F447367

General Info

Members Datasets Scaffolds Average Seq Length
454 245 440 328

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10008475|Ga0099795_100084752
Length 382
Sequence MMVEHPRNGRRHHADAAKTSRPPRTKVADLVLSGGGVKGIGLVGAVVALMEAGYRIGRISGTSAGAVRGEQLTGAQLKEIALSLPYRKFLDPVSAATVPVLGTAWAALRGRGIYRGDFIHDWVESELRTLGVRTFGDLAIDDPDLPAEQRYRLVVTVADVTRGHLVRLPWDYRRLYGLDPDEQPVADAVRASMAIPFFFRPVTLTSAAGSTSTLIDGGLLSNFPMYSLDRTDGKPPRWPSFGITVMTQHPAQGDGDPAPGLAPLIHLPGAPQLLEAIVNTALLGHDQTYLTQPAVTARTIAVDSSGIGYLNFNISHVDREKLYDKGYEAAQKFLTTWNWPAHLKRFHPESAADSLLNHTRQSTKAHRCVSGPRDGNVANRRA

Samples

Sample ID Description Type Environment
1 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
2 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
3 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
4 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
5 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
6 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
7 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
8 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
9 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
10 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
11 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
12 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
13 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
14 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
15 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
19 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
162 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
163 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
169 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
214 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0.22
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.91
Nodule 0
Rhizoplane 12.78
Rhizosphere 66.96
Stem 0
Stem Tuber 0
Unclassified 10.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10009306 3300001991 Unclassified 1738
2 JGI24738J21930_10008451 3300002075 Unclassified 2343
3 JGI24744J21845_10014071 3300002077 Bacteria 1610
4 JGI24034J26672_10001513 3300002239 Bacteria 3092
5 JGI24742J22300_10000680 3300002244 Bacteria 5114
6 rootH2_10039752 3300003320 Bacteria 4700
7 Ga0055540_1000219 3300003792 Bacteria 54071
8 Ga0055540_1000684 3300003792 Bacteria 23433
9 Ga0055540_1004584 3300003792 Bacteria 6144
10 Ga0070676_10073979 3300005328 Bacteria 2051
11 Ga0070690_100033606 3300005330 Bacteria 3212
12 Ga0068869_100052470 3300005334 Bacteria 2961
13 Ga0068869_100147387 3300005334 Bacteria 1822
14 Ga0070666_10009031 3300005335 Bacteria 6209
15 Ga0070666_10023841 3300005335 Bacteria 3984
16 Ga0070682_100053844 3300005337 Bacteria 2523
17 Ga0068868_100025757 3300005338 Bacteria 4477
18 Ga0068868_100223457 3300005338 Bacteria 1577
19 Ga0070660_100307346 3300005339 Bacteria 1301
20 Ga0070689_100025992 3300005340 Bacteria 4403
21 Ga0070691_10064799 3300005341 Bacteria 1763
22 Ga0070668_100000783 3300005347 Bacteria 21957
23 Ga0070668_100050820 3300005347 Bacteria 3192
24 Ga0070668_100154434 3300005347 Bacteria 1859
25 Ga0070668_100359159 3300005347 Bacteria 1235
26 Ga0070669_100004939 3300005353 Bacteria 9634
27 Ga0070669_100019437 3300005353 Bacteria 4852
28 Ga0070671_100020153 3300005355 Bacteria 5435
29 Ga0070674_100015164 3300005356 Bacteria 4806
30 Ga0070673_100065544 3300005364 Bacteria 2898
31 Ga0070688_100020213 3300005365 Bacteria 3869
32 Ga0070659_100009223 3300005366 Bacteria 7242
33 Ga0070667_100000073 3300005367 Bacteria 122757
34 Ga0070667_100004426 3300005367 Bacteria 11853
35 Ga0070667_100010309 3300005367 Bacteria 7722
36 Ga0070710_10067005 3300005437 Bacteria 2059
37 Ga0070701_10000316 3300005438 Bacteria 15817
38 Ga0070711_100008474 3300005439 Bacteria 6298
39 Ga0070711_100019414 3300005439 Bacteria 4360
40 Ga0070711_100159634 3300005439 Bacteria 1708
41 Ga0070705_100003071 3300005440 Bacteria 8227
42 Ga0070700_100006412 3300005441 Bacteria 6292
43 Ga0070694_100032592 3300005444 Bacteria 3422
44 Ga0070663_100024308 3300005455 Bacteria 4075
45 Ga0070678_100007614 3300005456 Bacteria 6433
46 Ga0070662_100015309 3300005457 Bacteria 5135
47 Ga0068867_100001555 3300005459 Bacteria 15936
48 Ga0070685_10097639 3300005466 Bacteria 1789
49 Ga0068853_100112623 3300005539 Bacteria 2418
50 Ga0068853_100283828 3300005539 Bacteria 1526
51 Ga0070686_100120725 3300005544 Bacteria 1799
52 Ga0070695_100014218 3300005545 Bacteria 4796
53 Ga0070695_100035376 3300005545 Bacteria 3138
54 Ga0070696_100009528 3300005546 Bacteria 6500
55 Ga0070696_100040044 3300005546 Bacteria 3235
56 Ga0070693_100033011 3300005547 Bacteria 2853
57 Ga0070665_100004535 3300005548 Bacteria 14551
58 Ga0070665_100006701 3300005548 Bacteria 11708
59 Ga0070665_100084982 3300005548 Bacteria 3169
60 Ga0070665_100415112 3300005548 Bacteria 1355
61 Ga0070704_100007683 3300005549 Bacteria 6426
62 Ga0068855_100507305 3300005563 Bacteria 1310
63 Ga0068854_100007657 3300005578 Bacteria 6906
64 Ga0070702_100000825 3300005615 Bacteria 11899
65 Ga0068852_100370676 3300005616 Bacteria 1403
66 Ga0068859_100000223 3300005617 Bacteria 56082
67 Ga0068859_100008058 3300005617 Bacteria 10681
68 Ga0068866_10001954 3300005718 Bacteria 8593
69 Ga0068866_10079903 3300005718 Bacteria 1753
70 Ga0068861_100011981 3300005719 Bacteria 6039
71 Ga0068863_100003366 3300005841 Bacteria 15781
72 Ga0068863_100012821 3300005841 Bacteria 8084
73 Ga0068863_100161314 3300005841 Bacteria 2148
74 Ga0068858_100025702 3300005842 Bacteria 5478
75 Ga0068860_100000127 3300005843 Bacteria 122766
76 Ga0068860_100026823 3300005843 Bacteria 5551
77 Ga0068860_100111486 3300005843 Bacteria 2616
78 Ga0068862_100000052 3300005844 Bacteria 144622
79 Ga0068862_100002811 3300005844 Bacteria 15253
80 Ga0081455_10041565 3300005937 Bacteria 4041
81 Ga0075365_10000732 3300006038 Bacteria 13274
82 Ga0075365_10001736 3300006038 Bacteria 10114
83 Ga0075365_10142880 3300006038 Bacteria 1662
84 Ga0075363_100002790 3300006048 Bacteria 7252
85 Ga0075363_100010432 3300006048 Bacteria 4413
86 Ga0075363_100045230 3300006048 Bacteria 2334
87 Ga0075364_10000472 3300006051 Bacteria 20463
88 Ga0075364_10008520 3300006051 Bacteria 6134
89 Ga0075364_10029400 3300006051 Bacteria 3524
90 Ga0075364_10077059 3300006051 Bacteria 2201
91 Ga0070715_10007283 3300006163 Bacteria 3805
92 Ga0070716_100008024 3300006173 Bacteria 5227
93 Ga0070716_100109710 3300006173 Bacteria 1707
94 Ga0070712_100000738 3300006175 Bacteria 19307
95 Ga0075362_10112383 3300006177 Bacteria 1283
96 Ga0075369_10002275 3300006186 Bacteria 6823
97 Ga0075369_10002722 3300006186 Bacteria 6340
98 Ga0075369_10017899 3300006186 Bacteria 2880
99 Ga0075369_10033352 3300006186 Bacteria 2182
100 Ga0075369_10080514 3300006186 Bacteria 1444
101 Ga0075369_10094399 3300006186 Bacteria 1337
102 Ga0075370_10021576 3300006353 Bacteria 3529
103 Ga0068871_100185617 3300006358 Bacteria 1789
104 Ga0075428_100255274 3300006844 Bacteria 1889
105 Ga0097620_100000223 3300006931 Bacteria 56082
106 Ga0097620_100008058 3300006931 Bacteria 10681
107 Ga0099795_10008475 3300007788 Bacteria 2934
108 Ga0111539_10673390 3300009094 Bacteria 1205
109 Ga0105245_10003640 3300009098 Bacteria 13755
110 Ga0105245_10010716 3300009098 Bacteria 7976
111 Ga0105245_10866962 3300009098 Bacteria 943
112 Ga0105247_10000066 3300009101 Bacteria 121025
113 Ga0105247_10001100 3300009101 Bacteria 20116
114 Ga0114129_10300348 3300009147 Bacteria 2140
115 Ga0114129_10432253 3300009147 Bacteria 1729
116 Ga0105243_10002917 3300009148 Bacteria 14159
117 Ga0105243_10084335 3300009148 Bacteria 2602
118 Ga0105241_10011800 3300009174 Bacteria 6417
119 Ga0105242_10001265 3300009176 Bacteria 19971
120 Ga0105248_10000144 3300009177 Bacteria 81953
121 Ga0105248_10066282 3300009177 Bacteria 4054
122 Ga0105248_10136840 3300009177 Bacteria 2763
123 Ga0105248_10259322 3300009177 Bacteria 1957
124 Ga0105237_10003772 3300009545 Bacteria 17834
125 Ga0105237_10012754 3300009545 Bacteria 8840
126 Ga0105237_10076052 3300009545 Bacteria 3348
127 Ga0105237_10151394 3300009545 Bacteria 2316
128 Ga0105249_10000093 3300009553 Bacteria 122840
129 Ga0105249_10072970 3300009553 Bacteria 3174
130 Ga0105249_10185759 3300009553 Bacteria 2025
131 Ga0105239_10008803 3300010375 Bacteria 11423
132 Ga0105239_10016589 3300010375 Bacteria 8142
133 Ga0105239_10097720 3300010375 Bacteria 3245
134 Ga0105239_10330967 3300010375 Bacteria 1718
135 Ga0105246_10026437 3300011119 Bacteria 3792
136 Ga0157373_10233127 3300013100 Bacteria 1300
137 Ga0157369_10359965 3300013105 Bacteria 1511
138 Ga0157378_10004665 3300013297 Bacteria 12019
139 Ga0157378_10043286 3300013297 Bacteria 3997
140 Ga0163162_10019654 3300013306 Bacteria 6631
141 Ga0163162_10061486 3300013306 Bacteria 3793
142 Ga0163162_10101332 3300013306 Bacteria 2971
143 Ga0157372_10026589 3300013307 Bacteria 6297
144 Ga0157375_10007227 3300013308 Bacteria 9712
145 Ga0157375_10123178 3300013308 Bacteria 2705
146 Ga0163163_10192939 3300014325 Bacteria 2085
147 Ga0163163_10200711 3300014325 Bacteria 2043
148 Ga0157380_10002330 3300014326 Bacteria 12761
149 Ga0157380_10161326 3300014326 Unclassified 1949
150 Ga0157377_10077314 3300014745 Bacteria 1938
151 Ga0157379_10056144 3300014968 Bacteria 3519
152 Ga0157379_10060728 3300014968 Bacteria 3380
153 Ga0157376_10039793 3300014969 Bacteria 3837
154 Ga0157376_10087590 3300014969 Bacteria 2687
155 Ga0163161_10005500 3300017792 Bacteria 8786
156 Ga0163161_10026591 3300017792 Bacteria 4099
157 Ga0163161_10152648 3300017792 Bacteria 1756
158 Ga0206353_11102129 3300020082 Bacteria 3327
159 Ga0209051_1000116 3300025303 Bacteria 150182
160 Ga0209051_1000558 3300025303 Bacteria 45355
161 Ga0209051_1003583 3300025303 Bacteria 10098
162 Ga0209051_1003747 3300025303 Bacteria 9772
163 Ga0209051_1008038 3300025303 Bacteria 5652
164 Ga0207692_10002051 3300025898 Bacteria 7692
165 Ga0207692_10038058 3300025898 Bacteria 2357
166 Ga0207692_10077281 3300025898 Bacteria 1771
167 Ga0207710_10000090 3300025900 Bacteria 121405
168 Ga0207688_10000932 3300025901 Bacteria 14778
169 Ga0207688_10006744 3300025901 Bacteria 6246
170 Ga0207688_10175677 3300025901 Bacteria 1275
171 Ga0207680_10026619 3300025903 Bacteria 3208
172 Ga0207647_10060935 3300025904 Bacteria 2305
173 Ga0207685_10001541 3300025905 Bacteria 4890
174 Ga0207685_10003524 3300025905 Bacteria 3822
175 Ga0207699_10028146 3300025906 Bacteria 3120
176 Ga0207699_10083177 3300025906 Bacteria 1990
177 Ga0207654_10012646 3300025911 Bacteria 4328
178 Ga0207671_10011278 3300025914 Bacteria 7290
179 Ga0207671_10012944 3300025914 Bacteria 6676
180 Ga0207671_10030440 3300025914 Bacteria 4026
181 Ga0207693_10000428 3300025915 Bacteria 38211
182 Ga0207693_10020194 3300025915 Bacteria 5299
183 Ga0207663_10010841 3300025916 Bacteria 4868
184 Ga0207663_10014290 3300025916 Bacteria 4341
185 Ga0207681_10022549 3300025923 Bacteria 4017
186 Ga0207681_10038725 3300025923 Bacteria 3161
187 Ga0207659_10185859 3300025926 Bacteria 1650
188 Ga0207687_10005219 3300025927 Bacteria 8610
189 Ga0207664_10044495 3300025929 Bacteria 3477
190 Ga0207664_10264493 3300025929 Bacteria 1505
191 Ga0207644_10033096 3300025931 Bacteria 3610
192 Ga0207690_10030986 3300025932 Bacteria 3418
193 Ga0207706_10001922 3300025933 Bacteria 20409
194 Ga0207706_10005781 3300025933 Bacteria 11505
195 Ga0207686_10014184 3300025934 Bacteria 4430
196 Ga0207709_10020928 3300025935 Bacteria 3696
197 Ga0207670_10026966 3300025936 Bacteria 3627
198 Ga0207669_10001245 3300025937 Bacteria 10834
199 Ga0207669_10008434 3300025937 Bacteria 4839
200 Ga0207704_10003885 3300025938 Bacteria 6792
201 Ga0207665_10008506 3300025939 Bacteria 6756
202 Ga0207665_10009244 3300025939 Bacteria 6470
203 Ga0207711_10001782 3300025941 Bacteria 19720
204 Ga0207711_10012635 3300025941 Bacteria 7012
205 Ga0207689_10013017 3300025942 Bacteria 7104
206 Ga0207689_10042995 3300025942 Bacteria 3735
207 Ga0207667_10331745 3300025949 Bacteria 1553
208 Ga0207712_10000073 3300025961 Bacteria 123046
209 Ga0207712_10006710 3300025961 Bacteria 7258
210 Ga0207668_10000804 3300025972 Bacteria 19218
211 Ga0207668_10052848 3300025972 Bacteria 2812
212 Ga0207668_10329182 3300025972 Bacteria 1270
213 Ga0207640_10003619 3300025981 Bacteria 8341
214 Ga0207658_10000304 3300025986 Bacteria 50815
215 Ga0207658_10003086 3300025986 Bacteria 11913
216 Ga0207658_10013038 3300025986 Bacteria 5677
217 Ga0207658_10137421 3300025986 Bacteria 1973
218 Ga0207677_10141016 3300026023 Bacteria 1845
219 Ga0207703_10021877 3300026035 Bacteria 5007
220 Ga0207703_10078735 3300026035 Bacteria 2739
221 Ga0207703_10320682 3300026035 Bacteria 1419
222 Ga0207639_10016205 3300026041 Bacteria 5267
223 Ga0207678_10017039 3300026067 Bacteria 6380
224 Ga0207708_10004070 3300026075 Bacteria 10754
225 Ga0207708_10015261 3300026075 Bacteria 5760
226 Ga0207641_10003816 3300026088 Bacteria 13213
227 Ga0207641_10051538 3300026088 Bacteria 3486
228 Ga0207648_10005092 3300026089 Bacteria 13318
229 Ga0207648_10028388 3300026089 Bacteria 4960
230 Ga0207676_10281952 3300026095 Bacteria 1509
231 Ga0207675_100000876 3300026118 Bacteria 30016
232 Ga0207675_100027583 3300026118 Bacteria 5289
233 Ga0207675_100090491 3300026118 Bacteria 2877
234 Ga0207683_10001137 3300026121 Bacteria 24171
235 Ga0207683_10017031 3300026121 Bacteria 6186
236 Ga0268266_10005255 3300028379 Bacteria 12161
237 Ga0268266_10009396 3300028379 Bacteria 8616
238 Ga0268266_10126869 3300028379 Bacteria 2278
239 Ga0268266_10278495 3300028379 Bacteria 1554
240 Ga0268265_10000063 3300028380 Bacteria 144643
241 Ga0268265_10017748 3300028380 Bacteria 4919
242 Ga0268265_10063049 3300028380 Bacteria 2850
243 Ga0268264_10000007 3300028381 Bacteria 815790
244 Ga0268264_10010619 3300028381 Bacteria 7610
245 Ga0268264_10081058 3300028381 Bacteria 2773
246 Ga0307413_10266466 3300031824 Bacteria 1280
247 Ga0307410_10009614 3300031852 Bacteria 5436
248 Ga0307410_10293259 3300031852 Bacteria 1281
249 Ga0307414_10245199 3300032004 Bacteria 1486
250 Ga0307415_100011924 3300032126 Bacteria 5002
251 Ga0373952_0026409 3300035092 Bacteria 1262
252 Ga0373931_0003310 3300035691 Bacteria 7217
253 Ga0373937_0026485 3300036401 Bacteria 5241
254 Ga0316584_0100278 3300036712 Bacteria 2168
255 Ga0439461_0001209 3300041410 Bacteria 3944
256 Ga0439465_0010132 3300041413 Bacteria 2963
257 Ga0439465_0010515 3300041413 Bacteria 2905
258 Ga0451833_1405370 3300041491 Bacteria 1586
259 Ga0439445_0022133 3300042004 Bacteria 1601
260 Ga0439434_0011590 3300042435 Bacteria 2607
261 Ga0439434_0065194 3300042435 Bacteria 1143
262 Ga0439459_0001564 3300042438 Bacteria 3401
263 Ga0466969_0059508 3300044656 Bacteria 1858
264 Ga0466972_0013821 3300044658 Bacteria 4052
265 Ga0466972_0037689 3300044658 Bacteria 2363
266 Ga0466972_0069544 3300044658 Bacteria 1681
267 Ga0466965_0005526 3300044683 Bacteria 5698
268 Ga0466965_0011317 3300044683 Bacteria 4178
269 Ga0466965_0037166 3300044683 Bacteria 2391
270 Ga0466966_0002685 3300044684 Bacteria 11651
271 Ga0466966_0003951 3300044684 Bacteria 9796
272 Ga0466966_0053303 3300044684 Bacteria 2566
273 Ga0466966_0153105 3300044684 Bacteria 1405
274 Ga0466961_0001059 3300044693 Bacteria 16934
275 Ga0466961_0023460 3300044693 Bacteria 3969
276 Ga0466961_0035105 3300044693 Bacteria 3220
277 Ga0466963_0019467 3300044694 Bacteria 4258
278 Ga0466968_0063579 3300044735 Bacteria 1595
279 Ga0466968_0084107 3300044735 Bacteria 1402
280 Ga0466970_0005226 3300044765 Bacteria 6425
281 Ga0466970_0007527 3300044765 Bacteria 5462
282 Ga0466970_0029805 3300044765 Bacteria 2876
283 Ga0466960_0073884 3300044901 Bacteria 1702
284 Ga0466959_0012119 3300045049 Bacteria 6222
285 Ga0466959_0110075 3300045049 Bacteria 1966
286 Ga0466958_0006610 3300045836 Bacteria 6322
287 Ga0466958_0084005 3300045836 Bacteria 1963
288 Ga0466958_0087251 3300045836 Bacteria 1926
289 Ga0466967_0010085 3300045976 Bacteria 7062
290 Ga0466967_0049038 3300045976 Bacteria 3691
291 Ga0466967_0111894 3300045976 Bacteria 2510
292 Ga0466967_0224816 3300045976 Bacteria 1785
293 Ga0466967_0392969 3300045976 Bacteria 1348
294 Ga0466967_0600449 3300045976 Bacteria 1086
295 Ga0495638_0001056 3300046460 Bacteria 27089
296 Ga0495641_0002764 3300046461 Bacteria 13593
297 Ga0495606_0042684 3300046507 Bacteria 3031
298 Ga0495648_0018447 3300046524 Bacteria 4938
299 Ga0495668_0035171 3300046616 Bacteria 2808
300 Ga0495611_0064602 3300046648 Bacteria 1667
301 Ga0495625_0165144 3300046660 Bacteria 1481
302 Ga0495657_0050910 3300046675 Bacteria 2783
303 Ga0495658_0008300 3300046683 Bacteria 5146
304 Ga0495672_0004388 3300047320 Bacteria 11572
305 Ga0495672_0037906 3300047320 Bacteria 2946
306 Ga0495672_0190772 3300047320 Bacteria 1031
307 Ga0495673_0000642 3300047469 Bacteria 34378
308 Ga0495686_0002560 3300047472 Bacteria 16969
309 Ga0495626_0038107 3300048091 Bacteria 2281
310 Ga0496100_0000091 3300048903 Bacteria 51013
311 Ga0496100_0002577 3300048903 Bacteria 9237
312 Ga0496100_0003937 3300048903 Bacteria 7806
313 Ga0496100_0044463 3300048903 Bacteria 2845
314 Ga0496100_0046638 3300048903 Bacteria 2788
315 Ga0496100_0052104 3300048903 Bacteria 2659
316 Ga0496101_0000024 3300048904 Bacteria 205570
317 Ga0496101_0000095 3300048904 Bacteria 94155
318 Ga0496101_0001131 3300048904 Bacteria 15917
319 Ga0496101_0002098 3300048904 Bacteria 12153
320 Ga0496101_0005302 3300048904 Bacteria 8212
321 Ga0496101_0103055 3300048904 Bacteria 2138
322 Ga0496101_0128524 3300048904 Bacteria 1922
323 Ga0496102_0000001 3300048905 Bacteria 873433
324 Ga0496102_0000168 3300048905 Bacteria 88511
325 Ga0496102_0019983 3300048905 Bacteria 5909
326 Ga0496102_0034576 3300048905 Bacteria 4545
327 Ga0496102_0062876 3300048905 Bacteria 3399
328 Ga0496102_0079715 3300048905 Bacteria 3016
329 Ga0496102_0112492 3300048905 Bacteria 2539
330 Ga0496103_0000003 3300048906 Bacteria 603967
331 Ga0496103_0000550 3300048906 Bacteria 29973
332 Ga0496103_0001007 3300048906 Bacteria 19723
333 Ga0496103_0005112 3300048906 Bacteria 7900
334 Ga0496103_0011180 3300048906 Bacteria 5315
335 Ga0496103_0043650 3300048906 Bacteria 2761
336 Ga0496104_0001250 3300048907 Bacteria 21900
337 Ga0496104_0005405 3300048907 Bacteria 11179
338 Ga0496104_0189874 3300048907 Bacteria 1966
339 Ga0496104_0243135 3300048907 Unclassified 1712
340 Ga0496105_0017922 3300048908 Bacteria 5683
341 Ga0496105_0046502 3300048908 Bacteria 3582
342 Ga0496106_0000650 3300048909 Bacteria 24883
343 Ga0496106_0009643 3300048909 Bacteria 7129
344 Ga0496106_0010393 3300048909 Bacteria 6877
345 Ga0496106_0222072 3300048909 Bacteria 1507
346 Ga0496107_0000482 3300048910 Bacteria 21888
347 Ga0496107_0000831 3300048910 Bacteria 18014
348 Ga0496107_0019865 3300048910 Bacteria 4743
349 Ga0496107_0030372 3300048910 Bacteria 3851
350 Ga0496107_0137090 3300048910 Bacteria 1808
351 Ga0496108_0000223 3300048911 Bacteria 50671
352 Ga0496108_0002551 3300048911 Bacteria 14584
353 Ga0496108_0067662 3300048911 Bacteria 3013
354 Ga0496109_0002340 3300048912 Bacteria 15800
355 Ga0496109_0004617 3300048912 Bacteria 11498
356 Ga0496110_0005712 3300048913 Bacteria 9770
357 Ga0496110_0050064 3300048913 Bacteria 3668
358 Ga0496110_0507654 3300048913 Bacteria 1097
359 Ga0496111_0003366 3300048914 Bacteria 9882
360 Ga0496112_0070501 3300048915 Bacteria 3455
361 Ga0496113_0092433 3300048916 Bacteria 2333
362 Ga0496114_0000320 3300048917 Bacteria 35231
363 Ga0496114_0005357 3300048917 Bacteria 10028
364 Ga0496114_0005984 3300048917 Bacteria 9576
365 Ga0496115_0009308 3300048918 Bacteria 7299
366 Ga0496115_0010946 3300048918 Bacteria 6791
367 Ga0496115_0050633 3300048918 Bacteria 3328
368 Ga0496116_0000013 3300048919 Bacteria 603993
369 Ga0496116_0004456 3300048919 Bacteria 13348
370 Ga0496116_0007483 3300048919 Bacteria 9668
371 Ga0496117_0000013 3300048920 Bacteria 603995
372 Ga0496117_0000869 3300048920 Bacteria 46596
373 Ga0496117_0031424 3300048920 Bacteria 4052
374 Ga0496118_0000011 3300048921 Bacteria 603995
375 Ga0496118_0000171 3300048921 Bacteria 117495
376 Ga0496118_0000648 3300048921 Bacteria 56769
377 Ga0496118_0066594 3300048921 Bacteria 2628
378 Ga0496119_0001640 3300048922 Bacteria 26356
379 Ga0496119_0007395 3300048922 Bacteria 9907
380 Ga0496119_0038890 3300048922 Bacteria 3065
381 Ga0496119_0053614 3300048922 Bacteria 2462
382 Ga0496119_0187696 3300048922 Bacteria 1079
383 Ga0496120_0149111 3300048923 Bacteria 1177
384 Ga0496120_0204229 3300048923 Bacteria 954
385 Ga0496121_0000004 3300048924 Bacteria 1139011
386 Ga0496121_0000958 3300048924 Bacteria 52159
387 Ga0496121_0001811 3300048924 Bacteria 34525
388 Ga0496122_0000085 3300048925 Bacteria 208310
389 Ga0496122_0042859 3300048925 Bacteria 3554
390 Ga0496123_0012970 3300048926 Bacteria 7043
391 Ga0496123_0048938 3300048926 Bacteria 2839
392 Ga0496124_0000030 3300048927 Bacteria 351350
393 Ga0496124_0005252 3300048927 Bacteria 14656
394 Ga0496125_0000003 3300048928 Bacteria 1189767
395 Ga0496125_0019309 3300048928 Bacteria 6435
396 Ga0496126_0000001 3300048929 Bacteria 1139011
397 Ga0496126_0000351 3300048929 Bacteria 96459
398 Ga0496126_0077338 3300048929 Bacteria 2950
399 Ga0496126_0103009 3300048929 Bacteria 2494
400 Ga0501032_0004382 3300049569 Bacteria 10651
401 Ga0501033_0078354 3300049570 Bacteria 2425
402 Ga0501034_0045550 3300049571 Bacteria 4432
403 Ga0501034_0054844 3300049571 Bacteria 4012
404 Ga0501037_0019944 3300049573 Bacteria 4948
405 Ga0501037_0145135 3300049573 Bacteria 1697
406 Ga0501038_0021690 3300049574 Bacteria 5761
407 Ga0501039_0003301 3300049575 Bacteria 12062
408 Ga0501046_0013184 3300049580 Bacteria 7011
409 Ga0501046_0093681 3300049580 Bacteria 2309
410 Ga0501047_0026162 3300049581 Bacteria 5613
411 Ga0501070_0201505 3300049586 Bacteria 1634
412 Ga0501074_0046637 3300049590 Bacteria 3133
413 Ga0501077_0189906 3300049593 Bacteria 1305
414 Ga0501035_0004777 3300049822 Bacteria 12865
415 Ga0501044_0014776 3300049823 Bacteria 8417
416 Ga0501044_0148628 3300049823 Bacteria 2326
417 Ga0501044_0421727 3300049823 Bacteria 1244
418 nmdc:mga03683_28755_c1 3300050489 Bacteria 2212
419 nmdc:mga03n38_325_c1 3300050490 Bacteria 11543
420 nmdc:mga00v17_11170_c1 3300050491 Bacteria 4931
421 nmdc:mga00v17_13461_c1 3300050491 Bacteria 4543
422 nmdc:mga00v17_43763_c1 3300050491 Bacteria 2698
423 nmdc:mga0yw44_28893_c1 3300050492 Bacteria 3195
424 nmdc:mga0yw44_31573_c1 3300050492 Bacteria 3081
425 nmdc:mga07m45_43521_c1 3300050496 Bacteria 2517
426 nmdc:mga0qj67_4687_c1 3300050509 Bacteria 9925
427 nmdc:mga0sz30_2056_c1 3300050516 Bacteria 7194
428 nmdc:mga0sz30_21482_c1 3300050516 Bacteria 2612
429 nmdc:mga0sz30_6204_c1 3300050516 Bacteria 4428
430 Ga0500610_0038274 3300053079 Bacteria 2471
431 Ga0500635_0000662 3300053080 Bacteria 8751
432 Ga0500635_0077589 3300053080 Bacteria 1188
433 Ga0500646_0034895 3300053090 Bacteria 1396
434 Ga0500556_0007357 3300053104 Bacteria 3147
435 Ga0500616_0008941 3300053153 Bacteria 6139
436 Ga0500616_0017051 3300053153 Bacteria 4124
437 Ga0500645_000004 3300053730 Bacteria 305014
438 Ga0466962_0028621 3300061719 Bacteria 2668
439 Ga0466962_0055299 3300061719 Bacteria 1896
440 Ga0530510_0222195 3300061734 Bacteria 1404

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0190772 Ga0495672_0190772_174_1013 272
2 3300009098 Ga0105245_10866962 Ga0105245_108669621 278
3 3300048923 Ga0496120_0149111 Ga0496120_0149111_304_1167 287
4 3300049580 Ga0501046_0013184 Ga0501046_0013184_5284_6363 303
5 3300020082 Ga0206353_11102129 Ga0206353_111021292 304
6 3300041491 Ga0451833_1405370 Ga0451833_1405370_50_1006 304
7 3300045976 Ga0466967_0049038 Ga0466967_0049038_1113_2186 305
8 3300048922 Ga0496119_0187696 Ga0496119_0187696_124_1041 305
9 3300048923 Ga0496120_0204229 Ga0496120_0204229_11_928 305
10 3300049573 Ga0501037_0019944 Ga0501037_0019944_1926_3005 305
11 3300010375 Ga0105239_10008803 Ga0105239_100088034 307
12 3300046461 Ga0495641_0002764 Ga0495641_0002764_6364_7398 307
13 3300046683 Ga0495658_0008300 Ga0495658_0008300_2281_3315 307
14 3300053090 Ga0500646_0034895 Ga0500646_0034895_163_1164 307
15 3300044684 Ga0466966_0002685 Ga0466966_0002685_1152_2168 308
16 3300044693 Ga0466961_0001059 Ga0466961_0001059_6692_7708 308
17 3300044694 Ga0466963_0019467 Ga0466963_0019467_2343_3359 308
18 3300061719 Ga0466962_0028621 Ga0466962_0028621_624_1640 308
19 3300005539 Ga0068853_100112623 Ga0068853_1001126232 310
20 3300026041 Ga0207639_10016205 Ga0207639_100162053 310
21 3300047472 Ga0495686_0002560 Ga0495686_0002560_12602_13597 310
22 3300003792 Ga0055540_1000684 Ga0055540_100068413 311
23 3300003792 Ga0055540_1004584 Ga0055540_10045846 311
24 3300006177 Ga0075362_10112383 Ga0075362_101123832 311
25 3300025303 Ga0209051_1000558 Ga0209051_100055813 311
26 3300025303 Ga0209051_1003583 Ga0209051_10035838 311
27 3300025303 Ga0209051_1003747 Ga0209051_10037473 311
28 3300050496 nmdc:mga07m45_43521_c1 nmdc:mga07m45_43521_c1_722_1723 311
29 3300053153 Ga0500616_0008941 Ga0500616_0008941_3965_4969 311
30 3300048905 Ga0496102_0062876 Ga0496102_0062876_2348_3358 312
31 3300048913 Ga0496110_0507654 Ga0496110_0507654_50_1078 312
32 3300049590 Ga0501074_0046637 Ga0501074_0046637_1296_2348 312
33 3300049823 Ga0501044_0148628 Ga0501044_0148628_1174_2226 312
34 3300025303 Ga0209051_1008038 Ga0209051_10080385 313
35 3300031852 Ga0307410_10293259 Ga0307410_102932591 313
36 3300045976 Ga0466967_0224816 Ga0466967_0224816_466_1476 313
37 iso_pu_bacteria 2558860112 2558911253 313
38 3300013306 Ga0163162_10061486 Ga0163162_100614863 314
39 3300025901 Ga0207688_10175677 Ga0207688_101756772 314
40 3300045976 Ga0466967_0392969 Ga0466967_0392969_216_1235 314
41 3300005353 Ga0070669_100004939 Ga0070669_1000049396 315
42 3300005367 Ga0070667_100000073 Ga0070667_10000007371 315
43 3300005548 Ga0070665_100006701 Ga0070665_1000067019 315
44 3300005617 Ga0068859_100000223 Ga0068859_1000002239 315
45 3300005841 Ga0068863_100003366 Ga0068863_1000033668 315
46 3300005842 Ga0068858_100025702 Ga0068858_1000257023 315
47 3300005843 Ga0068860_100000127 Ga0068860_10000012772 315
48 3300005844 Ga0068862_100000052 Ga0068862_10000005269 315
49 3300006931 Ga0097620_100000223 Ga0097620_1000002239 315
50 3300009101 Ga0105247_10000066 Ga0105247_1000006644 315
51 3300009177 Ga0105248_10000144 Ga0105248_1000014427 315
52 3300009553 Ga0105249_10000093 Ga0105249_1000009344 315
53 3300014325 Ga0163163_10200711 Ga0163163_102007112 315
54 3300014968 Ga0157379_10060728 Ga0157379_100607285 315
55 3300025900 Ga0207710_10000090 Ga0207710_1000009044 315
56 3300025923 Ga0207681_10038725 Ga0207681_100387252 315
57 3300025941 Ga0207711_10001782 Ga0207711_100017822 315
58 3300025961 Ga0207712_10000073 Ga0207712_1000007344 315
59 3300025986 Ga0207658_10000304 Ga0207658_1000030413 315
60 3300026035 Ga0207703_10021877 Ga0207703_100218773 315
61 3300026088 Ga0207641_10003816 Ga0207641_100038168 315
62 3300028379 Ga0268266_10009396 Ga0268266_100093967 315
63 3300028380 Ga0268265_10000063 Ga0268265_1000006369 315
64 3300028381 Ga0268264_10000007 Ga0268264_1000000772 315
65 3300036401 Ga0373937_0026485 Ga0373937_0026485_2898_3983 315
66 3300046675 Ga0495657_0050910 Ga0495657_0050910_937_2022 315
67 3300048903 Ga0496100_0046638 Ga0496100_0046638_127_1128 315
68 3300048904 Ga0496101_0005302 Ga0496101_0005302_5233_6234 315
69 3300048905 Ga0496102_0000168 Ga0496102_0000168_66815_67816 315
70 3300048906 Ga0496103_0000550 Ga0496103_0000550_21292_22293 315
71 3300048909 Ga0496106_0222072 Ga0496106_0222072_11_1012 315
72 3300048910 Ga0496107_0030372 Ga0496107_0030372_2150_3151 315
73 3300048919 Ga0496116_0007483 Ga0496116_0007483_62_1063 315
74 3300048920 Ga0496117_0000869 Ga0496117_0000869_20608_21609 315
75 3300048921 Ga0496118_0000171 Ga0496118_0000171_49483_50484 315
76 3300048922 Ga0496119_0001640 Ga0496119_0001640_7340_8341 315
77 3300048924 Ga0496121_0001811 Ga0496121_0001811_6261_7262 315
78 3300048927 Ga0496124_0005252 Ga0496124_0005252_1049_2050 315
79 3300048928 Ga0496125_0019309 Ga0496125_0019309_2492_3493 315
80 3300048929 Ga0496126_0103009 Ga0496126_0103009_405_1406 315
81 3300006038 Ga0075365_10001736 Ga0075365_100017367 316
82 3300050492 nmdc:mga0yw44_28893_c1 nmdc:mga0yw44_28893_c1_940_1923 316
83 3300005347 Ga0070668_100000783 Ga0070668_10000078313 317
84 3300025972 Ga0207668_10000804 Ga0207668_100008047 317
85 3300046460 Ga0495638_0001056 Ga0495638_0001056_5036_6040 317
86 3300046660 Ga0495625_0165144 Ga0495625_0165144_151_1155 317
87 3300048091 Ga0495626_0038107 Ga0495626_0038107_455_1459 317
88 3300053079 Ga0500610_0038274 Ga0500610_0038274_121_1125 317
89 3300053104 Ga0500556_0007357 Ga0500556_0007357_2133_3137 317
90 3300053153 Ga0500616_0017051 Ga0500616_0017051_1316_2320 317
91 iso_pu_bacteria 2837183177 2837185162 317
92 3300005356 Ga0070674_100015164 Ga0070674_1000151643 318
93 3300005841 Ga0068863_100161314 Ga0068863_1001613141 318
94 3300006186 Ga0075369_10094399 Ga0075369_100943991 318
95 3300009177 Ga0105248_10066282 Ga0105248_100662822 318
96 3300025937 Ga0207669_10008434 Ga0207669_100084345 318
97 3300026035 Ga0207703_10320682 Ga0207703_103206822 318
98 3300041413 Ga0439465_0010132 Ga0439465_0010132_497_1498 318
99 3300048903 Ga0496100_0052104 Ga0496100_0052104_1583_2587 318
100 3300048904 Ga0496101_0001131 Ga0496101_0001131_6364_7368 318
101 3300048907 Ga0496104_0001250 Ga0496104_0001250_12938_13942 318
102 3300048908 Ga0496105_0017922 Ga0496105_0017922_3553_4557 318
103 3300048909 Ga0496106_0009643 Ga0496106_0009643_597_1601 318
104 3300048910 Ga0496107_0000831 Ga0496107_0000831_11221_12225 318
105 3300048917 Ga0496114_0000320 Ga0496114_0000320_3971_4975 318
106 3300048918 Ga0496115_0009308 Ga0496115_0009308_4905_5909 318
107 iso_pu_bacteria 2643221715 2644638204 318
108 3300005548 Ga0070665_100004535 Ga0070665_1000045355 319
109 3300005841 Ga0068863_100012821 Ga0068863_1000128217 319
110 3300006844 Ga0075428_100255274 Ga0075428_1002552742 319
111 3300009147 Ga0114129_10432253 Ga0114129_104322532 319
112 3300026095 Ga0207676_10281952 Ga0207676_102819522 319
113 3300028379 Ga0268266_10005255 Ga0268266_100052553 319
114 3300044683 Ga0466965_0037166 Ga0466965_0037166_1248_2306 319
115 3300048905 Ga0496102_0079715 Ga0496102_0079715_1877_2872 319
116 3300048906 Ga0496103_0011180 Ga0496103_0011180_155_1150 319
117 3300048907 Ga0496104_0005405 Ga0496104_0005405_5937_6932 319
118 3300048908 Ga0496105_0046502 Ga0496105_0046502_2447_3442 319
119 3300050509 nmdc:mga0qj67_4687_c1 nmdc:mga0qj67_4687_c1_6958_7959 319
120 3300061734 Ga0530510_0222195 Ga0530510_0222195_134_1189 320
121 3300005937 Ga0081455_10041565 Ga0081455_100415654 321
122 3300006038 Ga0075365_10142880 Ga0075365_101428802 321
123 3300005563 Ga0068855_100507305 Ga0068855_1005073052 322
124 3300006051 Ga0075364_10077059 Ga0075364_100770592 322
125 3300006186 Ga0075369_10033352 Ga0075369_100333523 322
126 3300009545 Ga0105237_10003772 Ga0105237_100037722 322
127 3300010375 Ga0105239_10097720 Ga0105239_100977203 322
128 3300025914 Ga0207671_10011278 Ga0207671_100112786 322
129 3300025929 Ga0207664_10264493 Ga0207664_102644932 322
130 3300036712 Ga0316584_0100278 Ga0316584_0100278_260_1300 322
131 3300047320 Ga0495672_0037906 Ga0495672_0037906_86_1093 322
132 3300050516 nmdc:mga0sz30_21482_c1 nmdc:mga0sz30_21482_c1_60_1067 322
133 3300053080 Ga0500635_0077589 Ga0500635_0077589_31_1038 322
134 3300053730 Ga0500645_000004 Ga0500645_000004_71968_72975 322
135 iso_pu_bacteria 2870782633 2870784375 322
136 3300005335 Ga0070666_10023841 Ga0070666_100238414 323
137 3300005367 Ga0070667_100004426 Ga0070667_1000044266 323
138 3300009545 Ga0105237_10012754 Ga0105237_100127543 323
139 3300010375 Ga0105239_10330967 Ga0105239_103309672 323
140 3300025914 Ga0207671_10012944 Ga0207671_100129442 323
141 3300025986 Ga0207658_10003086 Ga0207658_100030868 323
142 3300048903 Ga0496100_0000091 Ga0496100_0000091_45167_46225 323
143 3300048904 Ga0496101_0000095 Ga0496101_0000095_4763_5821 323
144 3300048905 Ga0496102_0034576 Ga0496102_0034576_1478_2536 323
145 3300048906 Ga0496103_0001007 Ga0496103_0001007_12710_13768 323
146 3300048909 Ga0496106_0000650 Ga0496106_0000650_2952_4010 323
147 3300048910 Ga0496107_0000482 Ga0496107_0000482_4817_5875 323
148 3300048911 Ga0496108_0002551 Ga0496108_0002551_4769_5827 323
149 3300048912 Ga0496109_0002340 Ga0496109_0002340_4906_5964 323
150 3300048913 Ga0496110_0005712 Ga0496110_0005712_4779_5837 323
151 3300048914 Ga0496111_0003366 Ga0496111_0003366_1870_2928 323
152 3300048917 Ga0496114_0005357 Ga0496114_0005357_4175_5233 323
153 3300048918 Ga0496115_0050633 Ga0496115_0050633_659_1717 323
154 3300048919 Ga0496116_0004456 Ga0496116_0004456_7014_8072 323
155 3300048920 Ga0496117_0031424 Ga0496117_0031424_1279_2337 323
156 3300048921 Ga0496118_0066594 Ga0496118_0066594_1478_2536 323
157 3300048922 Ga0496119_0007395 Ga0496119_0007395_4061_5119 323
158 3300048924 Ga0496121_0000004 Ga0496121_0000004_792450_793508 323
159 3300048925 Ga0496122_0000085 Ga0496122_0000085_85212_86270 323
160 3300048926 Ga0496123_0012970 Ga0496123_0012970_2760_3818 323
161 3300048927 Ga0496124_0000030 Ga0496124_0000030_4789_5847 323
162 3300048928 Ga0496125_0000003 Ga0496125_0000003_396260_397318 323
163 3300048929 Ga0496126_0000001 Ga0496126_0000001_792450_793508 323
164 3300002239 JGI24034J26672_10001513 JGI24034J26672_100015133 324
165 3300002244 JGI24742J22300_10000680 JGI24742J22300_100006804 324
166 3300005334 Ga0068869_100052470 Ga0068869_1000524703 324
167 3300005335 Ga0070666_10009031 Ga0070666_100090312 324
168 3300005338 Ga0068868_100025757 Ga0068868_1000257574 324
169 3300005340 Ga0070689_100025992 Ga0070689_1000259922 324
170 3300005347 Ga0070668_100359159 Ga0070668_1003591592 324
171 3300005353 Ga0070669_100019437 Ga0070669_1000194372 324
172 3300005355 Ga0070671_100020153 Ga0070671_1000201537 324
173 3300005365 Ga0070688_100020213 Ga0070688_1000202134 324
174 3300005366 Ga0070659_100009223 Ga0070659_1000092235 324
175 3300005367 Ga0070667_100010309 Ga0070667_1000103095 324
176 3300005438 Ga0070701_10000316 Ga0070701_1000031610 324
177 3300005439 Ga0070711_100008474 Ga0070711_1000084742 324
178 3300005440 Ga0070705_100003071 Ga0070705_1000030717 324
179 3300005441 Ga0070700_100006412 Ga0070700_1000064128 324
180 3300005444 Ga0070694_100032592 Ga0070694_1000325923 324
181 3300005455 Ga0070663_100024308 Ga0070663_1000243082 324
182 3300005456 Ga0070678_100007614 Ga0070678_1000076144 324
183 3300005457 Ga0070662_100015309 Ga0070662_1000153096 324
184 3300005459 Ga0068867_100001555 Ga0068867_10000155511 324
185 3300005544 Ga0070686_100120725 Ga0070686_1001207252 324
186 3300005545 Ga0070695_100014218 Ga0070695_1000142182 324
187 3300005546 Ga0070696_100009528 Ga0070696_1000095282 324
188 3300005547 Ga0070693_100033011 Ga0070693_1000330112 324
189 3300005548 Ga0070665_100415112 Ga0070665_1004151122 324
190 3300005549 Ga0070704_100007683 Ga0070704_1000076838 324
191 3300005578 Ga0068854_100007657 Ga0068854_1000076572 324
192 3300005615 Ga0070702_100000825 Ga0070702_1000008257 324
193 3300005617 Ga0068859_100008058 Ga0068859_1000080582 324
194 3300005718 Ga0068866_10001954 Ga0068866_100019544 324
195 3300005719 Ga0068861_100011981 Ga0068861_1000119814 324
196 3300005843 Ga0068860_100026823 Ga0068860_1000268234 324
197 3300005844 Ga0068862_100002811 Ga0068862_1000028119 324
198 3300006163 Ga0070715_10007283 Ga0070715_100072833 324
199 3300006173 Ga0070716_100008024 Ga0070716_1000080244 324
200 3300006175 Ga0070712_100000738 Ga0070712_10000073810 324
201 3300006931 Ga0097620_100008058 Ga0097620_1000080582 324
202 3300007788 Ga0099795_10008475 Ga0099795_100084752 324
203 3300009098 Ga0105245_10003640 Ga0105245_100036405 324
204 3300009101 Ga0105247_10001100 Ga0105247_100011008 324
205 3300009148 Ga0105243_10002917 Ga0105243_100029178 324
206 3300009174 Ga0105241_10011800 Ga0105241_100118008 324
207 3300009176 Ga0105242_10001265 Ga0105242_1000126522 324
208 3300009177 Ga0105248_10259322 Ga0105248_102593222 324
209 3300009545 Ga0105237_10151394 Ga0105237_101513942 324
210 3300009553 Ga0105249_10185759 Ga0105249_101857592 324
211 3300010375 Ga0105239_10016589 Ga0105239_1001658910 324
212 3300013297 Ga0157378_10004665 Ga0157378_1000466511 324
213 3300013306 Ga0163162_10019654 Ga0163162_100196542 324
214 3300013307 Ga0157372_10026589 Ga0157372_100265895 324
215 3300013308 Ga0157375_10007227 Ga0157375_100072279 324
216 3300014326 Ga0157380_10002330 Ga0157380_100023309 324
217 3300014968 Ga0157379_10056144 Ga0157379_100561442 324
218 3300014969 Ga0157376_10039793 Ga0157376_100397934 324
219 3300017792 Ga0163161_10005500 Ga0163161_100055003 324
220 3300017792 Ga0163161_10152648 Ga0163161_101526482 324
221 3300025898 Ga0207692_10002051 Ga0207692_100020517 324
222 3300025901 Ga0207688_10000932 Ga0207688_100009328 324
223 3300025903 Ga0207680_10026619 Ga0207680_100266193 324
224 3300025905 Ga0207685_10001541 Ga0207685_100015414 324
225 3300025906 Ga0207699_10028146 Ga0207699_100281462 324
226 3300025911 Ga0207654_10012646 Ga0207654_100126463 324
227 3300025915 Ga0207693_10000428 Ga0207693_1000042815 324
228 3300025916 Ga0207663_10010841 Ga0207663_100108413 324
229 3300025923 Ga0207681_10022549 Ga0207681_100225494 324
230 3300025927 Ga0207687_10005219 Ga0207687_100052192 324
231 3300025931 Ga0207644_10033096 Ga0207644_100330963 324
232 3300025932 Ga0207690_10030986 Ga0207690_100309864 324
233 3300025933 Ga0207706_10001922 Ga0207706_1000192218 324
234 3300025934 Ga0207686_10014184 Ga0207686_100141843 324
235 3300025935 Ga0207709_10020928 Ga0207709_100209284 324
236 3300025936 Ga0207670_10026966 Ga0207670_100269663 324
237 3300025937 Ga0207669_10001245 Ga0207669_100012458 324
238 3300025938 Ga0207704_10003885 Ga0207704_100038859 324
239 3300025939 Ga0207665_10009244 Ga0207665_100092444 324
240 3300025941 Ga0207711_10012635 Ga0207711_100126359 324
241 3300025942 Ga0207689_10013017 Ga0207689_100130174 324
242 3300025961 Ga0207712_10006710 Ga0207712_100067107 324
243 3300025972 Ga0207668_10052848 Ga0207668_100528483 324
244 3300025981 Ga0207640_10003619 Ga0207640_100036194 324
245 3300026035 Ga0207703_10078735 Ga0207703_100787353 324
246 3300026067 Ga0207678_10017039 Ga0207678_100170392 324
247 3300026075 Ga0207708_10004070 Ga0207708_100040709 324
248 3300026089 Ga0207648_10005092 Ga0207648_100050922 324
249 3300026118 Ga0207675_100000876 Ga0207675_10000087614 324
250 3300026118 Ga0207675_100090491 Ga0207675_1000904912 324
251 3300026121 Ga0207683_10001137 Ga0207683_100011379 324
252 3300028379 Ga0268266_10126869 Ga0268266_101268692 324
253 3300028380 Ga0268265_10017748 Ga0268265_100177485 324
254 3300028381 Ga0268264_10010619 Ga0268264_100106197 324
255 3300035691 Ga0373931_0003310 Ga0373931_0003310_3541_4542 324
256 3300044658 Ga0466972_0013821 Ga0466972_0013821_1254_2261 324
257 3300044683 Ga0466965_0011317 Ga0466965_0011317_2761_3768 324
258 3300044684 Ga0466966_0053303 Ga0466966_0053303_226_1233 324
259 3300044693 Ga0466961_0023460 Ga0466961_0023460_372_1379 324
260 3300044765 Ga0466970_0007527 Ga0466970_0007527_1965_2972 324
261 3300045836 Ga0466958_0006610 Ga0466958_0006610_3929_4936 324
262 3300046507 Ga0495606_0042684 Ga0495606_0042684_1844_2848 324
263 3300048903 Ga0496100_0002577 Ga0496100_0002577_3141_4142 324
264 3300048904 Ga0496101_0002098 Ga0496101_0002098_4522_5523 324
265 3300048905 Ga0496102_0112492 Ga0496102_0112492_1079_2080 324
266 3300048906 Ga0496103_0005112 Ga0496103_0005112_5441_6442 324
267 3300048909 Ga0496106_0010393 Ga0496106_0010393_3239_4240 324
268 3300048910 Ga0496107_0019865 Ga0496107_0019865_2784_3785 324
269 3300048917 Ga0496114_0005984 Ga0496114_0005984_3009_4010 324
270 3300048918 Ga0496115_0010946 Ga0496115_0010946_1323_2324 324
271 3300061719 Ga0466962_0055299 Ga0466962_0055299_377_1384 324
272 3300003792 Ga0055540_1000219 Ga0055540_100021937 325
273 3300025303 Ga0209051_1000116 Ga0209051_1000116121 325
274 3300028380 Ga0268265_10063049 Ga0268265_100630492 325
275 3300041413 Ga0439465_0010515 Ga0439465_0010515_563_1573 325
276 3300042435 Ga0439434_0011590 Ga0439434_0011590_517_1527 325
277 3300046524 Ga0495648_0018447 Ga0495648_0018447_2494_3513 325
278 3300046616 Ga0495668_0035171 Ga0495668_0035171_1044_2063 325
279 3300046648 Ga0495611_0064602 Ga0495611_0064602_466_1485 325
280 3300047320 Ga0495672_0004388 Ga0495672_0004388_1653_2672 325
281 3300047469 Ga0495673_0000642 Ga0495673_0000642_28765_29784 325
282 3300050489 nmdc:mga03683_28755_c1 nmdc:mga03683_28755_c1_1020_1997 325
283 3300050491 nmdc:mga00v17_11170_c1 nmdc:mga00v17_11170_c1_3096_4073 325
284 3300006038 Ga0075365_10000732 Ga0075365_1000073215 326
285 3300006048 Ga0075363_100010432 Ga0075363_1000104325 326
286 3300006051 Ga0075364_10029400 Ga0075364_100294003 326
287 3300006186 Ga0075369_10002722 Ga0075369_100027225 326
288 3300006186 Ga0075369_10017899 Ga0075369_100178992 326
289 3300009147 Ga0114129_10300348 Ga0114129_103003482 326
290 3300013306 Ga0163162_10101332 Ga0163162_101013322 326
291 3300044735 Ga0466968_0084107 Ga0466968_0084107_328_1329 326
292 3300045976 Ga0466967_0111894 Ga0466967_0111894_693_1721 326
293 3300048922 Ga0496119_0053614 Ga0496119_0053614_638_1642 326
294 3300006048 Ga0075363_100045230 Ga0075363_1000452302 327
295 3300006051 Ga0075364_10000472 Ga0075364_1000047215 327
296 3300006186 Ga0075369_10002275 Ga0075369_100022752 327
297 3300044658 Ga0466972_0069544 Ga0466972_0069544_197_1198 327
298 iso_pu_bacteria 2902810491 2902812079 327
299 3300041410 Ga0439461_0001209 Ga0439461_0001209_2796_3803 328
300 iso_pu_bacteria 2939582691 2939588768 328
301 3300025986 Ga0207658_10137421 Ga0207658_101374212 329
302 3300048904 Ga0496101_0103055 Ga0496101_0103055_568_1575 329
303 3300048916 Ga0496113_0092433 Ga0496113_0092433_221_1228 329
304 3300048925 Ga0496122_0042859 Ga0496122_0042859_717_1724 329
305 3300048926 Ga0496123_0048938 Ga0496123_0048938_1144_2151 329
306 3300048929 Ga0496126_0077338 Ga0496126_0077338_565_1572 329
307 iso_pu_bacteria 2738541274 2738703106 329
308 iso_pu_bacteria 2738543028 2739329430 329
309 iso_pu_bacteria 2902792274 2902796559 329
310 iso_pu_bacteria 2902799365 2902800486 329
311 iso_pu_bacteria 2902837492 2902838324 329
312 3300013308 Ga0157375_10123178 Ga0157375_101231782 330
313 3300044684 Ga0466966_0003951 Ga0466966_0003951_8392_9444 330
314 3300045049 Ga0466959_0012119 Ga0466959_0012119_118_1170 330
315 3300045836 Ga0466958_0087251 Ga0466958_0087251_769_1821 330
316 3300048911 Ga0496108_0067662 Ga0496108_0067662_422_1414 330
317 3300049569 Ga0501032_0004382 Ga0501032_0004382_2821_3855 330
318 3300049571 Ga0501034_0045550 Ga0501034_0045550_433_1467 330
319 3300049573 Ga0501037_0145135 Ga0501037_0145135_168_1202 330
320 3300049574 Ga0501038_0021690 Ga0501038_0021690_872_1906 330
321 3300049575 Ga0501039_0003301 Ga0501039_0003301_177_1211 330
322 3300049586 Ga0501070_0201505 Ga0501070_0201505_330_1364 330
323 3300049593 Ga0501077_0189906 Ga0501077_0189906_156_1190 330
324 3300049823 Ga0501044_0421727 Ga0501044_0421727_174_1208 330
325 iso_pu_bacteria 2738541264 2738668549 330
326 iso_pu_bacteria 2738541356 2739147741 330
327 3300003320 rootH2_10039752 rootH2_100397522 331
328 3300042004 Ga0439445_0022133 Ga0439445_0022133_275_1291 331
329 3300042435 Ga0439434_0065194 Ga0439434_0065194_88_1104 331
330 3300049570 Ga0501033_0078354 Ga0501033_0078354_1350_2360 331
331 3300049571 Ga0501034_0054844 Ga0501034_0054844_2208_3218 331
332 3300049580 Ga0501046_0093681 Ga0501046_0093681_151_1161 331
333 3300049581 Ga0501047_0026162 Ga0501047_0026162_1970_2980 331
334 3300049822 Ga0501035_0004777 Ga0501035_0004777_9224_10234 331
335 3300049823 Ga0501044_0014776 Ga0501044_0014776_5434_6444 331
336 3300050491 nmdc:mga00v17_13461_c1 nmdc:mga00v17_13461_c1_196_1212 331
337 3300031824 Ga0307413_10266466 Ga0307413_102664661 332
338 3300031852 Ga0307410_10009614 Ga0307410_100096143 332
339 3300032004 Ga0307414_10245199 Ga0307414_102451992 332
340 3300032126 Ga0307415_100011924 Ga0307415_1000119243 332
341 3300044658 Ga0466972_0037689 Ga0466972_0037689_331_1350 332
342 3300044683 Ga0466965_0005526 Ga0466965_0005526_2928_3947 332
343 3300044765 Ga0466970_0005226 Ga0466970_0005226_3888_4907 332
344 3300044901 Ga0466960_0073884 Ga0466960_0073884_541_1560 332
345 3300045976 Ga0466967_0010085 Ga0466967_0010085_660_1679 332
346 3300001991 JGI24743J22301_10009306 JGI24743J22301_100093062 333
347 3300002075 JGI24738J21930_10008451 JGI24738J21930_100084513 333
348 3300002077 JGI24744J21845_10014071 JGI24744J21845_100140712 333
349 3300005328 Ga0070676_10073979 Ga0070676_100739792 333
350 3300005330 Ga0070690_100033606 Ga0070690_1000336063 333
351 3300005334 Ga0068869_100147387 Ga0068869_1001473872 333
352 3300005337 Ga0070682_100053844 Ga0070682_1000538444 333
353 3300005338 Ga0068868_100223457 Ga0068868_1002234572 333
354 3300005339 Ga0070660_100307346 Ga0070660_1003073461 333
355 3300005341 Ga0070691_10064799 Ga0070691_100647992 333
356 3300005347 Ga0070668_100050820 Ga0070668_1000508203 333
357 3300005347 Ga0070668_100154434 Ga0070668_1001544341 333
358 3300005364 Ga0070673_100065544 Ga0070673_1000655442 333
359 3300005437 Ga0070710_10067005 Ga0070710_100670052 333
360 3300005439 Ga0070711_100019414 Ga0070711_1000194142 333
361 3300005439 Ga0070711_100159634 Ga0070711_1001596342 333
362 3300005466 Ga0070685_10097639 Ga0070685_100976392 333
363 3300005539 Ga0068853_100283828 Ga0068853_1002838282 333
364 3300005545 Ga0070695_100035376 Ga0070695_1000353763 333
365 3300005546 Ga0070696_100040044 Ga0070696_1000400444 333
366 3300005548 Ga0070665_100084982 Ga0070665_1000849823 333
367 3300005616 Ga0068852_100370676 Ga0068852_1003706762 333
368 3300005718 Ga0068866_10079903 Ga0068866_100799032 333
369 3300005843 Ga0068860_100111486 Ga0068860_1001114862 333
370 3300006048 Ga0075363_100002790 Ga0075363_1000027902 333
371 3300006051 Ga0075364_10008520 Ga0075364_100085204 333
372 3300006173 Ga0070716_100109710 Ga0070716_1001097102 333
373 3300006186 Ga0075369_10080514 Ga0075369_100805142 333
374 3300006353 Ga0075370_10021576 Ga0075370_100215762 333
375 3300006358 Ga0068871_100185617 Ga0068871_1001856172 333
376 3300009094 Ga0111539_10673390 Ga0111539_106733901 333
377 3300009098 Ga0105245_10010716 Ga0105245_100107166 333
378 3300009148 Ga0105243_10084335 Ga0105243_100843352 333
379 3300009177 Ga0105248_10136840 Ga0105248_101368403 333
380 3300009545 Ga0105237_10076052 Ga0105237_100760523 333
381 3300009553 Ga0105249_10072970 Ga0105249_100729703 333
382 3300011119 Ga0105246_10026437 Ga0105246_100264373 333
383 3300013100 Ga0157373_10233127 Ga0157373_102331272 333
384 3300013105 Ga0157369_10359965 Ga0157369_103599652 333
385 3300013297 Ga0157378_10043286 Ga0157378_100432867 333
386 3300014325 Ga0163163_10192939 Ga0163163_101929392 333
387 3300014326 Ga0157380_10161326 Ga0157380_101613263 333
388 3300014745 Ga0157377_10077314 Ga0157377_100773142 333
389 3300014969 Ga0157376_10087590 Ga0157376_100875903 333
390 3300017792 Ga0163161_10026591 Ga0163161_100265911 333
391 3300025898 Ga0207692_10038058 Ga0207692_100380583 333
392 3300025898 Ga0207692_10077281 Ga0207692_100772812 333
393 3300025901 Ga0207688_10006744 Ga0207688_100067443 333
394 3300025904 Ga0207647_10060935 Ga0207647_100609352 333
395 3300025905 Ga0207685_10003524 Ga0207685_100035242 333
396 3300025906 Ga0207699_10083177 Ga0207699_100831773 333
397 3300025914 Ga0207671_10030440 Ga0207671_100304404 333
398 3300025915 Ga0207693_10020194 Ga0207693_100201948 333
399 3300025916 Ga0207663_10014290 Ga0207663_100142903 333
400 3300025926 Ga0207659_10185859 Ga0207659_101858592 333
401 3300025929 Ga0207664_10044495 Ga0207664_100444952 333
402 3300025933 Ga0207706_10005781 Ga0207706_1000578110 333
403 3300025939 Ga0207665_10008506 Ga0207665_100085063 333
404 3300025942 Ga0207689_10042995 Ga0207689_100429954 333
405 3300025949 Ga0207667_10331745 Ga0207667_103317452 333
406 3300025972 Ga0207668_10329182 Ga0207668_103291821 333
407 3300025986 Ga0207658_10013038 Ga0207658_100130386 333
408 3300026023 Ga0207677_10141016 Ga0207677_101410162 333
409 3300026075 Ga0207708_10015261 Ga0207708_100152612 333
410 3300026088 Ga0207641_10051538 Ga0207641_100515383 333
411 3300026089 Ga0207648_10028388 Ga0207648_100283886 333
412 3300026118 Ga0207675_100027583 Ga0207675_1000275832 333
413 3300026121 Ga0207683_10017031 Ga0207683_100170319 333
414 3300028379 Ga0268266_10278495 Ga0268266_102784952 333
415 3300028381 Ga0268264_10081058 Ga0268264_100810583 333
416 3300035092 Ga0373952_0026409 Ga0373952_0026409_158_1159 333
417 3300042438 Ga0439459_0001564 Ga0439459_0001564_439_1443 333
418 3300044656 Ga0466969_0059508 Ga0466969_0059508_234_1259 333
419 3300044684 Ga0466966_0153105 Ga0466966_0153105_287_1312 333
420 3300044693 Ga0466961_0035105 Ga0466961_0035105_1799_2824 333
421 3300044735 Ga0466968_0063579 Ga0466968_0063579_50_1075 333
422 3300044765 Ga0466970_0029805 Ga0466970_0029805_492_1517 333
423 3300045049 Ga0466959_0110075 Ga0466959_0110075_238_1263 333
424 3300045836 Ga0466958_0084005 Ga0466958_0084005_397_1422 333
425 3300045976 Ga0466967_0600449 Ga0466967_0600449_52_1071 333
426 3300048903 Ga0496100_0003937 Ga0496100_0003937_339_1343 333
427 3300048903 Ga0496100_0044463 Ga0496100_0044463_926_1927 333
428 3300048904 Ga0496101_0000024 Ga0496101_0000024_102824_103828 333
429 3300048904 Ga0496101_0128524 Ga0496101_0128524_909_1910 333
430 3300048905 Ga0496102_0000001 Ga0496102_0000001_767179_768183 333
431 3300048905 Ga0496102_0019983 Ga0496102_0019983_996_2060 333
432 3300048906 Ga0496103_0000003 Ga0496103_0000003_498241_499245 333
433 3300048906 Ga0496103_0043650 Ga0496103_0043650_687_1688 333
434 3300048907 Ga0496104_0189874 Ga0496104_0189874_118_1140 333
435 3300048907 Ga0496104_0243135 Ga0496104_0243135_638_1639 333
436 3300048910 Ga0496107_0137090 Ga0496107_0137090_420_1421 333
437 3300048911 Ga0496108_0000223 Ga0496108_0000223_18474_19475 333
438 3300048912 Ga0496109_0004617 Ga0496109_0004617_3017_4018 333
439 3300048913 Ga0496110_0050064 Ga0496110_0050064_2342_3343 333
440 3300048915 Ga0496112_0070501 Ga0496112_0070501_714_1715 333
441 3300048919 Ga0496116_0000013 Ga0496116_0000013_104749_105753 333
442 3300048920 Ga0496117_0000013 Ga0496117_0000013_498241_499245 333
443 3300048921 Ga0496118_0000011 Ga0496118_0000011_104751_105755 333
444 3300048921 Ga0496118_0000648 Ga0496118_0000648_8838_9902 333
445 3300048922 Ga0496119_0038890 Ga0496119_0038890_499_1503 333
446 3300048924 Ga0496121_0000958 Ga0496121_0000958_44144_45148 333
447 3300048929 Ga0496126_0000351 Ga0496126_0000351_8299_9303 333
448 3300050490 nmdc:mga03n38_325_c1 nmdc:mga03n38_325_c1_745_1773 333
449 3300050491 nmdc:mga00v17_43763_c1 nmdc:mga00v17_43763_c1_972_2000 333
450 3300050492 nmdc:mga0yw44_31573_c1 nmdc:mga0yw44_31573_c1_456_1484 333
451 3300050516 nmdc:mga0sz30_2056_c1 nmdc:mga0sz30_2056_c1_5889_6917 333
452 3300050516 nmdc:mga0sz30_6204_c1 nmdc:mga0sz30_6204_c1_782_1786 333
453 3300053080 Ga0500635_0000662 Ga0500635_0000662_4417_5421 333
454 iso_pu_bacteria 2643221687 2644489353 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01734

Patatin

Patatin-like phospholipase

30

229

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.6818 7 320
5fqu-assembly1.cif.gz_A orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.6749 7 320
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.6738 8 320
5fya-assembly1.cif.gz_A cubic crystal of the native plpd 0.667 8 320
5fqu-assembly1.cif.gz_B orthorhombic crystal structure of of plpd (selenomethionine derivative) 0.6635 7 320
ID Description Score Start End Superfamily
af_L0TB61_98_310_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.8912 97 324 3.40.1090.10
af_L0TB61_98_310_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.879 97 324 3.40.1090.10
af_A2AJ88_944_1192_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.732 4 213 3.40.1090.10
af_O69695_801_1044_3.40.1090.10 Alpha Beta;3-Layer(aba) Sandwich;Cytosolic phospholipase A2 catalytic domain;Cytosolic phospholipase A2 catalytic domain 0.682 7 307 3.40.1090.10
af_P9WNZ1_7_185_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.6794 4 41 3.40.50.1950
ID Description Score Start End GO Terms
AF-A0A4R5X7B8-F1-model_v4 Phospholipase 0.9835 5 332 GO:0016042
GO:0016787
AF-A0A4R5X7B8-F1-model_v4 Phospholipase 0.9747 5 332 GO:0016042
GO:0016787
AF-X8CA53-F1-model_v4 Patatin-like phospholipase family protein 0.9556 106 332 GO:0006629
AF-A0A7I7SDR1-F1-model_v4 Phospholipase 0.9545 1 331 GO:0016042
GO:0016787
AF-A0A7I7SDR1-F1-model_v4 Phospholipase 0.9489 1 331 GO:0016042
GO:0016787

Feature Viewer

pLDDT pTM Quality
80.75 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map