F447355

General Info

Members Datasets Scaffolds Average Seq Length
454 289 908 336

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10040976|Ga0081455_100409763
Length 338
Sequence MSNHFTGLSLGPPLGDQRLDLCDLYAFQSPRDPSRTAIILNANPQADQFHPDAIYRLNIDNDGDCLTDIAFTYVFSPVANGRQTASVYVAKGAESHSVEPVGTKIISDAEVSLGRTPNIVRSGNYTFFAGSRSDAFFFDFDGIKALFDTSGGRNFTAPHHIGGGKSPWTSVDSNTQANVLSTVIELPTSELGGKPGVRIWGRCSLRRDGKLLHVDRAGHPSVSSFFNTDDTKEEYNASEPVNDRNRWTEMFIHLMGHTGDYTREEAIAAIDAHAILPDMLSFDPSKPAKYPNGRVFTDDVIDFRLAFLTKGDCPPSGLKPHTDVLTEFPYLGPPHGKS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
158 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
173 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
174 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
195 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
196 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
226 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
255 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
276 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
277 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
278 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
282 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
283 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
284 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
285 2849660919 Nostoc sp. T09 Isolate Unclassified
286 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
287 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
288 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
289 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.8
Metatranscriptomes 0.22
Isolates 1.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.83
Nodule 0
Rhizoplane 10.35
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10040976 3300005937 Bacteria 4079
2 JGI25405J52794_10016209 3300003911 Bacteria 1470
3 Ga0065707_10113354 3300005295 Bacteria 2330
4 Ga0065707_10133956 3300005295 Bacteria 1873
5 Ga0070658_10294572 3300005327 Bacteria 1383
6 Ga0070683_100009765 3300005329 Bacteria 8221
7 Ga0068869_100125091 3300005334 Bacteria 1971
8 Ga0070666_10054901 3300005335 Bacteria 2688
9 Ga0070689_100095325 3300005340 Bacteria 2350
10 Ga0070689_100212295 3300005340 Bacteria 1585
11 Ga0070692_10112618 3300005345 Bacteria 1507
12 Ga0070669_100052229 3300005353 Bacteria 2990
13 Ga0070675_100092380 3300005354 Bacteria 2537
14 Ga0070674_100023393 3300005356 Bacteria 3999
15 Ga0070674_100074814 3300005356 Bacteria 2404
16 Ga0070673_100186762 3300005364 Bacteria 1778
17 Ga0070673_100280329 3300005364 Bacteria 1462
18 Ga0070688_100017566 3300005365 Bacteria 4108
19 Ga0070709_10029097 3300005434 Bacteria 3301
20 Ga0070714_100051450 3300005435 Bacteria 3511
21 Ga0070714_100150824 3300005435 Bacteria 2095
22 Ga0070713_100025291 3300005436 Bacteria 4639
23 Ga0070713_100501976 3300005436 Bacteria 1145
24 Ga0070710_10020516 3300005437 Bacteria 3430
25 Ga0070701_10053254 3300005438 Bacteria 2105
26 Ga0070711_100001631 3300005439 Bacteria 12392
27 Ga0070711_100045111 3300005439 Bacteria 2996
28 Ga0070705_100090381 3300005440 Bacteria 1906
29 Ga0070700_100076036 3300005441 Bacteria 2155
30 Ga0070694_100120122 3300005444 Bacteria 1884
31 Ga0070678_100154144 3300005456 Bacteria 1854
32 Ga0070681_10011677 3300005458 Bacteria 8699
33 Ga0070681_10184974 3300005458 Bacteria 2004
34 Ga0070706_100059686 3300005467 Bacteria 3521
35 Ga0070698_100314622 3300005471 Bacteria 1496
36 Ga0070699_100341429 3300005518 Bacteria 1348
37 Ga0070684_100156462 3300005535 Bacteria 2067
38 Ga0070697_100036563 3300005536 Bacteria 3967
39 Ga0070697_100200483 3300005536 Bacteria 1696
40 Ga0068853_100083929 3300005539 Bacteria 2791
41 Ga0070695_100150930 3300005545 Bacteria 1622
42 Ga0070665_100003659 3300005548 Bacteria 16287
43 Ga0070665_100022679 3300005548 Bacteria 6320
44 Ga0070665_100217848 3300005548 Bacteria 1909
45 Ga0070704_100391823 3300005549 Bacteria 1183
46 Ga0068855_100214324 3300005563 Bacteria 2162
47 Ga0070664_100001685 3300005564 Bacteria 17708
48 Ga0070664_100450778 3300005564 Bacteria 1181
49 Ga0068857_100313272 3300005577 Bacteria 1448
50 Ga0068854_100118843 3300005578 Bacteria 2003
51 Ga0068856_100023982 3300005614 Bacteria 5934
52 Ga0068856_100220625 3300005614 Bacteria 1911
53 Ga0068852_100126595 3300005616 Bacteria 2347
54 Ga0068852_100130980 3300005616 Bacteria 2310
55 Ga0068859_100063135 3300005617 Bacteria 3735
56 Ga0068864_100029347 3300005618 Bacteria 4657
57 Ga0068866_10074537 3300005718 Bacteria 1804
58 Ga0068861_100007259 3300005719 Bacteria 7594
59 Ga0068861_100036982 3300005719 Bacteria 3627
60 Ga0068863_100052023 3300005841 Bacteria 3882
61 Ga0068858_100017087 3300005842 Bacteria 6809
62 Ga0068858_100197119 3300005842 Bacteria 1903
63 Ga0068858_100403262 3300005842 Bacteria 1314
64 Ga0068862_100005683 3300005844 Bacteria 10407
65 Ga0068862_100096261 3300005844 Bacteria 2584
66 Ga0068862_100222636 3300005844 Bacteria 1709
67 Ga0081455_10013326 3300005937 Bacteria 8135
68 Ga0081538_10009663 3300005981 Bacteria 8015
69 Ga0081538_10019960 3300005981 Bacteria 4954
70 Ga0081538_10038355 3300005981 Bacteria 3092
71 Ga0081539_10092050 3300005985 Bacteria 1564
72 Ga0070717_10253951 3300006028 Bacteria 1554
73 Ga0075365_10003953 3300006038 Bacteria 7764
74 Ga0075365_10103915 3300006038 Bacteria 1948
75 Ga0075368_10051387 3300006042 Bacteria 1639
76 Ga0075363_100021027 3300006048 Bacteria 3280
77 Ga0075364_10022818 3300006051 Bacteria 3958
78 Ga0070715_10013479 3300006163 Bacteria 3004
79 Ga0070715_10060263 3300006163 Bacteria 1663
80 Ga0070716_100125932 3300006173 Bacteria 1611
81 Ga0070716_100175087 3300006173 Bacteria 1404
82 Ga0070712_100014043 3300006175 Bacteria 5133
83 Ga0070712_100014484 3300006175 Bacteria 5062
84 Ga0075367_10119454 3300006178 Bacteria 1623
85 Ga0075369_10000465 3300006186 Bacteria 12424
86 Ga0075369_10002022 3300006186 Bacteria 7147
87 Ga0097621_100020111 3300006237 Bacteria 5140
88 Ga0097621_100377922 3300006237 Bacteria 1265
89 Ga0075370_10066245 3300006353 Bacteria 2060
90 Ga0068871_100287223 3300006358 Bacteria 1440
91 Ga0075428_100268880 3300006844 Bacteria 1834
92 Ga0075428_100329351 3300006844 Bacteria 1641
93 Ga0075428_100469788 3300006844 Bacteria 1347
94 Ga0075430_100164759 3300006846 Bacteria 1845
95 Ga0075431_100062995 3300006847 Bacteria 3827
96 Ga0075431_100226216 3300006847 Bacteria 1907
97 Ga0075434_100078726 3300006871 Bacteria 3292
98 Ga0075429_100166576 3300006880 Bacteria 1930
99 Ga0068865_100057845 3300006881 Bacteria 2706
100 Ga0075436_100010704 3300006914 Bacteria 6291
101 Ga0075436_100062691 3300006914 Bacteria 2570
102 Ga0097620_100063137 3300006931 Bacteria 3735
103 Ga0075435_100271593 3300007076 Bacteria 1446
104 Ga0099794_10011054 3300007265 Bacteria 3856
105 Ga0099794_10034769 3300007265 Bacteria 2376
106 Ga0099795_10033886 3300007788 Bacteria 1776
107 Ga0105240_10603409 3300009093 Bacteria 1208
108 Ga0105245_10002137 3300009098 Bacteria 17895
109 Ga0105247_10008964 3300009101 Bacteria 6097
110 Ga0105247_10093965 3300009101 Bacteria 1907
111 Ga0105243_10019506 3300009148 Bacteria 5140
112 Ga0105243_10229726 3300009148 Bacteria 1645
113 Ga0105241_10072193 3300009174 Bacteria 2682
114 Ga0105242_10039343 3300009176 Bacteria 3805
115 Ga0105248_10048466 3300009177 Bacteria 4766
116 Ga0105248_10186349 3300009177 Bacteria 2338
117 Ga0105248_10361865 3300009177 Bacteria 1633
118 Ga0105237_10062277 3300009545 Bacteria 3730
119 Ga0105237_10336586 3300009545 Bacteria 1514
120 Ga0105237_10452890 3300009545 Bacteria 1289
121 Ga0105238_10072681 3300009551 Bacteria 3434
122 Ga0105249_10023733 3300009553 Bacteria 5507
123 Ga0105249_10059029 3300009553 Bacteria 3517
124 Ga0099796_10026967 3300010159 Bacteria 1830
125 Ga0105239_10067491 3300010375 Bacteria 3929
126 Ga0105239_10210152 3300010375 Bacteria 2181
127 Ga0105239_10334417 3300010375 Bacteria 1709
128 Ga0105239_10687157 3300010375 Bacteria 1170
129 Ga0105246_10056649 3300011119 Bacteria 2710
130 Ga0157370_10166206 3300013104 Bacteria 2052
131 Ga0157369_10172295 3300013105 Bacteria 2280
132 Ga0157374_10028948 3300013296 Bacteria 5008
133 Ga0157374_10043780 3300013296 Bacteria 4136
134 Ga0157374_10352029 3300013296 Bacteria 1463
135 Ga0157378_10041011 3300013297 Bacteria 4106
136 Ga0163162_10082963 3300013306 Bacteria 3278
137 Ga0157372_10085586 3300013307 Bacteria 3576
138 Ga0157375_10001979 3300013308 Bacteria 17684
139 Ga0157379_10009472 3300014968 Bacteria 8486
140 Ga0157379_10025907 3300014968 Bacteria 5214
141 Ga0157376_10002781 3300014969 Bacteria 11949
142 Ga0213874_10017408 3300021377 Bacteria 1927
143 Ga0224572_1000166 3300024225 Bacteria 5922
144 Ga0209758_1040082 3300025297 Bacteria 1771
145 Ga0207426_1000338 3300025302 Bacteria 88019
146 Ga0207426_1004450 3300025302 Bacteria 6832
147 Ga0207426_1026004 3300025302 Bacteria 1965
148 Ga0209051_1039173 3300025303 Bacteria 1715
149 Ga0207653_10036221 3300025885 Bacteria 1607
150 Ga0207692_10118245 3300025898 Bacteria 1480
151 Ga0207710_10002834 3300025900 Bacteria 7899
152 Ga0207688_10030230 3300025901 Bacteria 2986
153 Ga0207680_10041253 3300025903 Bacteria 2691
154 Ga0207685_10014289 3300025905 Bacteria 2482
155 Ga0207685_10068426 3300025905 Bacteria 1431
156 Ga0207645_10186993 3300025907 Bacteria 1360
157 Ga0207684_10166765 3300025910 Bacteria 1898
158 Ga0207684_10294958 3300025910 Bacteria 1398
159 Ga0207707_10027796 3300025912 Bacteria 4946
160 Ga0207707_10043419 3300025912 Bacteria 3922
161 Ga0207671_10209333 3300025914 Bacteria 1525
162 Ga0207693_10004827 3300025915 Bacteria 11340
163 Ga0207693_10037787 3300025915 Bacteria 3805
164 Ga0207693_10171843 3300025915 Bacteria 1706
165 Ga0207663_10000819 3300025916 Bacteria 14055
166 Ga0207663_10051180 3300025916 Bacteria 2570
167 Ga0207657_10184924 3300025919 Bacteria 1683
168 Ga0207681_10095177 3300025923 Bacteria 2136
169 Ga0207681_10103603 3300025923 Bacteria 2057
170 Ga0207694_10021331 3300025924 Bacteria 4907
171 Ga0207694_10359456 3300025924 Bacteria 1206
172 Ga0207650_10370473 3300025925 Bacteria 1181
173 Ga0207659_10045850 3300025926 Bacteria 3085
174 Ga0207659_10074324 3300025926 Bacteria 2491
175 Ga0207687_10016437 3300025927 Bacteria 4861
176 Ga0207687_10025003 3300025927 Bacteria 3995
177 Ga0207700_10039461 3300025928 Bacteria 3438
178 Ga0207700_10135462 3300025928 Bacteria 2017
179 Ga0207700_10301968 3300025928 Bacteria 1383
180 Ga0207706_10004419 3300025933 Bacteria 13212
181 Ga0207706_10172311 3300025933 Bacteria 1901
182 Ga0207686_10264210 3300025934 Bacteria 1263
183 Ga0207709_10020849 3300025935 Bacteria 3702
184 Ga0207670_10042512 3300025936 Bacteria 2995
185 Ga0207670_10193935 3300025936 Bacteria 1539
186 Ga0207669_10048730 3300025937 Bacteria 2519
187 Ga0207704_10002001 3300025938 Bacteria 9141
188 Ga0207665_10000851 3300025939 Bacteria 20622
189 Ga0207665_10016935 3300025939 Bacteria 4785
190 Ga0207665_10023817 3300025939 Bacteria 4032
191 Ga0207689_10010929 3300025942 Bacteria 7804
192 Ga0207661_10047389 3300025944 Bacteria 3411
193 Ga0207679_10004079 3300025945 Bacteria 9063
194 Ga0207667_10051141 3300025949 Bacteria 4357
195 Ga0207712_10075416 3300025961 Bacteria 2438
196 Ga0207712_10208256 3300025961 Bacteria 1555
197 Ga0207668_10040160 3300025972 Bacteria 3155
198 Ga0207640_10084165 3300025981 Bacteria 2183
199 Ga0207640_10100620 3300025981 Bacteria 2026
200 Ga0207658_10050337 3300025986 Bacteria 3065
201 Ga0207658_10140201 3300025986 Bacteria 1955
202 Ga0207703_10080058 3300026035 Bacteria 2720
203 Ga0207703_10390573 3300026035 Bacteria 1289
204 Ga0207639_10137405 3300026041 Bacteria 2032
205 Ga0207708_10007385 3300026075 Bacteria 8124
206 Ga0207708_10155154 3300026075 Bacteria 1805
207 Ga0207702_10010200 3300026078 Bacteria 7864
208 Ga0207702_10159658 3300026078 Bacteria 2058
209 Ga0207648_10277077 3300026089 Bacteria 1499
210 Ga0207676_10026938 3300026095 Bacteria 4277
211 Ga0207674_10109552 3300026116 Bacteria 2737
212 Ga0207674_10300354 3300026116 Bacteria 1554
213 Ga0207675_100013384 3300026118 Bacteria 7655
214 Ga0207683_10231698 3300026121 Bacteria 1684
215 Ga0207698_10224058 3300026142 Bacteria 1702
216 Ga0268266_10002866 3300028379 Bacteria 17937
217 Ga0268266_10030528 3300028379 Bacteria 4579
218 Ga0268266_10277206 3300028379 Bacteria 1558
219 Ga0268266_10346018 3300028379 Bacteria 1396
220 Ga0268265_10192319 3300028380 Bacteria 1763
221 Ga0268264_10042260 3300028381 Bacteria 3773
222 Ga0265760_10011582 3300031090 Bacteria 2520
223 Ga0265325_10018761 3300031241 Bacteria 3835
224 Ga0265340_10003888 3300031247 Bacteria 8417
225 Ga0265340_10040255 3300031247 Bacteria 2303
226 Ga0265331_10003786 3300031250 Bacteria 9598
227 Ga0265331_10007577 3300031250 Bacteria 6264
228 Ga0265331_10023162 3300031250 Bacteria 3160
229 Ga0265327_10019330 3300031251 Bacteria 4192
230 Ga0265327_10123503 3300031251 Bacteria 1224
231 Ga0265316_10038122 3300031344 Bacteria 3876
232 Ga0265313_10001336 3300031595 Bacteria 23225
233 Ga0265313_10021491 3300031595 Bacteria 3528
234 Ga0265314_10050234 3300031711 Bacteria 2914
235 Ga0373926_0021392 3300035083 Bacteria 2240
236 Ga0373945_0010644 3300035116 Bacteria 3032
237 Ga0373945_0023738 3300035116 Bacteria 2121
238 Ga0373953_0072027 3300035117 Bacteria 1427
239 Ga0373954_0031028 3300035118 Bacteria 2465
240 Ga0373954_0063674 3300035118 Bacteria 1743
241 Ga0373956_0012825 3300035119 Bacteria 3480
242 Ga0373946_0129358 3300035171 Bacteria 1160
243 Ga0373955_0014385 3300035172 Bacteria 3848
244 Ga0373955_0111240 3300035172 Bacteria 1584
245 Ga0373931_0009606 3300035691 Bacteria 4631
246 Ga0373931_0057811 3300035691 Bacteria 2081
247 Ga0373935_0239557 3300035692 Bacteria 1266
248 Ga0373927_0037448 3300035695 Bacteria 3152
249 Ga0373933_0003210 3300035724 Bacteria 9125
250 Ga0373933_0044571 3300035724 Bacteria 2628
251 Ga0373937_0001938 3300036401 Bacteria 17317
252 Ga0373937_0219711 3300036401 Bacteria 1789
253 Ga0373925_0000062 3300037068 Bacteria 114902
254 Ga0373925_0040463 3300037068 Bacteria 3451
255 Ga0373925_0219465 3300037068 Bacteria 1517
256 Ga0237819_11442 3300038705 Bacteria 1123
257 Ga0436365_0478007 3300039437 Bacteria 9450
258 Ga0436360_0327711 3300039438 Bacteria 1216
259 Ga0436363_1388743 3300039450 Bacteria 1936
260 Ga0436362_0702198 3300039453 Bacteria 1756
261 Ga0439461_0019387 3300041410 Bacteria 1339
262 Ga0439448_0001674 3300042005 Bacteria 5819
263 Ga0439448_0055697 3300042005 Bacteria 1301
264 Ga0439450_016885 3300042008 Bacteria 1515
265 Ga0439460_0046309 3300042461 Bacteria 1292
266 Ga0466960_0009606 3300044901 Bacteria 3993
267 Ga0466959_0008043 3300045049 Bacteria 7430
268 Ga0451576_0285049 3300045051 Bacteria 1727
269 Ga0466967_0140466 3300045976 Bacteria 2249
270 Ga0495592_0030019 3300046454 Bacteria 4112
271 Ga0495603_0133515 3300046455 Bacteria 1445
272 Ga0495629_0010388 3300046459 Bacteria 6776
273 Ga0495629_0069728 3300046459 Bacteria 2453
274 Ga0495638_0001822 3300046460 Bacteria 18494
275 Ga0495638_0004348 3300046460 Bacteria 10736
276 Ga0495638_0105137 3300046460 Bacteria 1683
277 Ga0495651_0000210 3300046462 Bacteria 44718
278 Ga0495653_0000528 3300046463 Bacteria 29299
279 Ga0495653_0058326 3300046463 Bacteria 2935
280 Ga0495662_0087046 3300046476 Bacteria 1522
281 Ga0495664_0037410 3300046477 Bacteria 2864
282 Ga0495585_0120189 3300046492 Bacteria 1390
283 Ga0495594_0122988 3300046499 Bacteria 1467
284 Ga0495607_0069759 3300046501 Bacteria 1966
285 Ga0495608_0012907 3300046511 Bacteria 5798
286 Ga0495618_0015423 3300046514 Bacteria 4664
287 Ga0495618_0023937 3300046514 Bacteria 3781
288 Ga0495628_0077500 3300046516 Bacteria 2585
289 Ga0495630_0071878 3300046517 Bacteria 2604
290 Ga0495630_0127588 3300046517 Bacteria 1931
291 Ga0495652_0065719 3300046529 Bacteria 3046
292 Ga0495665_0068181 3300046531 Bacteria 1876
293 Ga0495665_0145475 3300046531 Bacteria 1238
294 Ga0495640_0002763 3300046533 Bacteria 14109
295 Ga0495640_0015597 3300046533 Bacteria 5710
296 Ga0495640_0020110 3300046533 Bacteria 4919
297 Ga0495640_0042216 3300046533 Bacteria 3184
298 Ga0495640_0093268 3300046533 Bacteria 1984
299 Ga0495587_0000572 3300046536 Bacteria 25284
300 Ga0495587_0045940 3300046536 Bacteria 2594
301 Ga0495645_0043258 3300046543 Bacteria 3285
302 Ga0495645_0069627 3300046543 Bacteria 2540
303 Ga0495622_0022377 3300046557 Bacteria 2945
304 Ga0495667_0012093 3300046559 Bacteria 5846
305 Ga0495656_0021574 3300046615 Bacteria 2509
306 Ga0495634_0005003 3300046642 Bacteria 10238
307 Ga0495634_0031284 3300046642 Bacteria 3666
308 Ga0495634_0112014 3300046642 Bacteria 1754
309 Ga0495634_0122201 3300046642 Bacteria 1667
310 Ga0495611_0075287 3300046648 Bacteria 1547
311 Ga0495635_0001564 3300046663 Bacteria 15359
312 Ga0495635_0001925 3300046663 Bacteria 14124
313 Ga0495588_0049623 3300046674 Bacteria 2159
314 Ga0495599_0032597 3300046678 Bacteria 3270
315 Ga0495623_0036437 3300046679 Bacteria 3151
316 Ga0495623_0051993 3300046679 Bacteria 2590
317 Ga0495623_0054687 3300046679 Bacteria 2518
318 Ga0495646_0057464 3300046680 Bacteria 2328
319 Ga0495658_0230062 3300046683 Bacteria 1162
320 Ga0495613_0018157 3300046689 Bacteria 5243
321 Ga0495624_0016645 3300046690 Bacteria 4949
322 Ga0495649_0123395 3300046694 Bacteria 1369
323 Ga0495600_0001587 3300046809 Bacteria 12627
324 Ga0495604_0000186 3300047317 Bacteria 55450
325 Ga0495604_0097202 3300047317 Bacteria 2172
326 Ga0495674_0013760 3300047319 Bacteria 7596
327 Ga0495674_0055673 3300047319 Bacteria 3467
328 Ga0495674_0249999 3300047319 Bacteria 1459
329 Ga0495676_0048171 3300047321 Bacteria 3439
330 Ga0495676_0066456 3300047321 Bacteria 2794
331 Ga0495680_0000924 3300047322 Bacteria 32584
332 Ga0495675_0000802 3300047444 Bacteria 19371
333 Ga0495684_0001047 3300047471 Bacteria 22374
334 Ga0495684_0141000 3300047471 Bacteria 1807
335 Ga0495684_0294500 3300047471 Bacteria 1167
336 Ga0495593_0027965 3300047673 Bacteria 3100
337 Ga0495602_0002489 3300048088 Bacteria 18784
338 Ga0495602_0043942 3300048088 Bacteria 4056
339 Ga0496100_0000351 3300048903 Bacteria 22387
340 Ga0496100_0029230 3300048903 Bacteria 3407
341 Ga0496100_0110608 3300048903 Bacteria 1908
342 Ga0496100_0160162 3300048903 Bacteria 1613
343 Ga0496100_0218470 3300048903 Bacteria 1398
344 Ga0496101_0000573 3300048904 Bacteria 22521
345 Ga0496101_0101338 3300048904 Bacteria 2156
346 Ga0496101_0180986 3300048904 Bacteria 1623
347 Ga0496102_0439118 3300048905 Bacteria 1225
348 Ga0496104_0001083 3300048907 Bacteria 23253
349 Ga0496104_0008186 3300048907 Bacteria 9282
350 Ga0496104_0008719 3300048907 Bacteria 9015
351 Ga0496104_0033729 3300048907 Bacteria 4771
352 Ga0496104_0062875 3300048907 Bacteria 3520
353 Ga0496104_0094258 3300048907 Bacteria 2864
354 Ga0496105_0027397 3300048908 Bacteria 4655
355 Ga0496105_0042120 3300048908 Bacteria 3764
356 Ga0496105_0194811 3300048908 Bacteria 1656
357 Ga0496105_0225973 3300048908 Bacteria 1522
358 Ga0496106_0000883 3300048909 Bacteria 21852
359 Ga0496106_0001925 3300048909 Bacteria 15564
360 Ga0496106_0291123 3300048909 Bacteria 1309
361 Ga0496107_0004812 3300048910 Bacteria 9165
362 Ga0496107_0041427 3300048910 Bacteria 3306
363 Ga0496108_0001432 3300048911 Bacteria 18832
364 Ga0496108_0133624 3300048911 Bacteria 2133
365 Ga0496108_0183946 3300048911 Bacteria 1810
366 Ga0496109_0005809 3300048912 Bacteria 10335
367 Ga0496109_0069226 3300048912 Bacteria 3236
368 Ga0496109_0170348 3300048912 Bacteria 2042
369 Ga0496110_0121042 3300048913 Bacteria 2358
370 Ga0496111_0204444 3300048914 Bacteria 1468
371 Ga0496112_0039184 3300048915 Bacteria 4629
372 Ga0496112_0074625 3300048915 Bacteria 3354
373 Ga0496112_0116537 3300048915 Bacteria 2642
374 Ga0496112_0160909 3300048915 Bacteria 2211
375 Ga0496113_0036035 3300048916 Bacteria 3623
376 Ga0496113_0049235 3300048916 Bacteria 3137
377 Ga0496113_0147054 3300048916 Bacteria 1857
378 Ga0496114_0078835 3300048917 Bacteria 2779
379 Ga0496114_0206771 3300048917 Bacteria 1721
380 Ga0496115_0020697 3300048918 Bacteria 5075
381 Ga0496115_0035733 3300048918 Bacteria 3933
382 Ga0496115_0037692 3300048918 Bacteria 3832
383 Ga0496115_0067407 3300048918 Bacteria 2895
384 Ga0496115_0116091 3300048918 Bacteria 2201
385 Ga0496115_0159056 3300048918 Bacteria 1867
386 Ga0496126_0035891 3300048929 Bacteria 4640
387 Ga0501032_0010247 3300049569 Bacteria 6763
388 Ga0501034_0000826 3300049571 Bacteria 46024
389 Ga0501034_0008942 3300049571 Bacteria 10531
390 Ga0501034_0012184 3300049571 Bacteria 8893
391 Ga0501034_0108580 3300049571 Bacteria 2766
392 Ga0501036_0017892 3300049572 Bacteria 5933
393 Ga0501037_0000167 3300049573 Bacteria 61779
394 Ga0501038_0003744 3300049574 Bacteria 14160
395 Ga0501039_0002467 3300049575 Bacteria 13771
396 Ga0501041_0205550 3300049577 Bacteria 1235
397 Ga0501043_0013914 3300049579 Bacteria 6296
398 Ga0501046_0029542 3300049580 Bacteria 4455
399 Ga0501047_0262298 3300049581 Bacteria 1575
400 Ga0501068_0006678 3300049584 Bacteria 6372
401 Ga0501070_0003715 3300049586 Bacteria 13186
402 Ga0501075_0259648 3300049591 Bacteria 1324
403 Ga0501239_001179 3300049672 Bacteria 2204
404 Ga0501268_000865 3300049765 Bacteria 3529
405 Ga0501044_0015489 3300049823 Bacteria 8212
406 Ga0501044_0066296 3300049823 Bacteria 3682
407 nmdc:mga0yw44_3197_c1 3300050492 Bacteria 7209
408 nmdc:mga0yw44_3510_c1 3300050492 Bacteria 6981
409 nmdc:mga0yw44_93007_c1 3300050492 Bacteria 1909
410 nmdc:mga06z11_14039_c1 3300050494 Bacteria 3535
411 nmdc:mga07m45_14840_c1 3300050496 Bacteria 4159
412 nmdc:mga09592_86082_c1 3300050508 Bacteria 2681
413 nmdc:mga0qj67_66870_c1 3300050509 Bacteria 2863
414 nmdc:mga06r32_135263_c1 3300050510 Bacteria 2439
415 nmdc:mga06r32_54308_c1 3300050510 Bacteria 3841
416 nmdc:mga06r32_94055_c1 3300050510 Bacteria 2933
417 nmdc:mga0n895_119775_c1 3300050512 Bacteria 2653
418 nmdc:mga0rr50_248683_c1 3300050513 Bacteria 1476
419 nmdc:mga08x19_1785_c1 3300050514 Bacteria 13230
420 nmdc:mga08x19_84321_c1 3300050514 Bacteria 2090
421 nmdc:mga0a205_95537_c1 3300050515 Bacteria 2871
422 nmdc:mga0sz30_3190_c1 3300050516 Bacteria 5878
423 nmdc:mga0sz30_3317_c1 3300050516 Bacteria 5789
424 Ga0495601_0000669 3300053077 Bacteria 18279
425 Ga0495601_0010212 3300053077 Bacteria 5581
426 Ga0495601_0024488 3300053077 Bacteria 3717
427 Ga0495601_0158581 3300053077 Bacteria 1478
428 Ga0495601_0163994 3300053077 Unclassified 1452
429 Ga0495612_0000178 3300053078 Bacteria 26879
430 Ga0495612_0009725 3300053078 Bacteria 3894
431 Ga0500635_0071294 3300053080 Bacteria 1233
432 Ga0495595_0000871 3300053084 Bacteria 11574
433 Ga0495619_0000480 3300053085 Bacteria 26747
434 Ga0495619_0035684 3300053085 Bacteria 3235
435 Ga0495619_0074458 3300053085 Bacteria 2277
436 Ga0500556_0014852 3300053104 Bacteria 2387
437 Ga0500562_010040 3300053108 Bacteria 2396
438 Ga0500608_103683 3300053122 Bacteria 1314
439 Ga0500652_030672 3300053131 Bacteria 2104
440 Ga0500616_0025892 3300053153 Bacteria 3252
441 Ga0500616_0080370 3300053153 Bacteria 1639
442 Ga0500627_0006317 3300053158 Bacteria 4025
443 Ga0500645_000006 3300053730 Bacteria 276677
444 Ga0500645_023410 3300053730 Bacteria 1893
445 Ga0501084_0373207 3300054114 Bacteria 1205
446 2738664912 2738541264 Bacteria 5935393
447 2738704359 2738541274 Bacteria 6909446
448 2739144046 2738541356 Bacteria 5935017
449 2739331158 2738543028 Bacteria 6917070
450 2849664416 2849660919 Bacteria 8251853
451 2902799527 2902799365 Bacteria 5419524
452 2939583631 2939582691 Bacteria 7088898
453 2990088241 2990088156 Bacteria 6657676
454 3006326518 3006321560 Bacteria 8247479
455 Ga0081455_10040976
456 JGI25405J52794_10016209
457 Ga0065707_10113354
458 Ga0065707_10133956
459 Ga0070658_10294572
460 Ga0070683_100009765
461 Ga0068869_100125091
462 Ga0070666_10054901
463 Ga0070689_100095325
464 Ga0070689_100212295
465 Ga0070692_10112618
466 Ga0070669_100052229
467 Ga0070675_100092380
468 Ga0070674_100023393
469 Ga0070674_100074814
470 Ga0070673_100186762
471 Ga0070673_100280329
472 Ga0070688_100017566
473 Ga0070709_10029097
474 Ga0070714_100051450
475 Ga0070714_100150824
476 Ga0070713_100025291
477 Ga0070713_100501976
478 Ga0070710_10020516
479 Ga0070701_10053254
480 Ga0070711_100001631
481 Ga0070711_100045111
482 Ga0070705_100090381
483 Ga0070700_100076036
484 Ga0070694_100120122
485 Ga0070678_100154144
486 Ga0070681_10011677
487 Ga0070681_10184974
488 Ga0070706_100059686
489 Ga0070698_100314622
490 Ga0070699_100341429
491 Ga0070684_100156462
492 Ga0070697_100036563
493 Ga0070697_100200483
494 Ga0068853_100083929
495 Ga0070695_100150930
496 Ga0070665_100003659
497 Ga0070665_100022679
498 Ga0070665_100217848
499 Ga0070704_100391823
500 Ga0068855_100214324
501 Ga0070664_100001685
502 Ga0070664_100450778
503 Ga0068857_100313272
504 Ga0068854_100118843
505 Ga0068856_100023982
506 Ga0068856_100220625
507 Ga0068852_100126595
508 Ga0068852_100130980
509 Ga0068859_100063135
510 Ga0068864_100029347
511 Ga0068866_10074537
512 Ga0068861_100007259
513 Ga0068861_100036982
514 Ga0068863_100052023
515 Ga0068858_100017087
516 Ga0068858_100197119
517 Ga0068858_100403262
518 Ga0068862_100005683
519 Ga0068862_100096261
520 Ga0068862_100222636
521 Ga0081455_10013326
522 Ga0081538_10009663
523 Ga0081538_10019960
524 Ga0081538_10038355
525 Ga0081539_10092050
526 Ga0070717_10253951
527 Ga0075365_10003953
528 Ga0075365_10103915
529 Ga0075368_10051387
530 Ga0075363_100021027
531 Ga0075364_10022818
532 Ga0070715_10013479
533 Ga0070715_10060263
534 Ga0070716_100125932
535 Ga0070716_100175087
536 Ga0070712_100014043
537 Ga0070712_100014484
538 Ga0075367_10119454
539 Ga0075369_10000465
540 Ga0075369_10002022
541 Ga0097621_100020111
542 Ga0097621_100377922
543 Ga0075370_10066245
544 Ga0068871_100287223
545 Ga0075428_100268880
546 Ga0075428_100329351
547 Ga0075428_100469788
548 Ga0075430_100164759
549 Ga0075431_100062995
550 Ga0075431_100226216
551 Ga0075434_100078726
552 Ga0075429_100166576
553 Ga0068865_100057845
554 Ga0075436_100010704
555 Ga0075436_100062691
556 Ga0097620_100063137
557 Ga0075435_100271593
558 Ga0099794_10011054
559 Ga0099794_10034769
560 Ga0099795_10033886
561 Ga0105240_10603409
562 Ga0105245_10002137
563 Ga0105247_10008964
564 Ga0105247_10093965
565 Ga0105243_10019506
566 Ga0105243_10229726
567 Ga0105241_10072193
568 Ga0105242_10039343
569 Ga0105248_10048466
570 Ga0105248_10186349
571 Ga0105248_10361865
572 Ga0105237_10062277
573 Ga0105237_10336586
574 Ga0105237_10452890
575 Ga0105238_10072681
576 Ga0105249_10023733
577 Ga0105249_10059029
578 Ga0099796_10026967
579 Ga0105239_10067491
580 Ga0105239_10210152
581 Ga0105239_10334417
582 Ga0105239_10687157
583 Ga0105246_10056649
584 Ga0157370_10166206
585 Ga0157369_10172295
586 Ga0157374_10028948
587 Ga0157374_10043780
588 Ga0157374_10352029
589 Ga0157378_10041011
590 Ga0163162_10082963
591 Ga0157372_10085586
592 Ga0157375_10001979
593 Ga0157379_10009472
594 Ga0157379_10025907
595 Ga0157376_10002781
596 Ga0213874_10017408
597 Ga0224572_1000166
598 Ga0209758_1040082
599 Ga0207426_1000338
600 Ga0207426_1004450
601 Ga0207426_1026004
602 Ga0209051_1039173
603 Ga0207653_10036221
604 Ga0207692_10118245
605 Ga0207710_10002834
606 Ga0207688_10030230
607 Ga0207680_10041253
608 Ga0207685_10014289
609 Ga0207685_10068426
610 Ga0207645_10186993
611 Ga0207684_10166765
612 Ga0207684_10294958
613 Ga0207707_10027796
614 Ga0207707_10043419
615 Ga0207671_10209333
616 Ga0207693_10004827
617 Ga0207693_10037787
618 Ga0207693_10171843
619 Ga0207663_10000819
620 Ga0207663_10051180
621 Ga0207657_10184924
622 Ga0207681_10095177
623 Ga0207681_10103603
624 Ga0207694_10021331
625 Ga0207694_10359456
626 Ga0207650_10370473
627 Ga0207659_10045850
628 Ga0207659_10074324
629 Ga0207687_10016437
630 Ga0207687_10025003
631 Ga0207700_10039461
632 Ga0207700_10135462
633 Ga0207700_10301968
634 Ga0207706_10004419
635 Ga0207706_10172311
636 Ga0207686_10264210
637 Ga0207709_10020849
638 Ga0207670_10042512
639 Ga0207670_10193935
640 Ga0207669_10048730
641 Ga0207704_10002001
642 Ga0207665_10000851
643 Ga0207665_10016935
644 Ga0207665_10023817
645 Ga0207689_10010929
646 Ga0207661_10047389
647 Ga0207679_10004079
648 Ga0207667_10051141
649 Ga0207712_10075416
650 Ga0207712_10208256
651 Ga0207668_10040160
652 Ga0207640_10084165
653 Ga0207640_10100620
654 Ga0207658_10050337
655 Ga0207658_10140201
656 Ga0207703_10080058
657 Ga0207703_10390573
658 Ga0207639_10137405
659 Ga0207708_10007385
660 Ga0207708_10155154
661 Ga0207702_10010200
662 Ga0207702_10159658
663 Ga0207648_10277077
664 Ga0207676_10026938
665 Ga0207674_10109552
666 Ga0207674_10300354
667 Ga0207675_100013384
668 Ga0207683_10231698
669 Ga0207698_10224058
670 Ga0268266_10002866
671 Ga0268266_10030528
672 Ga0268266_10277206
673 Ga0268266_10346018
674 Ga0268265_10192319
675 Ga0268264_10042260
676 Ga0265760_10011582
677 Ga0265325_10018761
678 Ga0265340_10003888
679 Ga0265340_10040255
680 Ga0265331_10003786
681 Ga0265331_10007577
682 Ga0265331_10023162
683 Ga0265327_10019330
684 Ga0265327_10123503
685 Ga0265316_10038122
686 Ga0265313_10001336
687 Ga0265313_10021491
688 Ga0265314_10050234
689 Ga0373926_0021392
690 Ga0373945_0010644
691 Ga0373945_0023738
692 Ga0373953_0072027
693 Ga0373954_0031028
694 Ga0373954_0063674
695 Ga0373956_0012825
696 Ga0373946_0129358
697 Ga0373955_0014385
698 Ga0373955_0111240
699 Ga0373931_0009606
700 Ga0373931_0057811
701 Ga0373935_0239557
702 Ga0373927_0037448
703 Ga0373933_0003210
704 Ga0373933_0044571
705 Ga0373937_0001938
706 Ga0373937_0219711
707 Ga0373925_0000062
708 Ga0373925_0040463
709 Ga0373925_0219465
710 Ga0237819_11442
711 Ga0436365_0478007
712 Ga0436360_0327711
713 Ga0436363_1388743
714 Ga0436362_0702198
715 Ga0439461_0019387
716 Ga0439448_0001674
717 Ga0439448_0055697
718 Ga0439450_016885
719 Ga0439460_0046309
720 Ga0466960_0009606
721 Ga0466959_0008043
722 Ga0451576_0285049
723 Ga0466967_0140466
724 Ga0495592_0030019
725 Ga0495603_0133515
726 Ga0495629_0010388
727 Ga0495629_0069728
728 Ga0495638_0001822
729 Ga0495638_0004348
730 Ga0495638_0105137
731 Ga0495651_0000210
732 Ga0495653_0000528
733 Ga0495653_0058326
734 Ga0495662_0087046
735 Ga0495664_0037410
736 Ga0495585_0120189
737 Ga0495594_0122988
738 Ga0495607_0069759
739 Ga0495608_0012907
740 Ga0495618_0015423
741 Ga0495618_0023937
742 Ga0495628_0077500
743 Ga0495630_0071878
744 Ga0495630_0127588
745 Ga0495652_0065719
746 Ga0495665_0068181
747 Ga0495665_0145475
748 Ga0495640_0002763
749 Ga0495640_0015597
750 Ga0495640_0020110
751 Ga0495640_0042216
752 Ga0495640_0093268
753 Ga0495587_0000572
754 Ga0495587_0045940
755 Ga0495645_0043258
756 Ga0495645_0069627
757 Ga0495622_0022377
758 Ga0495667_0012093
759 Ga0495656_0021574
760 Ga0495634_0005003
761 Ga0495634_0031284
762 Ga0495634_0112014
763 Ga0495634_0122201
764 Ga0495611_0075287
765 Ga0495635_0001564
766 Ga0495635_0001925
767 Ga0495588_0049623
768 Ga0495599_0032597
769 Ga0495623_0036437
770 Ga0495623_0051993
771 Ga0495623_0054687
772 Ga0495646_0057464
773 Ga0495658_0230062
774 Ga0495613_0018157
775 Ga0495624_0016645
776 Ga0495649_0123395
777 Ga0495600_0001587
778 Ga0495604_0000186
779 Ga0495604_0097202
780 Ga0495674_0013760
781 Ga0495674_0055673
782 Ga0495674_0249999
783 Ga0495676_0048171
784 Ga0495676_0066456
785 Ga0495680_0000924
786 Ga0495675_0000802
787 Ga0495684_0001047
788 Ga0495684_0141000
789 Ga0495684_0294500
790 Ga0495593_0027965
791 Ga0495602_0002489
792 Ga0495602_0043942
793 Ga0496100_0000351
794 Ga0496100_0029230
795 Ga0496100_0110608
796 Ga0496100_0160162
797 Ga0496100_0218470
798 Ga0496101_0000573
799 Ga0496101_0101338
800 Ga0496101_0180986
801 Ga0496102_0439118
802 Ga0496104_0001083
803 Ga0496104_0008186
804 Ga0496104_0008719
805 Ga0496104_0033729
806 Ga0496104_0062875
807 Ga0496104_0094258
808 Ga0496105_0027397
809 Ga0496105_0042120
810 Ga0496105_0194811
811 Ga0496105_0225973
812 Ga0496106_0000883
813 Ga0496106_0001925
814 Ga0496106_0291123
815 Ga0496107_0004812
816 Ga0496107_0041427
817 Ga0496108_0001432
818 Ga0496108_0133624
819 Ga0496108_0183946
820 Ga0496109_0005809
821 Ga0496109_0069226
822 Ga0496109_0170348
823 Ga0496110_0121042
824 Ga0496111_0204444
825 Ga0496112_0039184
826 Ga0496112_0074625
827 Ga0496112_0116537
828 Ga0496112_0160909
829 Ga0496113_0036035
830 Ga0496113_0049235
831 Ga0496113_0147054
832 Ga0496114_0078835
833 Ga0496114_0206771
834 Ga0496115_0020697
835 Ga0496115_0035733
836 Ga0496115_0037692
837 Ga0496115_0067407
838 Ga0496115_0116091
839 Ga0496115_0159056
840 Ga0496126_0035891
841 Ga0501032_0010247
842 Ga0501034_0000826
843 Ga0501034_0008942
844 Ga0501034_0012184
845 Ga0501034_0108580
846 Ga0501036_0017892
847 Ga0501037_0000167
848 Ga0501038_0003744
849 Ga0501039_0002467
850 Ga0501041_0205550
851 Ga0501043_0013914
852 Ga0501046_0029542
853 Ga0501047_0262298
854 Ga0501068_0006678
855 Ga0501070_0003715
856 Ga0501075_0259648
857 Ga0501239_001179
858 Ga0501268_000865
859 Ga0501044_0015489
860 Ga0501044_0066296
861 nmdc:mga0yw44_3197_c1
862 nmdc:mga0yw44_3510_c1
863 nmdc:mga0yw44_93007_c1
864 nmdc:mga06z11_14039_c1
865 nmdc:mga07m45_14840_c1
866 nmdc:mga09592_86082_c1
867 nmdc:mga0qj67_66870_c1
868 nmdc:mga06r32_135263_c1
869 nmdc:mga06r32_54308_c1
870 nmdc:mga06r32_94055_c1
871 nmdc:mga0n895_119775_c1
872 nmdc:mga0rr50_248683_c1
873 nmdc:mga08x19_1785_c1
874 nmdc:mga08x19_84321_c1
875 nmdc:mga0a205_95537_c1
876 nmdc:mga0sz30_3190_c1
877 nmdc:mga0sz30_3317_c1
878 Ga0495601_0000669
879 Ga0495601_0010212
880 Ga0495601_0024488
881 Ga0495601_0158581
882 Ga0495601_0163994
883 Ga0495612_0000178
884 Ga0495612_0009725
885 Ga0500635_0071294
886 Ga0495595_0000871
887 Ga0495619_0000480
888 Ga0495619_0035684
889 Ga0495619_0074458
890 Ga0500556_0014852
891 Ga0500562_010040
892 Ga0500608_103683
893 Ga0500652_030672
894 Ga0500616_0025892
895 Ga0500616_0080370
896 Ga0500627_0006317
897 Ga0500645_000006
898 Ga0500645_023410
899 Ga0501084_0373207
900 2738664912
901 2738704359
902 2739144046
903 2739331158
904 2849664416
905 2902799527
906 2939583631
907 2990088241
908 3006326518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14224

DUF4331

Domain of unknown function (DUF4331)

13

111

0.84

PF14224

DUF4331

Domain of unknown function (DUF4331)

81

254

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8esw-assembly1.cif.gz_S3 structure of mitochondrial complex i from drosophila melanogaster, flexible-class 1 0.6775 17 42
7zmg-assembly1.cif.gz_G cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) 0.666 19 42
5cdh-assembly3.cif.gz_E structure of legionella pneumophila histidine acid phosphatase complexed with l(+)-tartrate 0.613 68 91
4f8c-assembly2.cif.gz_C structure of the cif:nedd8 complex - yersinia pseudotuberculosis cycle inhibiting factor in complex with human nedd8 0.5226 48 91
6x4g-assembly1.cif.gz_A crystal structure of icos in complex with icos-l and an anti icos-l vnar domain 0.4937 34 210
ID Description Score Start End Superfamily
af_Q09549_24_402_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.6716 66 90 3.40.50.1240
af_A0A0G2KGQ3_608_720_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6698 191 214 2.60.40.150
af_Q21412_3_165_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6196 66 98 3.30.420.10
5cdhG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.6187 68 91 3.40.50.1240
af_Q3U0X8_252_357_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5489 22 210 2.60.40.10
ID Description Score Start End GO Terms
AF-J1RHS4-F1-model_v4 DUF4331 domain-containing protein 0.9565 39 336
AF-J1RHS4-F1-model_v4 DUF4331 domain-containing protein 0.9442 39 336
AF-W9APX9-F1-model_v4 DUF4331 domain-containing protein 0.943 1 332
AF-A0A5S9PEC3-F1-model_v4 DUF4331 domain-containing protein 0.9419 15 332
AF-W9APX9-F1-model_v4 DUF4331 domain-containing protein 0.9375 1 332

Map