga0qj67_77943_c1	nmdc:mga0qj67_77943_c1_1026_2339	405
152	3300005564	Ga0070664_100025084	Ga0070664_1000250845	406
153	3300025929	Ga0207664_10055653	Ga0207664_100556532	406
154	3300025945	Ga0207679_10033338	Ga0207679_100333382	406
155	3300045836	Ga0466958_0065920	Ga0466958_0065920_706_1983	406
156	3300046683	Ga0495658_0030203	Ga0495658_0030203_270_1574	406
157	3300050489	nmdc:mga03683_33321_c1	nmdc:mga03683_33321_c1_601_1872	406
158	3300005616	Ga0068852_100005891	Ga0068852_1000058915	407
159	3300026142	Ga0207698_10003528	Ga0207698_100035285	407
160	3300005329	Ga0070683_100021802	Ga0070683_1000218026	408
161	3300005344	Ga0070661_100092609	Ga0070661_1000926092	408
162	3300005467	Ga0070706_100003274	Ga0070706_1000032749	408
163	3300005539	Ga0068853_100165596	Ga0068853_1001655962	408
164	3300005577	Ga0068857_100146653	Ga0068857_1001466532	408
165	3300005719	Ga0068861_100030418	Ga0068861_1000304182	408
166	3300025919	Ga0207657_10018679	Ga0207657_100186794	408
167	3300025920	Ga0207649_10042898	Ga0207649_100428982	408
168	3300026041	Ga0207639_10053757	Ga0207639_100537573	408
169	3300026116	Ga0207674_10014471	Ga0207674_100144719	408
170	3300026118	Ga0207675_100046717	Ga0207675_1000467172	408
171	3300047317	Ga0495604_0010356	Ga0495604_0010356_2863_4158	408
172	3300053077	Ga0495601_0007188	Ga0495601_0007188_3006_4301	408
173	3300005327	Ga0070658_10067341	Ga0070658_100673412	409
174	3300005471	Ga0070698_100000714	Ga0070698_10000071424	409
175	3300006173	Ga0070716_100019402	Ga0070716_1000194022	409
176	3300025939	Ga0207665_10027844	Ga0207665_100278442	409
177	3300025941	Ga0207711_10103298	Ga0207711_101032982	409
178	3300039447	Ga0436361_0327584	Ga0436361_0327584_797_2098	409
179	3300048915	Ga0496112_0007469	Ga0496112_0007469_6322_7653	409
180	3300005466	Ga0070685_10001726	Ga0070685_100017267	410
181	3300005536	Ga0070697_100000498	Ga0070697_10000049820	410
182	3300037466	Ga0395898_0224782	Ga0395898_0224782_85_1368	410
183	3300047444	Ga0495675_0059060	Ga0495675_0059060_736_2043	410
184	3300005331	Ga0070670_100067723	Ga0070670_1000677233	411
185	3300005336	Ga0070680_100005554	Ga0070680_1000055545	411
186	3300025917	Ga0207660_10042533	Ga0207660_100425332	411
187	3300044694	Ga0466963_0031778	Ga0466963_0031778_192_1478	411
188	3300048915	Ga0496112_0034805	Ga0496112_0034805_358_1668	411
189	3300048916	Ga0496113_0061177	Ga0496113_0061177_250_1560	411
190	3300005345	Ga0070692_10087702	Ga0070692_100877021	412
191	3300005617	Ga0068859_100097292	Ga0068859_1000972922	412
192	3300005844	Ga0068862_100174565	Ga0068862_1001745652	412
193	3300006931	Ga0097620_100097289	Ga0097620_1000972892	412
194	3300014326	Ga0157380_10039167	Ga0157380_100391674	412
195	3300031995	Ga0307409_100010609	Ga0307409_1000106095	412
196	3300032005	Ga0307411_10061433	Ga0307411_100614332	412
197	3300005547	Ga0070693_100006808	Ga0070693_1000068085	413
198	3300005548	Ga0070665_100000265	Ga0070665_10000026559	413
199	3300005617	Ga0068859_100108273	Ga0068859_1001082732	413
200	3300005843	Ga0068860_100003985	Ga0068860_1000039856	413
201	3300006931	Ga0097620_100108270	Ga0097620_1001082702	413
202	3300009177	Ga0105248_10148915	Ga0105248_101489152	413
203	3300013100	Ga0157373_10008548	Ga0157373_100085483	413
204	3300013297	Ga0157378_10000922	Ga0157378_100009229	413
205	3300013306	Ga0163162_10023035	Ga0163162_100230356	413
206	3300025913	Ga0207695_10298511	Ga0207695_102985112	413
207	3300025941	Ga0207711_10016086	Ga0207711_100160862	413
208	3300028379	Ga0268266_10001881	Ga0268266_1000188121	413
209	3300028381	Ga0268264_10004293	Ga0268264_100042932	413
210	3300044693	Ga0466961_0002409	Ga0466961_0002409_625_1989	413
211	3300048905	Ga0496102_0005962	Ga0496102_0005962_130_1443	413
212	3300048909	Ga0496106_0019022	Ga0496106_0019022_1804_3117	413
213	3300048915	Ga0496112_0097122	Ga0496112_0097122_1007_2320	413
214	3300005841	Ga0068863_100027190	Ga0068863_1000271902	414
215	3300005841	Ga0068863_100147375	Ga0068863_1001473752	414
216	3300013105	Ga0157369_10001722	Ga0157369_1000172216	414
217	3300026088	Ga0207641_10012662	Ga0207641_100126626	414
218	3300028654	Ga0265322_10000184	Ga0265322_1000018418	414
219	3300028800	Ga0265338_10048199	Ga0265338_100481992	414
220	3300031240	Ga0265320_10010444	Ga0265320_100104443	414
221	3300031595	Ga0265313_10037332	Ga0265313_100373322	414
222	3300036401	Ga0373937_0007336	Ga0373937_0007336_7000_8331	414
223	3300049571	Ga0501034_0200191	Ga0501034_0200191_286_1608	414
224	3300053085	Ga0495619_0002004	Ga0495619_0002004_8579_9910	414
225	3300005337	Ga0070682_100061260	Ga0070682_1000612602	415
226	3300005457	Ga0070662_100042776	Ga0070662_1000427762	415
227	3300005458	Ga0070681_10002906	Ga0070681_100029064	415
228	3300005539	Ga0068853_100006076	Ga0068853_1000060766	415
229	3300005564	Ga0070664_100004040	Ga0070664_1000040405	415
230	3300005577	Ga0068857_100043885	Ga0068857_1000438852	415
231	3300013100	Ga0157373_10023438	Ga0157373_100234385	415
232	3300013307	Ga0157372_10015552	Ga0157372_100155522	415
233	3300025933	Ga0207706_10045614	Ga0207706_100456143	415
234	3300026041	Ga0207639_10006885	Ga0207639_100068855	415
235	3300026116	Ga0207674_10110791	Ga0207674_101107912	415
236	3300036401	Ga0373937_0110624	Ga0373937_0110624_1150_2478	415
237	3300037466	Ga0395898_0016301	Ga0395898_0016301_3837_5174	415
238	3300037471	Ga0395905_0009372	Ga0395905_0009372_6922_8250	415
239	3300046472	Ga0495580_0004829	Ga0495580_0004829_3822_5138	415
240	3300046529	Ga0495652_0075553	Ga0495652_0075553_750_2066	415
241	3300047471	Ga0495684_0003519	Ga0495684_0003519_3014_4330	415
242	3300048088	Ga0495602_0024460	Ga0495602_0024460_1607_2923	415
243	3300005327	Ga0070658_10124625	Ga0070658_101246252	416
244	3300005436	Ga0070713_100010301	Ga0070713_1000103014	416
245	3300005439	Ga0070711_100021487	Ga0070711_1000214873	416
246	3300005441	Ga0070700_100135282	Ga0070700_1001352821	416
247	3300035692	Ga0373935_0041618	Ga0373935_0041618_84_1400	416
248	3300035695	Ga0373927_0030541	Ga0373927_0030541_1332_2657	416
249	3300036401	Ga0373937_0028276	Ga0373937_0028276_584_1900	416
250	3300037418	Ga0395900_0104921	Ga0395900_0104921_329_1690	416
251	3300044673	Ga0453683_0035530	Ga0453683_0035530_1259_2614	416
252	3300053129	Ga0500628_000418	Ga0500628_000418_2526_3875	416
253	3300005435	Ga0070714_100013043	Ga0070714_1000130433	417
254	3300005535	Ga0070684_100015605	Ga0070684_1000156053	417
255	3300006914	Ga0075436_100039587	Ga0075436_1000395872	417
256	3300021384	Ga0213876_10000160	Ga0213876_1000016033	417
257	3300039437	Ga0436365_1621207	Ga0436365_1621207_107593_108927	417
258	3300048913	Ga0496110_0084853	Ga0496110_0084853_812_2131	417
259	3300050512	nmdc:mga0n895_13809_c1	nmdc:mga0n895_13809_c1_3234_4553	417
260	3300005467	Ga0070706_100000012	Ga0070706_100000012204	418
261	3300005471	Ga0070698_100055982	Ga0070698_1000559822	418
262	3300005539	Ga0068853_100067376	Ga0068853_1000673762	418
263	3300006028	Ga0070717_10139549	Ga0070717_101395492	418
264	3300006163	Ga0070715_10008538	Ga0070715_100085382	418
265	3300009093	Ga0105240_10220697	Ga0105240_102206972	418
266	3300009148	Ga0105243_10020783	Ga0105243_100207833	418
267	3300009176	Ga0105242_10146375	Ga0105242_101463752	418
268	3300009551	Ga0105238_10135567	Ga0105238_101355672	418
269	3300013100	Ga0157373_10017790	Ga0157373_100177904	418
270	3300013105	Ga0157369_10018713	Ga0157369_100187134	418
271	3300021361	Ga0213872_10006081	Ga0213872_100060817	418
272	3300025910	Ga0207684_10000028	Ga0207684_10000028325	418
273	3300025916	Ga0207663_10126850	Ga0207663_101268502	418
274	3300025920	Ga0207649_10015240	Ga0207649_100152405	418
275	3300025935	Ga0207709_10058866	Ga0207709_100588661	418
276	3300025939	Ga0207665_10078831	Ga0207665_100788312	418
277	3300026041	Ga0207639_10007623	Ga0207639_100076236	418
278	3300035410	Ga0373924_0000058	Ga0373924_0000058_8055_9395	418
279	3300035692	Ga0373935_0000413	Ga0373935_0000413_2372_3712	418
280	3300035695	Ga0373927_0011274	Ga0373927_0011274_2276_3616	418
281	3300035725	Ga0373947_0014191	Ga0373947_0014191_165_1505	418
282	3300037068	Ga0373925_0099121	Ga0373925_0099121_604_1944	418
283	3300039447	Ga0436361_0002110	Ga0436361_0002110_16670_18007	418
284	3300044842	Ga0466957_0000088	Ga0466957_0000088_19284_20693	418
285	3300046473	Ga0495582_0049120	Ga0495582_0049120_797_2137	418
286	3300046511	Ga0495608_0075342	Ga0495608_0075342_92_1432	418
287	3300046531	Ga0495665_0059223	Ga0495665_0059223_246_1586	418
288	3300046684	Ga0495669_0021077	Ga0495669_0021077_527_1879	418
289	3300047320	Ga0495672_0074995	Ga0495672_0074995_365_1780	418
290	3300048907	Ga0496104_0091679	Ga0496104_0091679_104_1636	418
291	3300048916	Ga0496113_0003466	Ga0496113_0003466_1959_3299	418
292	3300048916	Ga0496113_0039770	Ga0496113_0039770_1800_3140	418
293	3300005985	Ga0081539_10001840	Ga0081539_100018408	419
294	3300013104	Ga0157370_10158073	Ga0157370_101580732	419
295	3300014968	Ga0157379_10012979	Ga0157379_100129794	419
296	3300037471	Ga0395905_0002082	Ga0395905_0002082_181_1680	419
297	3300049585	Ga0501069_0009717	Ga0501069_0009717_1144_2460	419
298	3300005334	Ga0068869_100048112	Ga0068869_1000481122	420
299	3300005548	Ga0070665_100000495	Ga0070665_10000049524	420
300	3300005617	Ga0068859_100020895	Ga0068859_1000208953	420
301	3300006931	Ga0097620_100020896	Ga0097620_1000208963	420
302	3300028379	Ga0268266_10000187	Ga0268266_1000018783	420
303	3300005577	Ga0068857_100026484	Ga0068857_1000264842	421
304	3300005339	Ga0070660_100093480	Ga0070660_1000934802	422
305	3300005437	Ga0070710_10019990	Ga0070710_100199902	423
306	3300025949	Ga0207667_10038716	Ga0207667_100387165	423
307	3300028380	Ga0268265_10060759	Ga0268265_100607592	423
308	3300031824	Ga0307413_10014089	Ga0307413_100140892	423
309	3300031852	Ga0307410_10017696	Ga0307410_100176962	423
310	3300031995	Ga0307409_100007636	Ga0307409_1000076367	423
311	3300032005	Ga0307411_10072011	Ga0307411_100720112	423
312	3300037466	Ga0395898_0136416	Ga0395898_0136416_968_2296	423
313	3300037471	Ga0395905_0063243	Ga0395905_0063243_679_2010	423
314	3300037471	Ga0395905_0078059	Ga0395905_0078059_125_1453	423
315	3300038443	Ga0395901_0162820	Ga0395901_0162820_54_1382	423
316	3300045976	Ga0466967_0254923	Ga0466967_0254923_68_1396	423
317	3300005293	Ga0065715_10116660	Ga0065715_101166602	424
318	3300005435	Ga0070714_100157375	Ga0070714_1001573752	424
319	3300013104	Ga0157370_10101284	Ga0157370_101012842	424
320	3300025901	Ga0207688_10005020	Ga0207688_100050206	424
321	3300025932	Ga0207690_10058864	Ga0207690_100588642	424
322	3300025949	Ga0207667_10167836	Ga0207667_101678362	424
323	3300026142	Ga0207698_10221460	Ga0207698_102214602	424
324	3300028379	Ga0268266_10047250	Ga0268266_100472502	424
325	3300037418	Ga0395900_0002008	Ga0395900_0002008_3571_4911	424
326	3300037466	Ga0395898_0234684	Ga0395898_0234684_12_1352	424
327	3300037471	Ga0395905_0000218	Ga0395905_0000218_9243_10583	424
328	3300037471	Ga0395905_0237264	Ga0395905_0237264_52_1380	424
329	3300038443	Ga0395901_0002884	Ga0395901_0002884_7876_9216	424
330	3300039437	Ga0436365_1352252	Ga0436365_1352252_159_1490	424
331	3300005328	Ga0070676_10020752	Ga0070676_100207522	425
332	3300005347	Ga0070668_100018349	Ga0070668_1000183496	425
333	3300005353	Ga0070669_100031918	Ga0070669_1000319184	425
334	3300005364	Ga0070673_100065928	Ga0070673_1000659283	425
335	3300005367	Ga0070667_100060400	Ga0070667_1000604001	425
336	3300005564	Ga0070664_100182288	Ga0070664_1001822882	425
337	3300005617	Ga0068859_100127913	Ga0068859_1001279132	425
338	3300005843	Ga0068860_100002325	Ga0068860_10000232511	425
339	3300005844	Ga0068862_100018881	Ga0068862_1000188813	425
340	3300006358	Ga0068871_100045287	Ga0068871_1000452873	425
341	3300006881	Ga0068865_100127731	Ga0068865_1001277312	425
342	3300006931	Ga0097620_100127913	Ga0097620_1001279132	425
343	3300013308	Ga0157375_10021468	Ga0157375_100214685	425
344	3300025907	Ga0207645_10008994	Ga0207645_1000899410	425
345	3300025938	Ga0207704_10052478	Ga0207704_100524782	425
346	3300025942	Ga0207689_10141706	Ga0207689_101417062	425
347	3300025960	Ga0207651_10005717	Ga0207651_1000571710	425
348	3300025972	Ga0207668_10000021	Ga0207668_1000002178	425
349	3300025986	Ga0207658_10005047	Ga0207658_100050474	425
350	3300026118	Ga0207675_100095000	Ga0207675_1000950003	425
351	3300028380	Ga0268265_10000789	Ga0268265_1000078925	425
352	3300028381	Ga0268264_10002322	Ga0268264_1000232211	425
353	3300037312	Ga0395899_0023950	Ga0395899_0023950_202_1536	425
354	3300037418	Ga0395900_0040442	Ga0395900_0040442_2965_4299	425
355	3300037418	Ga0395900_0192452	Ga0395900_0192452_326_1660	425
356	3300037471	Ga0395905_0010977	Ga0395905_0010977_3028_4362	425
357	3300037471	Ga0395905_0054053	Ga0395905_0054053_1677_3011	425
358	3300005548	Ga0070665_100000995	Ga0070665_10000099528	426
359	3300025913	Ga0207695_10234641	Ga0207695_102346412	426
360	3300025928	Ga0207700_10215643	Ga0207700_102156432	426
361	3300028379	Ga0268266_10000318	Ga0268266_1000031814	426
362	3300037418	Ga0395900_0186074	Ga0395900_0186074_194_1528	426
363	3300037471	Ga0395905_0111552	Ga0395905_0111552_1088_2425	426
364	3300038443	Ga0395901_0181244	Ga0395901_0181244_298_1632	426
365	3300001979	JGI24740J21852_10004254	JGI24740J21852_100042545	427
366	3300001989	JGI24739J22299_10001795	JGI24739J22299_100017956	427
367	3300001989	JGI24739J22299_10002106	JGI24739J22299_100021068	427
368	3300001990	JGI24737J22298_10000419	JGI24737J22298_1000041912	427
369	3300002075	JGI24738J21930_10000456	JGI24738J21930_100004564	427
370	3300005327	Ga0070658_10065055	Ga0070658_100650552	427
371	3300005328	Ga0070676_10000962	Ga0070676_100009625	427
372	3300005331	Ga0070670_100058462	Ga0070670_1000584622	427
373	3300005334	Ga0068869_100000249	Ga0068869_10000024931	427
374	3300005338	Ga0068868_100000113	Ga0068868_10000011332	427
375	3300005339	Ga0070660_100023068	Ga0070660_1000230683	427
376	3300005339	Ga0070660_100025786	Ga0070660_1000257862	427
377	3300005347	Ga0070668_100168602	Ga0070668_1001686021	427
378	3300005353	Ga0070669_100000155	Ga0070669_10000015543	427
379	3300005355	Ga0070671_100003933	Ga0070671_1000039332	427
380	3300005355	Ga0070671_100007800	Ga0070671_1000078008	427
381	3300005364	Ga0070673_100000177	Ga0070673_10000017721	427
382	3300005366	Ga0070659_100000305	Ga0070659_1000003053	427
383	3300005366	Ga0070659_100016610	Ga0070659_1000166102	427
384	3300005367	Ga0070667_100002102	Ga0070667_1000021023	427
385	3300005457	Ga0070662_100000133	Ga0070662_10000013331	427
386	3300005459	Ga0068867_100001645	Ga0068867_1000016458	427
387	3300005459	Ga0068867_100001817	Ga0068867_10000181712	427
388	3300005539	Ga0068853_100001365	Ga0068853_1000013656	427
389	3300005543	Ga0070672_100000437	Ga0070672_10000043720	427
390	3300005563	Ga0068855_100000753	Ga0068855_10000075331	427
391	3300005577	Ga0068857_100004566	Ga0068857_10000456612	427
392	3300005578	Ga0068854_100000206	Ga0068854_10000020613	427
393	3300005614	Ga0068856_100079969	Ga0068856_1000799693	427
394	3300005616	Ga0068852_100004086	Ga0068852_1000040862	427
395	3300005617	Ga0068859_100001723	Ga0068859_10000172316	427
396	3300005617	Ga0068859_100081118	Ga0068859_1000811183	427
397	3300005618	Ga0068864_100000428	Ga0068864_10000042819	427
398	3300005841	Ga0068863_100000634	Ga0068863_10000063438	427
399	3300005842	Ga0068858_100002105	Ga0068858_10000210519	427
400	3300005842	Ga0068858_100118340	Ga0068858_1001183403	427
401	3300005843	Ga0068860_100008486	Ga0068860_1000084866	427
402	3300005844	Ga0068862_100056723	Ga0068862_1000567233	427
403	3300006177	Ga0075362_10033722	Ga0075362_100337222	427
404	3300006881	Ga0068865_100002437	Ga0068865_1000024376	427
405	3300006931	Ga0097620_100001723	Ga0097620_10000172316	427
406	3300006931	Ga0097620_100081118	Ga0097620_1000811183	427
407	3300009098	Ga0105245_10000325	Ga0105245_1000032510	427
408	3300009177	Ga0105248_10001472	Ga0105248_1000147229	427
409	3300009551	Ga0105238_10053333	Ga0105238_100533333	427
410	3300013100	Ga0157373_10028364	Ga0157373_100283645	427
411	3300013297	Ga0157378_10000385	Ga0157378_1000038511	427
412	3300013307	Ga0157372_10004258	Ga0157372_1000425810	427
413	3300014745	Ga0157377_10031669	Ga0157377_100316693	427
414	3300025315	Ga0207697_10000109	Ga0207697_1000010931	427
415	3300025901	Ga0207688_10000437	Ga0207688_100004373	427
416	3300025903	Ga0207680_10025830	Ga0207680_100258302	427
417	3300025904	Ga0207647_10000999	Ga0207647_100009995	427
418	3300025907	Ga0207645_10001179	Ga0207645_100011798	427
419	3300025923	Ga0207681_10042235	Ga0207681_100422353	427
420	3300025924	Ga0207694_10067683	Ga0207694_100676833	427
421	3300025927	Ga0207687_10010009	Ga0207687_100100095	427
422	3300025929	Ga0207664_10124160	Ga0207664_101241602	427
423	3300025931	Ga0207644_10136233	Ga0207644_101362332	427
424	3300025933	Ga0207706_10000300	Ga0207706_1000030031	427
425	3300025940	Ga0207691_10000294	Ga0207691_1000029432	427
426	3300025942	Ga0207689_10000900	Ga0207689_1000090031	427
427	3300025949	Ga0207667_10099668	Ga0207667_100996683	427
428	3300025972	Ga0207668_10042469	Ga0207668_100424693	427
429	3300025981	Ga0207640_10000884	Ga0207640_1000088415	427
430	3300026035	Ga0207703_10007475	Ga0207703_100074759	427
431	3300026035	Ga0207703_10049055	Ga0207703_100490552	427
432	3300026041	Ga0207639_10041873	Ga0207639_100418733	427
433	3300026067	Ga0207678_10014225	Ga0207678_100142256	427
434	3300026088	Ga0207641_10032090	Ga0207641_100320902	427
435	3300026089	Ga0207648_10001537	Ga0207648_100015378	427
436	3300026089	Ga0207648_10008749	Ga0207648_100087497	427
437	3300026095	Ga0207676_10000492	Ga0207676_1000049236	427
438	3300026116	Ga0207674_10001709	Ga0207674_1000170910	427
439	3300026118	Ga0207675_100079959	Ga0207675_1000799592	427
440	3300026142	Ga0207698_10054544	Ga0207698_100545442	427
441	3300026142	Ga0207698_10123140	Ga0207698_101231402	427
442	3300035111	Ga0373923_0010101	Ga0373923_0010101_1830_3164	427
443	3300035120	Ga0373957_0005111	Ga0373957_0005111_878_2212	427
444	3300036401	Ga0373937_0018974	Ga0373937_0018974_2186_3520	427
445	3300037418	Ga0395900_0007137	Ga0395900_0007137_9036_10376	427
446	3300037418	Ga0395900_0079058	Ga0395900_0079058_607_1947	427
447	3300037471	Ga0395905_0061120	Ga0395905_0061120_392_1738	427
448	3300038443	Ga0395901_0208327	Ga0395901_0208327_263_1600	427
449	3300038443	Ga0395901_0243794	Ga0395901_0243794_185_1525	427
450	3300042157	Ga0439458_0000393	Ga0439458_0000393_3490_4830	427
451	3300044684	Ga0466966_0046264	Ga0466966_0046264_150_1484	427
452	3300044901	Ga0466960_0083537	Ga0466960_0083537_184_1524	427
453	3300045976	Ga0466967_0165138	Ga0466967_0165138_487_1833	427
454	3300046528	Ga0495642_0024326	Ga0495642_0024326_954_2294	427

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

88

506

0.87 PF13520

AA_permease_2

Amino acid permease

84

503

0.85 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6f2g-assembly1.cif.gz_A	bacterial asc transporter crystal structure in open to in conformation	0.9049	17	412
6li9-assembly1.cif.gz_B	heteromeric amino acid transporter b0,+at-rbat complex bound with arginine	0.8909	15	409
5oqt-assembly1.cif.gz_A	crystal structure of a bacterial cationic amino acid transporter (cat) homologue	0.8887	12	409
7dsk-assembly1.cif.gz_B	overall structure of the lat1-4f2hc bound with jx-075	0.8837	10	409
7p9v-assembly1.cif.gz_B	cryo em structure of system xc-	0.8814	17	409

ID	Description	Score	Start	End	Superfamily
af_Q50E62_26_473_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.929	11	408	1.20.1740.10
af_Q8IR48_79_518_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9154	11	408	1.20.1740.10
af_P71892_30_474_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9092	11	409	1.20.1740.10
af_Q9Y1A7_38_480_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9092	11	411	1.20.1740.10
af_Q2G1Y2_23_478_1.20.1740.10	Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I	0.9087	11	408	1.20.1740.10

ID	Description	Score	Start	End	GO Terms
AF-U1Q4E6-F1-model_v4	Amino acid transporter	0.9348	8	409	GO:0016020 GO:0055085
AF-A0A7C1ECS2-F1-model_v4	Amino acid permease	0.9154	7	410	GO:0005886 GO:0022857
AF-A0A0R2NSN2-F1-model_v4	Amino acid transport protein	0.9152	11	408	GO:0015171 GO:0016020
AF-A0A3L7PR48-F1-model_v4	Amino acid permease	0.9141	9	408	GO:0005886 GO:0015179
AF-A0A2V5X0I7-F1-model_v4	Amino acid permease	0.9124	16	409	GO:0015171 GO:0016020

Feature Viewer

pLDDT	pTM	Quality
84.65	0.84	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F447380

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00324

AA_permease

Amino acid permease

88

506

0.87

PF13520

AA_permease_2

Amino acid permease

84

503

0.85

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map