F447348

General Info

Members Datasets Scaffolds Average Seq Length
454 204 908 195

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100295609|Ga0068856_1002956092
Length 214
Sequence VGFVAQADAPAATVECVTQRPHHRPLTPGDRFFSGLDSGDDPVLLAEAADRAAELLVRGARASGDDQVAERVLHLADTEGIEVIAQAWAHRPADSVAGCLWRLYLLRSWVYADPVGVAREFDAGRRQAAVDDVVAGVADPPGPDELRDMVDQVLRGIAVGDFADVLLRAAAFARVVATGRALLADTDALAAARIQSVAEQLGRAARLELAGELT

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
108 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
109 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
110 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
111 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
112 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
135 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
138 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2643221561 Nocardioides sp. Root151 Isolate Unclassified
188 2643221576 Nocardioides sp. Root614 Isolate Unclassified
189 2643221590 Nocardioides sp. Root682 Isolate Unclassified
190 2643221604 Nocardioides sp. Root190 Isolate Unclassified
191 2643221617 Nocardioides sp. Root79 Isolate Unclassified
192 2643221620 Nocardioides sp. Root240 Isolate Unclassified
193 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
194 2643221696 Nocardioides sp. Root140 Isolate Unclassified
195 2738541305 Nocardioides sp. CF167 Isolate Unclassified
196 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
197 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
198 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
199 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
200 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
201 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
202 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
203 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
204 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0.66
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 9.91
Nodule 0
Rhizoplane 9.69
Rhizosphere 75.33
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100295609 3300005614 Bacteria 1637
2 LJQas_1006953 3300000549 Bacteria 1397
3 rootH1_10079093 3300003323 Bacteria 1780
4 Ga0006562J51391_1037182 3300003578 Bacteria 2869
5 Ga0070683_100001398 3300005329 Bacteria 18519
6 Ga0070683_100150793 3300005329 Bacteria 2204
7 Ga0068869_100435849 3300005334 Bacteria 1084
8 Ga0070666_10236497 3300005335 Bacteria 1291
9 Ga0070680_100314985 3300005336 Bacteria 1328
10 Ga0070682_100018966 3300005337 Bacteria 4029
11 Ga0070660_100058030 3300005339 Bacteria 3000
12 Ga0070660_100066788 3300005339 Bacteria 2801
13 Ga0070691_10384559 3300005341 Bacteria 787
14 Ga0070687_100068695 3300005343 Bacteria 1895
15 Ga0070661_100631715 3300005344 Bacteria 868
16 Ga0070692_10155485 3300005345 Bacteria 1306
17 Ga0070675_100155199 3300005354 Bacteria 1965
18 Ga0070659_100021202 3300005366 Bacteria 4943
19 Ga0070659_100647619 3300005366 Bacteria 911
20 Ga0070667_100062525 3300005367 Bacteria 3154
21 Ga0070701_10374024 3300005438 Bacteria 896
22 Ga0070678_101082663 3300005456 Bacteria 740
23 Ga0068867_100366674 3300005459 Bacteria 1206
24 Ga0070685_10071066 3300005466 Bacteria 2062
25 Ga0070698_100090068 3300005471 Bacteria 3051
26 Ga0070679_100079275 3300005530 Bacteria 3274
27 Ga0070679_100393636 3300005530 Bacteria 1332
28 Ga0070684_100000859 3300005535 Bacteria 21453
29 Ga0070684_100060898 3300005535 Bacteria 3303
30 Ga0070684_100162741 3300005535 Bacteria 2025
31 Ga0068853_100289074 3300005539 Bacteria 1513
32 Ga0070696_100087805 3300005546 Bacteria 2209
33 Ga0070693_100557956 3300005547 Bacteria 821
34 Ga0070665_100000606 3300005548 Bacteria 49390
35 Ga0070665_100090593 3300005548 Bacteria 3064
36 Ga0068855_100065608 3300005563 Bacteria 4232
37 Ga0070664_100080676 3300005564 Bacteria 2803
38 Ga0068857_100016723 3300005577 Bacteria 6426
39 Ga0068857_100552718 3300005577 Bacteria 1085
40 Ga0068861_100127866 3300005719 Bacteria 2058
41 Ga0068858_100218406 3300005842 Bacteria 1805
42 Ga0068862_100869884 3300005844 Bacteria 884
43 Ga0075365_10000585 3300006038 Bacteria 14182
44 Ga0075365_10009628 3300006038 Bacteria 5573
45 Ga0075365_10041611 3300006038 Bacteria 3003
46 Ga0075365_10059655 3300006038 Bacteria 2544
47 Ga0075365_10076826 3300006038 Bacteria 2255
48 Ga0075365_10148386 3300006038 Bacteria 1631
49 Ga0075365_10216784 3300006038 Bacteria 1342
50 Ga0075365_10289095 3300006038 Bacteria 1153
51 Ga0075365_10347188 3300006038 Bacteria 1046
52 Ga0075365_10418030 3300006038 Bacteria 947
53 Ga0075368_10000529 3300006042 Bacteria 11406
54 Ga0075363_100003967 3300006048 Bacteria 6396
55 Ga0075363_100020254 3300006048 Bacteria 3334
56 Ga0075363_100072516 3300006048 Bacteria 1872
57 Ga0075363_100142922 3300006048 Bacteria 1348
58 Ga0075364_10005556 3300006051 Bacteria 7346
59 Ga0075364_10011323 3300006051 Bacteria 5418
60 Ga0075364_10017885 3300006051 Bacteria 4432
61 Ga0075364_10422668 3300006051 Bacteria 910
62 Ga0075362_10006603 3300006177 Bacteria 4331
63 Ga0075367_10027230 3300006178 Bacteria 3250
64 Ga0075370_10012087 3300006353 Bacteria 4554
65 Ga0075370_10018994 3300006353 Bacteria 3734
66 Ga0075370_10019446 3300006353 Bacteria 3699
67 Ga0075370_10231331 3300006353 Bacteria 1094
68 Ga0068865_100310604 3300006881 Bacteria 1265
69 Ga0105245_10007388 3300009098 Bacteria 9622
70 Ga0105243_10112119 3300009148 Bacteria 2284
71 Ga0105243_10460799 3300009148 Bacteria 1195
72 Ga0105243_10873339 3300009148 Bacteria 892
73 Ga0105242_10100001 3300009176 Bacteria 2455
74 Ga0105242_10669683 3300009176 Bacteria 1011
75 Ga0105238_10869715 3300009551 Bacteria 919
76 Ga0105249_10041826 3300009553 Bacteria 4167
77 Ga0105239_10003082 3300010375 Bacteria 20711
78 Ga0105246_10015819 3300011119 Bacteria 4770
79 Ga0157371_10346984 3300013102 Bacteria 1080
80 Ga0157369_10099679 3300013105 Bacteria 3097
81 Ga0163162_10359137 3300013306 Bacteria 1590
82 Ga0157372_10172091 3300013307 Bacteria 2506
83 Ga0157372_10284479 3300013307 Bacteria 1923
84 Ga0157372_10322149 3300013307 Bacteria 1800
85 Ga0157372_10791530 3300013307 Bacteria 1102
86 Ga0157375_10006488 3300013308 Bacteria 10188
87 Ga0157375_10030975 3300013308 Bacteria 5050
88 Ga0157375_10255263 3300013308 Bacteria 1915
89 Ga0163163_10356366 3300014325 Bacteria 1519
90 Ga0157380_10040592 3300014326 Bacteria 3625
91 Ga0182008_10016958 3300014497 Bacteria 3778
92 Ga0182008_10073303 3300014497 Bacteria 1685
93 Ga0182008_10155961 3300014497 Bacteria 1147
94 Ga0157377_10482712 3300014745 Bacteria 862
95 Ga0157379_10053443 3300014968 Bacteria 3608
96 Ga0157376_10483926 3300014969 Bacteria 1213
97 Ga0206353_10862183 3300020082 Bacteria 931
98 Ga0206353_11006745 3300020082 Bacteria 1097
99 Ga0207688_10018470 3300025901 Bacteria 3794
100 Ga0207647_10276605 3300025904 Bacteria 959
101 Ga0207705_10151914 3300025909 Bacteria 1735
102 Ga0207660_10043589 3300025917 Bacteria 3153
103 Ga0207662_10086714 3300025918 Bacteria 1919
104 Ga0207657_10021029 3300025919 Bacteria 6152
105 Ga0207649_10302480 3300025920 Bacteria 1170
106 Ga0207652_10311106 3300025921 Bacteria 1422
107 Ga0207646_10331476 3300025922 Bacteria 1375
108 Ga0207659_10180006 3300025926 Bacteria 1674
109 Ga0207687_10018606 3300025927 Bacteria 4589
110 Ga0207690_10021748 3300025932 Bacteria 3982
111 Ga0207686_10123430 3300025934 Bacteria 1766
112 Ga0207709_10122140 3300025935 Bacteria 1760
113 Ga0207709_10140965 3300025935 Bacteria 1657
114 Ga0207709_10871991 3300025935 Bacteria 730
115 Ga0207661_10066162 3300025944 Bacteria 2935
116 Ga0207679_10177849 3300025945 Bacteria 1757
117 Ga0207667_10040919 3300025949 Bacteria 4932
118 Ga0207712_10052873 3300025961 Bacteria 2847
119 Ga0207712_10227933 3300025961 Bacteria 1494
120 Ga0207677_10097972 3300026023 Bacteria 2150
121 Ga0207703_10384218 3300026035 Bacteria 1299
122 Ga0207639_10250576 3300026041 Bacteria 1544
123 Ga0207708_10053882 3300026075 Bacteria 3066
124 Ga0207702_10329534 3300026078 Bacteria 1456
125 Ga0207648_10324833 3300026089 Bacteria 1383
126 Ga0207648_10445255 3300026089 Bacteria 1179
127 Ga0207674_10009755 3300026116 Bacteria 10937
128 Ga0207675_100039727 3300026118 Bacteria 4392
129 Ga0268266_10480856 3300028379 Bacteria 1184
130 Ga0268264_10694835 3300028381 Bacteria 1010
131 Ga0307408_100493841 3300031548 Bacteria 1070
132 Ga0307408_100648287 3300031548 Bacteria 944
133 Ga0307405_10035201 3300031731 Bacteria 2988
134 Ga0307410_10215705 3300031852 Bacteria 1473
135 Ga0307410_10523018 3300031852 Bacteria 979
136 Ga0307406_10090163 3300031901 Bacteria 2062
137 Ga0307407_10004200 3300031903 Bacteria 6077
138 Ga0307407_10023889 3300031903 Bacteria 3196
139 Ga0307407_10117536 3300031903 Bacteria 1680
140 Ga0307407_10295811 3300031903 Bacteria 1127
141 Ga0307412_10025529 3300031911 Bacteria 3662
142 Ga0307412_10226114 3300031911 Bacteria 1438
143 Ga0307412_10293769 3300031911 Bacteria 1281
144 Ga0307412_10368948 3300031911 Bacteria 1158
145 Ga0307409_100027515 3300031995 Bacteria 4031
146 Ga0307409_100113280 3300031995 Bacteria 2279
147 Ga0307409_100767791 3300031995 Bacteria 969
148 Ga0307416_100000221 3300032002 Bacteria 30062
149 Ga0307416_100057771 3300032002 Bacteria 3141
150 Ga0307416_100885430 3300032002 Bacteria 992
151 Ga0307414_10279112 3300032004 Bacteria 1403
152 Ga0307414_10508222 3300032004 Bacteria 1067
153 Ga0307411_10037100 3300032005 Bacteria 3061
154 Ga0307415_100000455 3300032126 Bacteria 17595
155 Ga0307415_100037266 3300032126 Bacteria 3194
156 Ga0307415_100289899 3300032126 Bacteria 1350
157 Ga0395900_0064398 3300037418 Bacteria 3767
158 Ga0395898_0027410 3300037466 Bacteria 5721
159 Ga0395905_0043099 3300037471 Bacteria 4234
160 Ga0395901_0017796 3300038443 Bacteria 7252
161 Ga0395901_0408105 3300038443 Bacteria 1395
162 Ga0395901_0809360 3300038443 Bacteria 925
163 Ga0436365_1426711 3300039437 Bacteria 1495
164 Ga0451853_2760549 3300041512 Bacteria 653
165 Ga0439431_0004287 3300041997 Bacteria 3133
166 Ga0439442_028340 3300042002 Bacteria 1168
167 Ga0439445_0038138 3300042004 Bacteria 1270
168 Ga0439457_073183 3300042014 Bacteria 783
169 Ga0450907_035647 3300042146 Bacteria 849
170 Ga0439446_0061835 3300042156 Bacteria 1133
171 Ga0439434_0008883 3300042435 Bacteria 2952
172 Ga0466972_0036473 3300044658 Bacteria 2406
173 Ga0466965_0066504 3300044683 Bacteria 1807
174 Ga0466966_0015053 3300044684 Bacteria 5117
175 Ga0466966_0461933 3300044684 Bacteria 763
176 Ga0466961_0075179 3300044693 Bacteria 2142
177 Ga0466961_0590169 3300044693 Bacteria 668
178 Ga0466963_0064044 3300044694 Bacteria 2462
179 Ga0466963_0270564 3300044694 Bacteria 1193
180 Ga0466963_0299389 3300044694 Bacteria 1131
181 Ga0466963_0651903 3300044694 Bacteria 743
182 Ga0466964_0046740 3300044706 Bacteria 1765
183 Ga0466971_0098323 3300044719 Bacteria 1343
184 Ga0466970_0081097 3300044765 Bacteria 1754
185 Ga0466970_0104532 3300044765 Bacteria 1544
186 Ga0466970_0106063 3300044765 Bacteria 1532
187 Ga0466970_0111448 3300044765 Bacteria 1494
188 Ga0466970_0157760 3300044765 Bacteria 1254
189 Ga0466957_0016292 3300044842 Bacteria 4347
190 Ga0466957_0286014 3300044842 Bacteria 1105
191 Ga0466957_0313410 3300044842 Bacteria 1057
192 Ga0466957_0499411 3300044842 Bacteria 843
193 Ga0466957_0516524 3300044842 Bacteria 829
194 Ga0466957_0611754 3300044842 Bacteria 763
195 Ga0466960_0008532 3300044901 Bacteria 4198
196 Ga0466960_0019642 3300044901 Bacteria 2980
197 Ga0466960_0022272 3300044901 Bacteria 2831
198 Ga0466960_0045288 3300044901 Bacteria 2101
199 Ga0466960_0054268 3300044901 Bacteria 1945
200 Ga0466960_0057415 3300044901 Bacteria 1898
201 Ga0466960_0105249 3300044901 Bacteria 1458
202 Ga0466960_0337909 3300044901 Bacteria 856
203 Ga0466960_0567633 3300044901 Bacteria 671
204 Ga0466958_0177627 3300045836 Bacteria 1350
205 Ga0466967_0007617 3300045976 Bacteria 7832
206 Ga0466967_0010070 3300045976 Bacteria 7065
207 Ga0466967_0051375 3300045976 Bacteria 3612
208 Ga0466967_0084960 3300045976 Bacteria 2864
209 Ga0466967_0355747 3300045976 Bacteria 1418
210 Ga0466967_0442684 3300045976 Bacteria 1269
211 Ga0466967_0502100 3300045976 Bacteria 1190
212 Ga0495620_0084535 3300046515 Bacteria 1280
213 Ga0495680_0394335 3300047322 Bacteria 957
214 Ga0496101_0216965 3300048904 Bacteria 1484
215 Ga0496101_0249531 3300048904 Bacteria 1382
216 Ga0496101_0485557 3300048904 Bacteria 976
217 Ga0496101_0650474 3300048904 Bacteria 833
218 Ga0496101_0771450 3300048904 Bacteria 758
219 Ga0496101_0855560 3300048904 Bacteria 716
220 Ga0496102_0030321 3300048905 Bacteria 4840
221 Ga0496102_0034295 3300048905 Bacteria 4564
222 Ga0496102_0075289 3300048905 Bacteria 3103
223 Ga0496102_0124293 3300048905 Bacteria 2411
224 Ga0496102_0257324 3300048905 Bacteria 1646
225 Ga0496102_0701367 3300048905 Bacteria 935
226 Ga0496105_0001788 3300048908 Bacteria 15363
227 Ga0496105_0033894 3300048908 Bacteria 4197
228 Ga0496105_0561547 3300048908 Bacteria 890
229 Ga0496107_0177535 3300048910 Bacteria 1581
230 Ga0496108_0227951 3300048911 Bacteria 1619
231 Ga0496108_0384661 3300048911 Bacteria 1225
232 Ga0496108_0622409 3300048911 Bacteria 940
233 Ga0496109_0004367 3300048912 Bacteria 11813
234 Ga0496109_0035220 3300048912 Bacteria 4514
235 Ga0496109_0038345 3300048912 Bacteria 4332
236 Ga0496109_0090810 3300048912 Bacteria 2825
237 Ga0496109_0158604 3300048912 Bacteria 2119
238 Ga0496109_0474560 3300048912 Bacteria 1181
239 Ga0496110_0008067 3300048913 Bacteria 8453
240 Ga0496110_0323763 3300048913 Bacteria 1404
241 Ga0496111_0040905 3300048914 Bacteria 3325
242 Ga0496111_0540156 3300048914 Bacteria 856
243 Ga0496112_0670690 3300048915 Bacteria 966
244 Ga0496113_0104067 3300048916 Bacteria 2202
245 Ga0496113_0443066 3300048916 Bacteria 1043
246 Ga0496113_0802508 3300048916 Bacteria 748
247 Ga0496114_0004376 3300048917 Bacteria 10942
248 Ga0496114_0005642 3300048917 Bacteria 9814
249 Ga0496114_0019142 3300048917 Bacteria 5547
250 Ga0496114_0030973 3300048917 Bacteria 4401
251 Ga0496114_0240797 3300048917 Bacteria 1591
252 Ga0496114_0295941 3300048917 Bacteria 1429
253 Ga0496114_0672297 3300048917 Bacteria 909
254 Ga0496115_0024020 3300048918 Bacteria 4735
255 Ga0496115_0083090 3300048918 Bacteria 2610
256 Ga0496115_0119585 3300048918 Bacteria 2167
257 Ga0496115_0455376 3300048918 Bacteria 1033
258 Ga0496124_0353404 3300048927 Bacteria 1039
259 Ga0501031_0016385 3300049568 Bacteria 4813
260 Ga0501031_0055976 3300049568 Bacteria 2570
261 Ga0501031_0356484 3300049568 Bacteria 946
262 Ga0501031_0428066 3300049568 Bacteria 855
263 Ga0501032_0002003 3300049569 Bacteria 16055
264 Ga0501032_0472692 3300049569 Bacteria 802
265 Ga0501033_0003693 3300049570 Bacteria 12446
266 Ga0501033_0220042 3300049570 Bacteria 1352
267 Ga0501033_0348783 3300049570 Unclassified 1037
268 Ga0501034_0009129 3300049571 Bacteria 10410
269 Ga0501034_0010965 3300049571 Bacteria 9414
270 Ga0501034_0020880 3300049571 Bacteria 6685
271 Ga0501034_0027704 3300049571 Bacteria 5762
272 Ga0501034_0457627 3300049571 Bacteria 1193
273 Ga0501036_0010955 3300049572 Bacteria 7496
274 Ga0501036_0017866 3300049572 Bacteria 5937
275 Ga0501036_0030465 3300049572 Bacteria 4557
276 Ga0501036_0109558 3300049572 Bacteria 2333
277 Ga0501036_0117469 3300049572 Bacteria 2246
278 Ga0501036_0210499 3300049572 Bacteria 1634
279 Ga0501037_0005898 3300049573 Bacteria 8948
280 Ga0501037_0082058 3300049573 Bacteria 2337
281 Ga0501037_0087742 3300049573 Bacteria 2251
282 Ga0501037_0242375 3300049573 Bacteria 1263
283 Ga0501038_0002504 3300049574 Bacteria 17105
284 Ga0501038_0008339 3300049574 Bacteria 9536
285 Ga0501038_0029979 3300049574 Bacteria 4816
286 Ga0501038_0084029 3300049574 Bacteria 2679
287 Ga0501038_0109453 3300049574 Bacteria 2289
288 Ga0501038_0331733 3300049574 Bacteria 1188
289 Ga0501038_0439368 3300049574 Bacteria 1005
290 Ga0501039_0026214 3300049575 Bacteria 4480
291 Ga0501039_0070304 3300049575 Bacteria 2719
292 Ga0501039_0083527 3300049575 Bacteria 2487
293 Ga0501039_0144664 3300049575 Bacteria 1868
294 Ga0501039_0363864 3300049575 Bacteria 1136
295 Ga0501039_0740901 3300049575 Bacteria 768
296 Ga0501039_0846562 3300049575 Bacteria 713
297 Ga0501040_0006014 3300049576 Bacteria 7851
298 Ga0501040_0096949 3300049576 Bacteria 2054
299 Ga0501040_0191935 3300049576 Bacteria 1449
300 Ga0501040_0524712 3300049576 Bacteria 854
301 Ga0501040_0773798 3300049576 Bacteria 694
302 Ga0501041_0010897 3300049577 Bacteria 5365
303 Ga0501041_0035473 3300049577 Bacteria 3021
304 Ga0501041_0290228 3300049577 Bacteria 1030
305 Ga0501041_0362155 3300049577 Bacteria 917
306 Ga0501042_0049344 3300049578 Bacteria 3002
307 Ga0501042_0093801 3300049578 Bacteria 2156
308 Ga0501042_0106740 3300049578 Bacteria 2016
309 Ga0501042_0147757 3300049578 Bacteria 1694
310 Ga0501042_0147798 3300049578 Bacteria 1694
311 Ga0501042_0152816 3300049578 Bacteria 1664
312 Ga0501042_0727253 3300049578 Bacteria 722
313 Ga0501043_0004060 3300049579 Bacteria 11969
314 Ga0501043_0020972 3300049579 Bacteria 5124
315 Ga0501046_0002659 3300049580 Bacteria 16677
316 Ga0501046_0005691 3300049580 Bacteria 11124
317 Ga0501046_0012673 3300049580 Bacteria 7169
318 Ga0501046_0017778 3300049580 Bacteria 5931
319 Ga0501046_0018081 3300049580 Bacteria 5871
320 Ga0501047_0031615 3300049581 Bacteria 5107
321 Ga0501047_0087511 3300049581 Bacteria 2992
322 Ga0501047_0219117 3300049581 Bacteria 1759
323 Ga0501048_0000846 3300049582 Bacteria 22534
324 Ga0501048_0047186 3300049582 Bacteria 3073
325 Ga0501048_0050608 3300049582 Bacteria 2958
326 Ga0501048_0142493 3300049582 Bacteria 1695
327 Ga0501048_0216956 3300049582 Bacteria 1357
328 Ga0501067_0002696 3300049583 Bacteria 9795
329 Ga0501067_0037657 3300049583 Bacteria 2686
330 Ga0501067_0343838 3300049583 Bacteria 831
331 Ga0501068_0003366 3300049584 Bacteria 8588
332 Ga0501068_0353133 3300049584 Bacteria 945
333 Ga0501069_0000486 3300049585 Bacteria 18160
334 Ga0501069_0011836 3300049585 Bacteria 4626
335 Ga0501069_0027761 3300049585 Bacteria 3103
336 Ga0501069_0221738 3300049585 Bacteria 1099
337 Ga0501069_0223445 3300049585 Bacteria 1095
338 Ga0501070_0002647 3300049586 Bacteria 15633
339 Ga0501070_0003993 3300049586 Bacteria 12684
340 Ga0501070_0013831 3300049586 Bacteria 6797
341 Ga0501070_0016150 3300049586 Bacteria 6275
342 Ga0501070_0019595 3300049586 Bacteria 5672
343 Ga0501070_0409054 3300049586 Bacteria 1097
344 Ga0501070_0489045 3300049586 Bacteria 989
345 Ga0501071_0002767 3300049587 Bacteria 10773
346 Ga0501071_0005406 3300049587 Bacteria 8206
347 Ga0501071_0080095 3300049587 Bacteria 2388
348 Ga0501071_0083696 3300049587 Bacteria 2337
349 Ga0501071_0133568 3300049587 Bacteria 1845
350 Ga0501071_0345374 3300049587 Bacteria 1132
351 Ga0501072_0007597 3300049588 Bacteria 8225
352 Ga0501072_0019037 3300049588 Bacteria 5302
353 Ga0501072_0124560 3300049588 Bacteria 2053
354 Ga0501072_0227298 3300049588 Bacteria 1487
355 Ga0501072_0447880 3300049588 Bacteria 1023
356 Ga0501072_0497376 3300049588 Bacteria 964
357 Ga0501072_0549947 3300049588 Bacteria 912
358 Ga0501073_0087854 3300049589 Bacteria 2161
359 Ga0501073_0149353 3300049589 Bacteria 1619
360 Ga0501073_0206117 3300049589 Bacteria 1359
361 Ga0501073_0702029 3300049589 Bacteria 698
362 Ga0501074_0004359 3300049590 Bacteria 10104
363 Ga0501074_0004705 3300049590 Bacteria 9775
364 Ga0501074_0018040 3300049590 Bacteria 5126
365 Ga0501074_0082219 3300049590 Bacteria 2310
366 Ga0501074_0671715 3300049590 Bacteria 731
367 Ga0501075_0031230 3300049591 Bacteria 3952
368 Ga0501075_0149501 3300049591 Bacteria 1780
369 Ga0501075_0179399 3300049591 Bacteria 1616
370 Ga0501075_0772357 3300049591 Bacteria 731
371 Ga0501076_0018711 3300049592 Bacteria 5287
372 Ga0501076_0228392 3300049592 Bacteria 1521
373 Ga0501077_0004994 3300049593 Bacteria 8043
374 Ga0501077_0007137 3300049593 Bacteria 6889
375 Ga0501077_0010070 3300049593 Bacteria 5885
376 Ga0501077_0085435 3300049593 Bacteria 2000
377 Ga0501079_0050644 3300049741 Bacteria 3206
378 Ga0501079_0054295 3300049741 Bacteria 3090
379 Ga0501079_0060883 3300049741 Bacteria 2912
380 Ga0501079_0852096 3300049741 Bacteria 718
381 Ga0501080_0016285 3300049742 Bacteria 6864
382 Ga0501080_0016384 3300049742 Bacteria 6845
383 Ga0501080_0042264 3300049742 Bacteria 4245
384 Ga0501080_0083967 3300049742 Bacteria 2959
385 Ga0501080_0101722 3300049742 Bacteria 2666
386 Ga0501080_0105212 3300049742 Bacteria 2617
387 Ga0501083_0142998 3300049744 Bacteria 1566
388 Ga0501083_0195614 3300049744 Bacteria 1319
389 Ga0501035_0004801 3300049822 Bacteria 12812
390 Ga0501035_0022896 3300049822 Bacteria 5736
391 Ga0501035_0444637 3300049822 Bacteria 1073
392 Ga0501035_0712987 3300049822 Bacteria 808
393 Ga0501044_0004098 3300049823 Bacteria 16346
394 Ga0501044_0074494 3300049823 Bacteria 3448
395 Ga0501044_0307420 3300049823 Bacteria 1513
396 Ga0501044_0548238 3300049823 Bacteria 1054
397 Ga0501045_0037957 3300049824 Bacteria 3503
398 Ga0501045_0076699 3300049824 Bacteria 2463
399 Ga0501045_0115298 3300049824 Bacteria 1993
400 Ga0501045_0305494 3300049824 Bacteria 1184
401 nmdc:mga03683_4196_c1 3300050489 Bacteria 4748
402 nmdc:mga03n38_85837_c1 3300050490 Bacteria 1489
403 nmdc:mga00v17_136317_c1 3300050491 Bacteria 1572
404 nmdc:mga00v17_34461_c1 3300050491 Bacteria 3007
405 nmdc:mga00v17_37660_c1 3300050491 Bacteria 2889
406 nmdc:mga00v17_51951_c1 3300050491 Bacteria 2493
407 nmdc:mga00v17_84183_c1 3300050491 Bacteria 1990
408 nmdc:mga0yw44_120678_c1 3300050492 Bacteria 1688
409 nmdc:mga0yw44_20975_c1 3300050492 Bacteria 3637
410 nmdc:mga0yw44_284399_c1 3300050492 Bacteria 1106
411 nmdc:mga0yw44_50135_c1 3300050492 Bacteria 2523
412 nmdc:mga0yw44_63776_c1 3300050492 Bacteria 2266
413 nmdc:mga0yw44_75661_c1 3300050492 Bacteria 2100
414 nmdc:mga0yw44_93278_c1 3300050492 Bacteria 1906
415 nmdc:mga0yw44_9886_c1 3300050492 Bacteria 4846
416 nmdc:mga06z11_292397_c1 3300050494 Bacteria 967
417 nmdc:mga07m45_22554_c1 3300050496 Bacteria 3438
418 nmdc:mga07m45_382289_c1 3300050496 Bacteria 817
419 nmdc:mga0sz30_72427_c1 3300050516 Bacteria 1022
420 Ga0495595_0248850 3300053084 Bacteria 890
421 Ga0495619_0211249 3300053085 Bacteria 1344
422 Ga0500556_0000502 3300053104 Bacteria 27054
423 Ga0501084_0012105 3300054114 Bacteria 7140
424 Ga0501084_0013970 3300054114 Bacteria 6647
425 Ga0501084_0101938 3300054114 Bacteria 2410
426 Ga0501084_0185278 3300054114 Bacteria 1757
427 Ga0501084_0345880 3300054114 Bacteria 1256
428 Ga0501082_0093064 3300060353 Bacteria 2604
429 Ga0501082_0232225 3300060353 Bacteria 1605
430 Ga0501082_0307068 3300060353 Bacteria 1381
431 Ga0501082_0316143 3300060353 Bacteria 1360
432 Ga0466962_0016016 3300061719 Bacteria 3617
433 Ga0530510_0056017 3300061734 Bacteria 2848
434 Ga0530510_0096712 3300061734 Bacteria 2158
435 Ga0530510_0190712 3300061734 Bacteria 1521
436 Ga0530510_0532673 3300061734 Bacteria 891
437 2643827669 2643221561 Bacteria 4984412
438 2643892312 2643221576 Bacteria 5214352
439 2643961364 2643221590 Bacteria 5214697
440 2644033432 2643221604 Bacteria 5014917
441 2644101508 2643221617 Bacteria 5139111
442 2644118756 2643221620 Bacteria 5134593
443 2644321337 2643221657 Bacteria 5490246
444 2644534923 2643221696 Bacteria 5431823
445 2738869337 2738541305 Bacteria 4910150
446 2774396447 2773857762 Bacteria 5971770
447 2809198104 2808606439 Bacteria 5952208
448 2812331416 2811994874 Bacteria 5367947
449 2812353206 2811994878 Bacteria 5992952
450 2855389550 2855386786 Bacteria 4752232
451 2857485412 2857481737 Bacteria 4761446
452 2891969164 2891968417 Bacteria 5821697
453 2984579093 2984576629 Bacteria 4248407
454 2990260013 2990256926 Bacteria 4252839
455 Ga0068856_100295609
456 LJQas_1006953
457 rootH1_10079093
458 Ga0006562J51391_1037182
459 Ga0070683_100001398
460 Ga0070683_100150793
461 Ga0068869_100435849
462 Ga0070666_10236497
463 Ga0070680_100314985
464 Ga0070682_100018966
465 Ga0070660_100058030
466 Ga0070660_100066788
467 Ga0070691_10384559
468 Ga0070687_100068695
469 Ga0070661_100631715
470 Ga0070692_10155485
471 Ga0070675_100155199
472 Ga0070659_100021202
473 Ga0070659_100647619
474 Ga0070667_100062525
475 Ga0070701_10374024
476 Ga0070678_101082663
477 Ga0068867_100366674
478 Ga0070685_10071066
479 Ga0070698_100090068
480 Ga0070679_100079275
481 Ga0070679_100393636
482 Ga0070684_100000859
483 Ga0070684_100060898
484 Ga0070684_100162741
485 Ga0068853_100289074
486 Ga0070696_100087805
487 Ga0070693_100557956
488 Ga0070665_100000606
489 Ga0070665_100090593
490 Ga0068855_100065608
491 Ga0070664_100080676
492 Ga0068857_100016723
493 Ga0068857_100552718
494 Ga0068861_100127866
495 Ga0068858_100218406
496 Ga0068862_100869884
497 Ga0075365_10000585
498 Ga0075365_10009628
499 Ga0075365_10041611
500 Ga0075365_10059655
501 Ga0075365_10076826
502 Ga0075365_10148386
503 Ga0075365_10216784
504 Ga0075365_10289095
505 Ga0075365_10347188
506 Ga0075365_10418030
507 Ga0075368_10000529
508 Ga0075363_100003967
509 Ga0075363_100020254
510 Ga0075363_100072516
511 Ga0075363_100142922
512 Ga0075364_10005556
513 Ga0075364_10011323
514 Ga0075364_10017885
515 Ga0075364_10422668
516 Ga0075362_10006603
517 Ga0075367_10027230
518 Ga0075370_10012087
519 Ga0075370_10018994
520 Ga0075370_10019446
521 Ga0075370_10231331
522 Ga0068865_100310604
523 Ga0105245_10007388
524 Ga0105243_10112119
525 Ga0105243_10460799
526 Ga0105243_10873339
527 Ga0105242_10100001
528 Ga0105242_10669683
529 Ga0105238_10869715
530 Ga0105249_10041826
531 Ga0105239_10003082
532 Ga0105246_10015819
533 Ga0157371_10346984
534 Ga0157369_10099679
535 Ga0163162_10359137
536 Ga0157372_10172091
537 Ga0157372_10284479
538 Ga0157372_10322149
539 Ga0157372_10791530
540 Ga0157375_10006488
541 Ga0157375_10030975
542 Ga0157375_10255263
543 Ga0163163_10356366
544 Ga0157380_10040592
545 Ga0182008_10016958
546 Ga0182008_10073303
547 Ga0182008_10155961
548 Ga0157377_10482712
549 Ga0157379_10053443
550 Ga0157376_10483926
551 Ga0206353_10862183
552 Ga0206353_11006745
553 Ga0207688_10018470
554 Ga0207647_10276605
555 Ga0207705_10151914
556 Ga0207660_10043589
557 Ga0207662_10086714
558 Ga0207657_10021029
559 Ga0207649_10302480
560 Ga0207652_10311106
561 Ga0207646_10331476
562 Ga0207659_10180006
563 Ga0207687_10018606
564 Ga0207690_10021748
565 Ga0207686_10123430
566 Ga0207709_10122140
567 Ga0207709_10140965
568 Ga0207709_10871991
569 Ga0207661_10066162
570 Ga0207679_10177849
571 Ga0207667_10040919
572 Ga0207712_10052873
573 Ga0207712_10227933
574 Ga0207677_10097972
575 Ga0207703_10384218
576 Ga0207639_10250576
577 Ga0207708_10053882
578 Ga0207702_10329534
579 Ga0207648_10324833
580 Ga0207648_10445255
581 Ga0207674_10009755
582 Ga0207675_100039727
583 Ga0268266_10480856
584 Ga0268264_10694835
585 Ga0307408_100493841
586 Ga0307408_100648287
587 Ga0307405_10035201
588 Ga0307410_10215705
589 Ga0307410_10523018
590 Ga0307406_10090163
591 Ga0307407_10004200
592 Ga0307407_10023889
593 Ga0307407_10117536
594 Ga0307407_10295811
595 Ga0307412_10025529
596 Ga0307412_10226114
597 Ga0307412_10293769
598 Ga0307412_10368948
599 Ga0307409_100027515
600 Ga0307409_100113280
601 Ga0307409_100767791
602 Ga0307416_100000221
603 Ga0307416_100057771
604 Ga0307416_100885430
605 Ga0307414_10279112
606 Ga0307414_10508222
607 Ga0307411_10037100
608 Ga0307415_100000455
609 Ga0307415_100037266
610 Ga0307415_100289899
611 Ga0395900_0064398
612 Ga0395898_0027410
613 Ga0395905_0043099
614 Ga0395901_0017796
615 Ga0395901_0408105
616 Ga0395901_0809360
617 Ga0436365_1426711
618 Ga0451853_2760549
619 Ga0439431_0004287
620 Ga0439442_028340
621 Ga0439445_0038138
622 Ga0439457_073183
623 Ga0450907_035647
624 Ga0439446_0061835
625 Ga0439434_0008883
626 Ga0466972_0036473
627 Ga0466965_0066504
628 Ga0466966_0015053
629 Ga0466966_0461933
630 Ga0466961_0075179
631 Ga0466961_0590169
632 Ga0466963_0064044
633 Ga0466963_0270564
634 Ga0466963_0299389
635 Ga0466963_0651903
636 Ga0466964_0046740
637 Ga0466971_0098323
638 Ga0466970_0081097
639 Ga0466970_0104532
640 Ga0466970_0106063
641 Ga0466970_0111448
642 Ga0466970_0157760
643 Ga0466957_0016292
644 Ga0466957_0286014
645 Ga0466957_0313410
646 Ga0466957_0499411
647 Ga0466957_0516524
648 Ga0466957_0611754
649 Ga0466960_0008532
650 Ga0466960_0019642
651 Ga0466960_0022272
652 Ga0466960_0045288
653 Ga0466960_0054268
654 Ga0466960_0057415
655 Ga0466960_0105249
656 Ga0466960_0337909
657 Ga0466960_0567633
658 Ga0466958_0177627
659 Ga0466967_0007617
660 Ga0466967_0010070
661 Ga0466967_0051375
662 Ga0466967_0084960
663 Ga0466967_0355747
664 Ga0466967_0442684
665 Ga0466967_0502100
666 Ga0495620_0084535
667 Ga0495680_0394335
668 Ga0496101_0216965
669 Ga0496101_0249531
670 Ga0496101_0485557
671 Ga0496101_0650474
672 Ga0496101_0771450
673 Ga0496101_0855560
674 Ga0496102_0030321
675 Ga0496102_0034295
676 Ga0496102_0075289
677 Ga0496102_0124293
678 Ga0496102_0257324
679 Ga0496102_0701367
680 Ga0496105_0001788
681 Ga0496105_0033894
682 Ga0496105_0561547
683 Ga0496107_0177535
684 Ga0496108_0227951
685 Ga0496108_0384661
686 Ga0496108_0622409
687 Ga0496109_0004367
688 Ga0496109_0035220
689 Ga0496109_0038345
690 Ga0496109_0090810
691 Ga0496109_0158604
692 Ga0496109_0474560
693 Ga0496110_0008067
694 Ga0496110_0323763
695 Ga0496111_0040905
696 Ga0496111_0540156
697 Ga0496112_0670690
698 Ga0496113_0104067
699 Ga0496113_0443066
700 Ga0496113_0802508
701 Ga0496114_0004376
702 Ga0496114_0005642
703 Ga0496114_0019142
704 Ga0496114_0030973
705 Ga0496114_0240797
706 Ga0496114_0295941
707 Ga0496114_0672297
708 Ga0496115_0024020
709 Ga0496115_0083090
710 Ga0496115_0119585
711 Ga0496115_0455376
712 Ga0496124_0353404
713 Ga0501031_0016385
714 Ga0501031_0055976
715 Ga0501031_0356484
716 Ga0501031_0428066
717 Ga0501032_0002003
718 Ga0501032_0472692
719 Ga0501033_0003693
720 Ga0501033_0220042
721 Ga0501033_0348783
722 Ga0501034_0009129
723 Ga0501034_0010965
724 Ga0501034_0020880
725 Ga0501034_0027704
726 Ga0501034_0457627
727 Ga0501036_0010955
728 Ga0501036_0017866
729 Ga0501036_0030465
730 Ga0501036_0109558
731 Ga0501036_0117469
732 Ga0501036_0210499
733 Ga0501037_0005898
734 Ga0501037_0082058
735 Ga0501037_0087742
736 Ga0501037_0242375
737 Ga0501038_0002504
738 Ga0501038_0008339
739 Ga0501038_0029979
740 Ga0501038_0084029
741 Ga0501038_0109453
742 Ga0501038_0331733
743 Ga0501038_0439368
744 Ga0501039_0026214
745 Ga0501039_0070304
746 Ga0501039_0083527
747 Ga0501039_0144664
748 Ga0501039_0363864
749 Ga0501039_0740901
750 Ga0501039_0846562
751 Ga0501040_0006014
752 Ga0501040_0096949
753 Ga0501040_0191935
754 Ga0501040_0524712
755 Ga0501040_0773798
756 Ga0501041_0010897
757 Ga0501041_0035473
758 Ga0501041_0290228
759 Ga0501041_0362155
760 Ga0501042_0049344
761 Ga0501042_0093801
762 Ga0501042_0106740
763 Ga0501042_0147757
764 Ga0501042_0147798
765 Ga0501042_0152816
766 Ga0501042_0727253
767 Ga0501043_0004060
768 Ga0501043_0020972
769 Ga0501046_0002659
770 Ga0501046_0005691
771 Ga0501046_0012673
772 Ga0501046_0017778
773 Ga0501046_0018081
774 Ga0501047_0031615
775 Ga0501047_0087511
776 Ga0501047_0219117
777 Ga0501048_0000846
778 Ga0501048_0047186
779 Ga0501048_0050608
780 Ga0501048_0142493
781 Ga0501048_0216956
782 Ga0501067_0002696
783 Ga0501067_0037657
784 Ga0501067_0343838
785 Ga0501068_0003366
786 Ga0501068_0353133
787 Ga0501069_0000486
788 Ga0501069_0011836
789 Ga0501069_0027761
790 Ga0501069_0221738
791 Ga0501069_0223445
792 Ga0501070_0002647
793 Ga0501070_0003993
794 Ga0501070_0013831
795 Ga0501070_0016150
796 Ga0501070_0019595
797 Ga0501070_0409054
798 Ga0501070_0489045
799 Ga0501071_0002767
800 Ga0501071_0005406
801 Ga0501071_0080095
802 Ga0501071_0083696
803 Ga0501071_0133568
804 Ga0501071_0345374
805 Ga0501072_0007597
806 Ga0501072_0019037
807 Ga0501072_0124560
808 Ga0501072_0227298
809 Ga0501072_0447880
810 Ga0501072_0497376
811 Ga0501072_0549947
812 Ga0501073_0087854
813 Ga0501073_0149353
814 Ga0501073_0206117
815 Ga0501073_0702029
816 Ga0501074_0004359
817 Ga0501074_0004705
818 Ga0501074_0018040
819 Ga0501074_0082219
820 Ga0501074_0671715
821 Ga0501075_0031230
822 Ga0501075_0149501
823 Ga0501075_0179399
824 Ga0501075_0772357
825 Ga0501076_0018711
826 Ga0501076_0228392
827 Ga0501077_0004994
828 Ga0501077_0007137
829 Ga0501077_0010070
830 Ga0501077_0085435
831 Ga0501079_0050644
832 Ga0501079_0054295
833 Ga0501079_0060883
834 Ga0501079_0852096
835 Ga0501080_0016285
836 Ga0501080_0016384
837 Ga0501080_0042264
838 Ga0501080_0083967
839 Ga0501080_0101722
840 Ga0501080_0105212
841 Ga0501083_0142998
842 Ga0501083_0195614
843 Ga0501035_0004801
844 Ga0501035_0022896
845 Ga0501035_0444637
846 Ga0501035_0712987
847 Ga0501044_0004098
848 Ga0501044_0074494
849 Ga0501044_0307420
850 Ga0501044_0548238
851 Ga0501045_0037957
852 Ga0501045_0076699
853 Ga0501045_0115298
854 Ga0501045_0305494
855 nmdc:mga03683_4196_c1
856 nmdc:mga03n38_85837_c1
857 nmdc:mga00v17_136317_c1
858 nmdc:mga00v17_34461_c1
859 nmdc:mga00v17_37660_c1
860 nmdc:mga00v17_51951_c1
861 nmdc:mga00v17_84183_c1
862 nmdc:mga0yw44_120678_c1
863 nmdc:mga0yw44_20975_c1
864 nmdc:mga0yw44_284399_c1
865 nmdc:mga0yw44_50135_c1
866 nmdc:mga0yw44_63776_c1
867 nmdc:mga0yw44_75661_c1
868 nmdc:mga0yw44_93278_c1
869 nmdc:mga0yw44_9886_c1
870 nmdc:mga06z11_292397_c1
871 nmdc:mga07m45_22554_c1
872 nmdc:mga07m45_382289_c1
873 nmdc:mga0sz30_72427_c1
874 Ga0495595_0248850
875 Ga0495619_0211249
876 Ga0500556_0000502
877 Ga0501084_0012105
878 Ga0501084_0013970
879 Ga0501084_0101938
880 Ga0501084_0185278
881 Ga0501084_0345880
882 Ga0501082_0093064
883 Ga0501082_0232225
884 Ga0501082_0307068
885 Ga0501082_0316143
886 Ga0466962_0016016
887 Ga0530510_0056017
888 Ga0530510_0096712
889 Ga0530510_0190712
890 Ga0530510_0532673
891 2643827669
892 2643892312
893 2643961364
894 2644033432
895 2644101508
896 2644118756
897 2644321337
898 2644534923
899 2738869337
900 2774396447
901 2809198104
902 2812331416
903 2812353206
904 2855389550
905 2857485412
906 2891969164
907 2984579093
908 2990260013

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dih-assembly2.cif.gz_B crystal structure of thermoglobin y29f mutant in complex with imidazole 0.5005 86 193
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.4776 94 189
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.4703 94 190
2cj5-assembly1.cif.gz_A crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0) 0.4507 73 190
5arn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.4407 87 191
ID Description Score Start End Superfamily
af_Q9UAG7_2_143_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5201 86 195 1.10.490.10
af_P24232_1_143_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5051 86 195 1.10.490.10
af_Q7ARS9_4_141_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4728 86 191 1.10.490.10
af_Q54HM5_62_190_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4727 87 196 1.20.58.70
af_Q55DR2_66_193_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4682 87 196 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A4S4ZT33-F1-model_v4 Uncharacterized protein 0.9094 30 172
AF-A0A7X7NPG2-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.8974 23 198
AF-A0A212U7S6-F1-model_v4 Uncharacterized protein 0.895 21 198
AF-A0A4Y4D8E0-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.8881 22 198
AF-A0A1M3AL93-F1-model_v4 deleted 0.8841 24 198

Map