metagRoot

F447345

General Info

Members	Datasets	Scaffolds	Average Seq Length
454	262	452	312

Family's Representative Sequence

Representative Sequence	3300005468\|Ga0070707_100004177\|Ga0070707_10000417716
Length	358
Sequence	MRTLIAASGTSTSECVRLHSRPAVHAGHNNDVTNANRTTYAVYAEALVRHFNGSRAVDNVDLQIQAGEIYGFLGPNGAGKSTTVRMLCTLLAPTGGRAQVAGYDVATQAGQVRLRIGVALQDAALDPKQTGNELLRLQGRLYGLSGKAMARRLAELSELIELGDALDRQIGTYSGGMQRRLDLAAALVHNPQVLFLDEPTTGLDPASRARVWSEIRRLNQQLGMTIFLTTQYLEEADELAHRVGIIDRGRIVAEGTPVELKRSVGTDVIVARVVGDADAARPVLDAIPGVLGVETHGNELVIATANGAGAISHVAVALASSKMTVRDLTLRTPTLDDVFLELTGTHIERNNNTGEDRS

Samples

	Sample ID	Description	Type	Environment
1	2808606394	Promicromonospora sp. C35	Isolate	Unclassified
2	2857737099	Lysinimonas sp. R-73066	Isolate	Unclassified
3	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
4	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
5	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
6	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
7	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
8	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
9	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
10	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
17	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
18	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
19	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
20	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
28	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
29	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
30	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
31	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
32	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
33	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
34	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
35	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
36	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
37	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
38	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
39	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
40	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
44	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
45	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
50	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
51	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
52	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
53	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
54	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
57	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
58	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
59	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
60	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
61	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
62	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
63	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
64	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
67	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
68	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
69	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
70	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
71	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
72	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
73	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
74	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
75	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
76	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
77	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
78	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
81	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
91	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
92	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
93	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
94	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
95	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
96	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
97	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
98	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
99	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
100	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
101	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
102	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
153	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
155	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
156	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
157	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
158	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
159	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
160	3300033527	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
161	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
162	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
163	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
164	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
165	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
167	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
168	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
169	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
170	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
171	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
172	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
173	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
174	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
175	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
176	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
177	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
178	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
179	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
180	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
181	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
182	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
183	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
184	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
185	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
186	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
187	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
188	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
189	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
190	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
191	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
192	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
193	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
194	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
195	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
196	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
197	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
198	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
199	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
200	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
201	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
202	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
203	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
204	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
205	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
206	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
207	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
208	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
209	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
210	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
211	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
212	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
213	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
214	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
215	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
216	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
217	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
218	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
219	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
220	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
221	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
222	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
227	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
228	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
229	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
232	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
233	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
234	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
235	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
237	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
242	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
247	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
248	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
249	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
250	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
251	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
252	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
253	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
254	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
255	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
256	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
257	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
258	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
259	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
260	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
261	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
262	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.9
Metatranscriptomes	0.66
Isolates	0.44

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.52
Nodule	0
Rhizoplane	6.61
Rhizosphere	86.34
Stem	0
Stem Tuber	0
Unclassified	3.52

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24743J22301_10002073	3300001991	Bacteria	2954
2	JGI24738J21930_10007689	3300002075	Bacteria	2476
3	JGI25407J50210_10016703	3300003373	Bacteria	1902
4	Ga0070658_10060869	3300005327	Bacteria	3075
5	Ga0070683_100027732	3300005329	Bacteria	5111
6	Ga0070683_100112232	3300005329	Bacteria	2572
7	Ga0070683_100199838	3300005329	Bacteria	1898
8	Ga0070690_100039161	3300005330	Bacteria	2994
9	Ga0070670_100084533	3300005331	Bacteria	2726
10	Ga0068869_100043803	3300005334	Bacteria	3216
11	Ga0070680_100100769	3300005336	Bacteria	2397
12	Ga0070680_100140003	3300005336	Bacteria	2029
13	Ga0070682_100000026	3300005337	Bacteria	191388
14	Ga0070682_100040946	3300005337	Bacteria	2853
15	Ga0070682_100044622	3300005337	Bacteria	2745
16	Ga0068868_100024062	3300005338	Bacteria	4616
17	Ga0070660_100010492	3300005339	Bacteria	6546
18	Ga0070660_100044189	3300005339	Bacteria	3407
19	Ga0070660_100255679	3300005339	Bacteria	1429
20	Ga0070689_100015926	3300005340	Bacteria	5494
21	Ga0070689_100110005	3300005340	Bacteria	2190
22	Ga0070691_10016718	3300005341	Bacteria	3373
23	Ga0070661_100048667	3300005344	Bacteria	3103
24	Ga0070661_100187239	3300005344	Bacteria	1577
25	Ga0070692_10006300	3300005345	Bacteria	5144
26	Ga0070668_100003538	3300005347	Bacteria	11519
27	Ga0070675_100077658	3300005354	Bacteria	2764
28	Ga0070675_100087078	3300005354	Bacteria	2611
29	Ga0070675_100159127	3300005354	Bacteria	1941
30	Ga0070671_100015451	3300005355	Bacteria	6166
31	Ga0070671_100022183	3300005355	Bacteria	5187
32	Ga0070674_100012058	3300005356	Bacteria	5295
33	Ga0070673_100016100	3300005364	Bacteria	5276
34	Ga0070688_100001975	3300005365	Bacteria	10319
35	Ga0070659_100025815	3300005366	Bacteria	4518
36	Ga0070659_100052030	3300005366	Bacteria	3220
37	Ga0070667_100286204	3300005367	Bacteria	1481
38	Ga0070709_10015386	3300005434	Bacteria	4352
39	Ga0070709_10016934	3300005434	Bacteria	4171
40	Ga0070701_10072506	3300005438	Bacteria	1844
41	Ga0070700_100101299	3300005441	Bacteria	1898
42	Ga0070700_100120151	3300005441	Bacteria	1759
43	Ga0070708_100014875	3300005445	Bacteria	6412
44	Ga0070708_100136156	3300005445	Bacteria	2275
45	Ga0070708_100200128	3300005445	Bacteria	1870
46	Ga0070663_100019615	3300005455	Bacteria	4462
47	Ga0070663_100073687	3300005455	Bacteria	2491
48	Ga0070678_100015299	3300005456	Bacteria	4872
49	Ga0070678_100081720	3300005456	Bacteria	2451
50	Ga0070662_100034134	3300005457	Bacteria	3586
51	Ga0070662_100060614	3300005457	Bacteria	2759
52	Ga0070681_10057213	3300005458	Bacteria	3880
53	Ga0070681_10146752	3300005458	Bacteria	2288
54	Ga0068867_100100746	3300005459	Bacteria	2206
55	Ga0070685_10018642	3300005466	Bacteria	3735
56	Ga0070706_100009402	3300005467	Bacteria	9102
57	Ga0070706_100011077	3300005467	Bacteria	8373
58	Ga0070706_100028025	3300005467	Bacteria	5182
59	Ga0070706_100044100	3300005467	Bacteria	4120
60	Ga0070707_100004177	3300005468	Bacteria	13533
61	Ga0070707_100018775	3300005468	Bacteria	6509
62	Ga0070707_100060676	3300005468	Bacteria	3627
63	Ga0070707_100166808	3300005468	Bacteria	2146
64	Ga0070698_100054998	3300005471	Bacteria	4039
65	Ga0070698_100078532	3300005471	Bacteria	3299
66	Ga0070698_100329106	3300005471	Bacteria	1459
67	Ga0070699_100314900	3300005518	Bacteria	1405
68	Ga0070679_100182975	3300005530	Bacteria	2067
69	Ga0070679_100253362	3300005530	Bacteria	1716
70	Ga0070684_100041522	3300005535	Bacteria	3966
71	Ga0070684_100159311	3300005535	Bacteria	2047
72	Ga0068853_100021929	3300005539	Bacteria	5327
73	Ga0068853_100317441	3300005539	Bacteria	1444
74	Ga0070672_100059653	3300005543	Bacteria	3002
75	Ga0070686_100010299	3300005544	Bacteria	5268
76	Ga0070695_100063588	3300005545	Bacteria	2399
77	Ga0070693_100038753	3300005547	Bacteria	2666
78	Ga0070665_100084556	3300005548	Bacteria	3178
79	Ga0068855_100118735	3300005563	Bacteria	3028
80	Ga0068855_100273801	3300005563	Bacteria	1876
81	Ga0070664_100127073	3300005564	Bacteria	2237
82	Ga0070664_100139610	3300005564	Bacteria	2133
83	Ga0068857_100004671	3300005577	Bacteria	11601
84	Ga0068854_100000082	3300005578	Bacteria	68340
85	Ga0068854_100030811	3300005578	Bacteria	3723
86	Ga0068854_100084357	3300005578	Bacteria	2351
87	Ga0068854_100085914	3300005578	Bacteria	2331
88	Ga0070702_100115900	3300005615	Bacteria	1669
89	Ga0068852_100205526	3300005616	Bacteria	1865
90	Ga0068859_100229136	3300005617	Bacteria	1946
91	Ga0068866_10067288	3300005718	Bacteria	1880
92	Ga0068866_10080681	3300005718	Bacteria	1746
93	Ga0068861_100293881	3300005719	Bacteria	1404
94	Ga0068851_10040146	3300005834	Bacteria	2352
95	Ga0068870_10202043	3300005840	Bacteria	1205
96	Ga0068858_100015291	3300005842	Bacteria	7220
97	Ga0068858_100036468	3300005842	Bacteria	4560
98	Ga0068858_100053436	3300005842	Bacteria	3737
99	Ga0068860_100140688	3300005843	Bacteria	2319
100	Ga0068862_100001142	3300005844	Bacteria	25132
101	Ga0081455_10002376	3300005937	Bacteria	22485
102	Ga0081455_10005042	3300005937	Bacteria	14589
103	Ga0081455_10011122	3300005937	Bacteria	9059
104	Ga0081538_10000105	3300005981	Bacteria	83102
105	Ga0081538_10006122	3300005981	Bacteria	10683
106	Ga0081538_10013679	3300005981	Bacteria	6413
107	Ga0081538_10037636	3300005981	Bacteria	3134
108	Ga0081538_10039860	3300005981	Bacteria	3006
109	Ga0081539_10038494	3300005985	Bacteria	2834
110	Ga0070717_10148635	3300006028	Bacteria	2026
111	Ga0075365_10004563	3300006038	Bacteria	7360
112	Ga0075365_10032753	3300006038	Bacteria	3344
113	Ga0075365_10079480	3300006038	Bacteria	2219
114	Ga0075363_100009449	3300006048	Bacteria	4585
115	Ga0075364_10046718	3300006051	Bacteria	2819
116	Ga0075364_10141866	3300006051	Bacteria	1616
117	Ga0075362_10124556	3300006177	Bacteria	1222
118	Ga0068871_100117013	3300006358	Bacteria	2248
119	Ga0068871_100265361	3300006358	Bacteria	1499
120	Ga0075428_100028377	3300006844	Bacteria	6191
121	Ga0075428_100081073	3300006844	Bacteria	3541
122	Ga0075428_100438503	3300006844	Bacteria	1399
123	Ga0075430_100006829	3300006846	Bacteria	9619
124	Ga0075430_100015802	3300006846	Bacteria	6428
125	Ga0075431_100000056	3300006847	Bacteria	62721
126	Ga0075431_100011012	3300006847	Bacteria	9105
127	Ga0075434_100000356	3300006871	Bacteria	33159
128	Ga0075429_100005701	3300006880	Bacteria	10743
129	Ga0068865_100056787	3300006881	Bacteria	2729
130	Ga0075436_100006747	3300006914	Bacteria	7859
131	Ga0097620_100229135	3300006931	Bacteria	1946
132	Ga0105240_10543334	3300009093	Bacteria	1286
133	Ga0111539_10000449	3300009094	Bacteria	51659
134	Ga0111539_10017044	3300009094	Bacteria	8993
135	Ga0111539_10226151	3300009094	Bacteria	2179
136	Ga0105245_10010835	3300009098	Bacteria	7933
137	Ga0105245_10015151	3300009098	Bacteria	6717
138	Ga0105245_10187064	3300009098	Bacteria	1982
139	Ga0114129_10023233	3300009147	Bacteria	8796
140	Ga0114129_10074343	3300009147	Bacteria	4733
141	Ga0114129_10240984	3300009147	Bacteria	2431
142	Ga0105243_10032278	3300009148	Bacteria	4044
143	Ga0105243_10057881	3300009148	Bacteria	3088
144	Ga0105243_10072936	3300009148	Bacteria	2780
145	Ga0105241_10377633	3300009174	Bacteria	1237
146	Ga0105242_10017399	3300009176	Bacteria	5602
147	Ga0105242_10054296	3300009176	Bacteria	3274
148	Ga0105242_10243097	3300009176	Bacteria	1619
149	Ga0105238_10058177	3300009551	Bacteria	3875
150	Ga0105238_10499883	3300009551	Bacteria	1217
151	Ga0105249_10011399	3300009553	Bacteria	7807
152	Ga0105249_10079542	3300009553	Bacteria	3043
153	Ga0105249_10260326	3300009553	Bacteria	1723
154	Ga0105249_10401936	3300009553	Bacteria	1400
155	Ga0105249_10424915	3300009553	Bacteria	1363
156	Ga0105239_10124153	3300010375	Bacteria	2868
157	Ga0105239_10201435	3300010375	Bacteria	2230
158	Ga0105239_10777474	3300010375	Bacteria	1096
159	Ga0105246_10205460	3300011119	Bacteria	1534
160	Ga0157373_10189268	3300013100	Bacteria	1450
161	Ga0157371_10058092	3300013102	Bacteria	2744
162	Ga0157369_10295292	3300013105	Bacteria	1686
163	Ga0157374_10047926	3300013296	Bacteria	3963
164	Ga0157378_10031394	3300013297	Bacteria	4693
165	Ga0157378_10169152	3300013297	Bacteria	2048
166	Ga0157378_10329390	3300013297	Bacteria	1486
167	Ga0163162_10437071	3300013306	Bacteria	1441
168	Ga0163162_10930691	3300013306	Bacteria	981
169	Ga0157372_10149462	3300013307	Bacteria	2695
170	Ga0157380_10032839	3300014326	Bacteria	3994
171	Ga0157377_10055890	3300014745	Bacteria	2240
172	Ga0157377_10068675	3300014745	Bacteria	2043
173	Ga0157379_10019221	3300014968	Bacteria	6033
174	Ga0157379_10035466	3300014968	Bacteria	4447
175	Ga0206353_10842230	3300020082	Bacteria	1352
176	Ga0207656_10018733	3300025321	Bacteria	2729
177	Ga0207682_10009047	3300025893	Bacteria	3935
178	Ga0207642_10121463	3300025899	Bacteria	1348
179	Ga0207688_10043807	3300025901	Bacteria	2493
180	Ga0207688_10050275	3300025901	Bacteria	2333
181	Ga0207688_10239190	3300025901	Bacteria	1098
182	Ga0207647_10056000	3300025904	Bacteria	2420
183	Ga0207699_10178366	3300025906	Bacteria	1426
184	Ga0207645_10126115	3300025907	Bacteria	1664
185	Ga0207684_10126869	3300025910	Bacteria	2190
186	Ga0207707_10143129	3300025912	Bacteria	2090
187	Ga0207695_10400864	3300025913	Bacteria	1256
188	Ga0207660_10111470	3300025917	Bacteria	2059
189	Ga0207662_10028999	3300025918	Bacteria	3203
190	Ga0207657_10006124	3300025919	Bacteria	12503
191	Ga0207649_10042792	3300025920	Bacteria	2764
192	Ga0207649_10259685	3300025920	Bacteria	1255
193	Ga0207652_10349060	3300025921	Bacteria	1335
194	Ga0207646_10008785	3300025922	Bacteria	10082
195	Ga0207681_10229632	3300025923	Bacteria	1440
196	Ga0207659_10060913	3300025926	Bacteria	2718
197	Ga0207659_10385670	3300025926	Bacteria	1169
198	Ga0207687_10067672	3300025927	Bacteria	2542
199	Ga0207687_10202430	3300025927	Bacteria	1553
200	Ga0207664_10343621	3300025929	Bacteria	1320
201	Ga0207644_10017944	3300025931	Bacteria	4785
202	Ga0207644_10335360	3300025931	Bacteria	1225
203	Ga0207690_10010789	3300025932	Bacteria	5444
204	Ga0207690_10496902	3300025932	Bacteria	986
205	Ga0207706_10015361	3300025933	Bacteria	6917
206	Ga0207706_10022030	3300025933	Bacteria	5719
207	Ga0207706_10114478	3300025933	Bacteria	2372
208	Ga0207706_10271785	3300025933	Bacteria	1479
209	Ga0207686_10044923	3300025934	Bacteria	2715
210	Ga0207686_10112568	3300025934	Bacteria	1838
211	Ga0207709_10035394	3300025935	Bacteria	2952
212	Ga0207670_10158857	3300025936	Bacteria	1685
213	Ga0207670_10181180	3300025936	Bacteria	1587
214	Ga0207669_10054128	3300025937	Bacteria	2422
215	Ga0207704_10113350	3300025938	Bacteria	1838
216	Ga0207704_10232604	3300025938	Bacteria	1372
217	Ga0207704_10397815	3300025938	Bacteria	1086
218	Ga0207691_10068837	3300025940	Bacteria	3198
219	Ga0207691_10089799	3300025940	Bacteria	2755
220	Ga0207691_10143766	3300025940	Bacteria	2101
221	Ga0207711_10133998	3300025941	Bacteria	2223
222	Ga0207689_10064480	3300025942	Bacteria	3014
223	Ga0207661_10039621	3300025944	Bacteria	3699
224	Ga0207661_10093744	3300025944	Bacteria	2507
225	Ga0207679_10112977	3300025945	Bacteria	2148
226	Ga0207667_10107924	3300025949	Bacteria	2872
227	Ga0207712_10006637	3300025961	Bacteria	7305
228	Ga0207712_10213946	3300025961	Bacteria	1537
229	Ga0207668_10004720	3300025972	Bacteria	8016
230	Ga0207640_10045752	3300025981	Bacteria	2812
231	Ga0207640_10295970	3300025981	Bacteria	1278
232	Ga0207658_10001121	3300025986	Bacteria	21617
233	Ga0207658_10387882	3300025986	Bacteria	1225
234	Ga0207677_10064176	3300026023	Bacteria	2556
235	Ga0207703_10029846	3300026035	Bacteria	4305
236	Ga0207639_10336192	3300026041	Bacteria	1345
237	Ga0207678_10070491	3300026067	Bacteria	2997
238	Ga0207678_10158302	3300026067	Bacteria	1934
239	Ga0207708_10035451	3300026075	Bacteria	3796
240	Ga0207708_10167187	3300026075	Bacteria	1739
241	Ga0207641_10243443	3300026088	Bacteria	1677
242	Ga0207641_10407842	3300026088	Bacteria	1306
243	Ga0207648_10001336	3300026089	Bacteria	27386
244	Ga0207648_10045253	3300026089	Bacteria	3860
245	Ga0207676_10187137	3300026095	Bacteria	1818
246	Ga0207674_10003204	3300026116	Bacteria	20154
247	Ga0207675_100016689	3300026118	Bacteria	6856
248	Ga0207675_100245959	3300026118	Bacteria	1730
249	Ga0207675_100308164	3300026118	Bacteria	1543
250	Ga0207683_10021406	3300026121	Bacteria	5536
251	Ga0207683_10149314	3300026121	Bacteria	2109
252	Ga0207698_10052395	3300026142	Bacteria	3126
253	Ga0207698_10184626	3300026142	Bacteria	1851
254	Ga0207428_10005428	3300027907	Bacteria	11891
255	Ga0207428_10199232	3300027907	Bacteria	1507
256	Ga0268265_10015269	3300028380	Bacteria	5251
257	Ga0316576_10012576	3300031727	Bacteria	5597
258	Ga0316578_10012226	3300031728	Bacteria	4522
259	Ga0316577_10032465	3300031733	Bacteria	2918
260	Ga0307410_10004681	3300031852	Bacteria	7114
261	Ga0307416_100261983	3300032002	Bacteria	1690
262	Ga0307414_10566997	3300032004	Bacteria	1014
263	Ga0316586_1001030	3300033527	Bacteria	3010
264	Ga0316587_1011710	3300033529	Bacteria	1420
265	Ga0373954_0150642	3300035118	Bacteria	1136
266	Ga0316574_0071619	3300035398	Bacteria	2189
267	Ga0316574_0091003	3300035398	Bacteria	1945
268	Ga0373927_0014962	3300035695	Bacteria	5133
269	Ga0373937_0128490	3300036401	Bacteria	2365
270	Ga0373925_0006749	3300037068	Bacteria	8415
271	Ga0316581_0028614	3300037588	Bacteria	1671
272	Ga0400485_05720	3300038735	Bacteria	7707
273	Ga0400483_023354	3300039062	Bacteria	2500
274	Ga0400483_031601	3300039062	Bacteria	46159
275	Ga0400483_079531	3300039062	Bacteria	1448
276	Ga0400483_092270	3300039062	Bacteria	5903
277	Ga0400483_230433	3300039062	Bacteria	44690
278	Ga0436365_1777696	3300039437	Bacteria	977
279	Ga0436361_0072893	3300039447	Bacteria	7948
280	Ga0436362_0242738	3300039453	Bacteria	11388
281	Ga0439448_0003212	3300042005	Bacteria	4511
282	Ga0439450_000102	3300042008	Bacteria	8623
283	Ga0439463_001393	3300042016	Bacteria	6428
284	Ga0439464_0005057	3300042439	Bacteria	3392
285	Ga0439460_0001170	3300042461	Bacteria	6157
286	Ga0439440_0001759	3300042993	Bacteria	3993
287	Ga0466965_0000011	3300044683	Bacteria	107319
288	Ga0466961_0026662	3300044693	Bacteria	3715
289	Ga0466963_0075898	3300044694	Bacteria	2269
290	Ga0466958_0076449	3300045836	Bacteria	2055
291	Ga0466967_0109784	3300045976	Bacteria	2533
292	Ga0495592_0292385	3300046454	Bacteria	1062
293	Ga0495651_0005694	3300046462	Bacteria	9495
294	Ga0495653_0050072	3300046463	Bacteria	3214
295	Ga0495608_0109944	3300046511	Bacteria	1772
296	Ga0495610_0125615	3300046512	Bacteria	1119
297	Ga0495645_0152051	3300046543	Bacteria	1607
298	Ga0495667_0000038	3300046559	Bacteria	131349
299	Ga0495667_0011435	3300046559	Bacteria	6006
300	Ga0495657_0011500	3300046675	Bacteria	6615
301	Ga0495599_0182324	3300046678	Bacteria	1294
302	Ga0495600_0016607	3300046809	Bacteria	4676
303	Ga0495604_0030162	3300047317	Bacteria	4310
304	Ga0495672_0050259	3300047320	Bacteria	2463
305	Ga0495680_0057724	3300047322	Bacteria	3000
306	Ga0495680_0180118	3300047322	Bacteria	1526
307	Ga0495675_0054175	3300047444	Bacteria	2546
308	Ga0495686_0027464	3300047472	Bacteria	3716
309	Ga0495602_0094730	3300048088	Bacteria	2467
310	Ga0496100_0177806	3300048903	Bacteria	1537
311	Ga0496101_0038317	3300048904	Bacteria	3404
312	Ga0496101_0063830	3300048904	Bacteria	2682
313	Ga0496101_0151327	3300048904	Bacteria	1775
314	Ga0496102_0232067	3300048905	Bacteria	1740
315	Ga0496102_0386224	3300048905	Bacteria	1317
316	Ga0496104_0015518	3300048907	Bacteria	6900
317	Ga0496105_0094339	3300048908	Bacteria	2471
318	Ga0496106_0339460	3300048909	Bacteria	1206
319	Ga0496107_0027390	3300048910	Bacteria	4047
320	Ga0496108_0008807	3300048911	Bacteria	8179
321	Ga0496108_0013267	3300048911	Bacteria	6716
322	Ga0496108_0209230	3300048911	Bacteria	1693
323	Ga0496108_0285830	3300048911	Bacteria	1436
324	Ga0496109_0014549	3300048912	Bacteria	6845
325	Ga0496109_0187555	3300048912	Bacteria	1943
326	Ga0496110_0022374	3300048913	Bacteria	5367
327	Ga0496110_0022785	3300048913	Bacteria	5322
328	Ga0496110_0107834	3300048913	Bacteria	2500
329	Ga0496110_0470158	3300048913	Bacteria	1145
330	Ga0496112_0001298	3300048915	Bacteria	18986
331	Ga0496112_0022626	3300048915	Bacteria	5992
332	Ga0496112_0047242	3300048915	Bacteria	4223
333	Ga0496113_0000005	3300048916	Bacteria	105956
334	Ga0496113_0012392	3300048916	Bacteria	5729
335	Ga0496113_0417538	3300048916	Bacteria	1078
336	Ga0496114_0004863	3300048917	Bacteria	10465
337	Ga0496114_0005323	3300048917	Bacteria	10055
338	Ga0496114_0056187	3300048917	Bacteria	3284
339	Ga0496114_0194578	3300048917	Bacteria	1775
340	Ga0496117_0032919	3300048920	Bacteria	3929
341	Ga0496118_0002693	3300048921	Bacteria	23403
342	Ga0496118_0039780	3300048921	Bacteria	3747
343	Ga0496121_0167138	3300048924	Bacteria	1602
344	Ga0496125_0040136	3300048928	Bacteria	4019
345	Ga0496126_0004897	3300048929	Bacteria	15649
346	Ga0496126_0216570	3300048929	Bacteria	1610
347	Ga0501031_0008308	3300049568	Bacteria	6752
348	Ga0501031_0057883	3300049568	Bacteria	2525
349	Ga0501031_0096717	3300049568	Bacteria	1927
350	Ga0501032_0004371	3300049569	Bacteria	10664
351	Ga0501032_0054707	3300049569	Bacteria	2686
352	Ga0501033_0080413	3300049570	Bacteria	2391
353	Ga0501033_0175327	3300049570	Bacteria	1539
354	Ga0501034_0003237	3300049571	Bacteria	18617
355	Ga0501034_0233744	3300049571	Bacteria	1786
356	Ga0501034_0312504	3300049571	Bacteria	1505
357	Ga0501036_0013793	3300049572	Bacteria	6722
358	Ga0501036_0108970	3300049572	Bacteria	2341
359	Ga0501036_0269038	3300049572	Bacteria	1427
360	Ga0501037_0016735	3300049573	Bacteria	5395
361	Ga0501037_0108837	3300049573	Bacteria	1997
362	Ga0501038_0042830	3300049574	Bacteria	3941
363	Ga0501038_0052692	3300049574	Bacteria	3507
364	Ga0501040_0005712	3300049576	Bacteria	8048
365	Ga0501040_0037620	3300049576	Bacteria	3288
366	Ga0501040_0231292	3300049576	Bacteria	1316
367	Ga0501041_0116714	3300049577	Bacteria	1657
368	Ga0501042_0024553	3300049578	Bacteria	4229
369	Ga0501042_0101354	3300049578	Bacteria	2070
370	Ga0501043_0011646	3300049579	Bacteria	6884
371	Ga0501043_0013975	3300049579	Bacteria	6282
372	Ga0501043_0021854	3300049579	Bacteria	5017
373	Ga0501043_0147127	3300049579	Bacteria	1844
374	Ga0501048_0012311	3300049582	Bacteria	6366
375	Ga0501048_0045982	3300049582	Bacteria	3116
376	Ga0501048_0113313	3300049582	Bacteria	1916
377	Ga0501068_0006401	3300049584	Bacteria	6490
378	Ga0501070_0001370	3300049586	Bacteria	21785
379	Ga0501070_0019981	3300049586	Bacteria	5616
380	Ga0501070_0135131	3300049586	Bacteria	2036
381	Ga0501070_0166423	3300049586	Bacteria	1817
382	Ga0501071_0001822	3300049587	Bacteria	12626
383	Ga0501072_0026552	3300049588	Bacteria	4515
384	Ga0501072_0036909	3300049588	Bacteria	3833
385	Ga0501072_0062344	3300049588	Bacteria	2941
386	Ga0501072_0119123	3300049588	Bacteria	2103
387	Ga0501073_0127173	3300049589	Bacteria	1766
388	Ga0501073_0263834	3300049589	Bacteria	1188
389	Ga0501074_0043628	3300049590	Bacteria	3246
390	Ga0501074_0176942	3300049590	Bacteria	1522
391	Ga0501074_0263384	3300049590	Bacteria	1225
392	Ga0501075_0009320	3300049591	Bacteria	6869
393	Ga0501075_0010211	3300049591	Bacteria	6594
394	Ga0501075_0062536	3300049591	Bacteria	2806
395	Ga0501076_0004007	3300049592	Bacteria	10408
396	Ga0501076_0057377	3300049592	Bacteria	3091
397	Ga0501077_0010284	3300049593	Bacteria	5824
398	Ga0501077_0020656	3300049593	Bacteria	4169
399	Ga0501077_0062892	3300049593	Bacteria	2354
400	Ga0501079_0014887	3300049741	Bacteria	5929
401	Ga0501079_0038961	3300049741	Bacteria	3665
402	Ga0501080_0000056	3300049742	Bacteria	72834
403	Ga0501080_0027767	3300049742	Bacteria	5262
404	Ga0501080_0341414	3300049742	Bacteria	1353
405	Ga0501081_0007958	3300049743	Bacteria	6876
406	Ga0501081_0010230	3300049743	Bacteria	6123
407	Ga0501081_0011089	3300049743	Bacteria	5894
408	Ga0501083_0014853	3300049744	Bacteria	5446
409	Ga0501083_0126947	3300049744	Bacteria	1672
410	Ga0501035_0044711	3300049822	Bacteria	3986
411	Ga0501035_0145580	3300049822	Bacteria	2058
412	Ga0501044_0256921	3300049823	Bacteria	1686
413	Ga0501045_0009180	3300049824	Bacteria	6909
414	Ga0501045_0010967	3300049824	Bacteria	6347
415	Ga0501045_0070406	3300049824	Bacteria	2573
416	Ga0501045_0204753	3300049824	Bacteria	1470
417	nmdc:mga0yw44_104361_c1	3300050492	Bacteria	1809
418	nmdc:mga0yw44_30152_c1	3300050492	Bacteria	3139
419	nmdc:mga05p37_125645_c1	3300050507	Bacteria	3150
420	nmdc:mga05p37_662221_c1	3300050507	Bacteria	1167
421	nmdc:mga09592_10713_c1	3300050508	Bacteria	7463
422	nmdc:mga09592_12330_c1	3300050508	Bacteria	6962
423	nmdc:mga09592_21712_c1	3300050508	Bacteria	5292
424	nmdc:mga0qj67_217_c1	3300050509	Bacteria	39240
425	nmdc:mga06r32_11755_c1	3300050510	Bacteria	7882
426	nmdc:mga06r32_175317_c1	3300050510	Bacteria	2128
427	nmdc:mga06r32_445838_c1	3300050510	Bacteria	1274
428	nmdc:mga06r32_663_c1	3300050510	Bacteria	29946
429	nmdc:mga08y16_10571_c1	3300050511	Bacteria	9688
430	nmdc:mga08y16_354495_c1	3300050511	Bacteria	1507
431	nmdc:mga08y16_39028_c1	3300050511	Bacteria	4984
432	nmdc:mga08x19_14775_c1	3300050514	Bacteria	4742
433	nmdc:mga0a205_234276_c1	3300050515	Bacteria	1718
434	Ga0495595_0014378	3300053084	Bacteria	3357
435	Ga0495619_0000088	3300053085	Bacteria	69615
436	Ga0500595_012984	3300053119	Bacteria	3201
437	Ga0500658_0053207	3300053134	Bacteria	1660
438	Ga0500568_0003548	3300053139	Bacteria	8633
439	Ga0500568_0003588	3300053139	Bacteria	8572
440	Ga0500568_0004703	3300053139	Bacteria	7245
441	Ga0500616_0000151	3300053153	Bacteria	116796
442	Ga0500616_0001517	3300053153	Bacteria	21901
443	Ga0501084_0000104	3300054114	Bacteria	62893
444	Ga0501084_0044495	3300054114	Bacteria	3716
445	Ga0501084_0082224	3300054114	Bacteria	2702
446	Ga0501082_0008395	3300060353	Bacteria	8909
447	Ga0501082_0037333	3300060353	Bacteria	4187
448	Ga0501082_0065058	3300060353	Bacteria	3140
449	Ga0530510_0013739	3300061734	Bacteria	5699
450	Ga0530510_0024446	3300061734	Bacteria	4310
451	Ga0530510_0037338	3300061734	Bacteria	3502
452	Ga0530510_0069400	3300061734	Bacteria	2557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300039437	Ga0436365_1777696	Ga0436365_1777696_133_942	246
2	3300053134	Ga0500658_0053207	Ga0500658_0053207_744_1649	258
3	3300005467	Ga0070706_100009402	Ga0070706_1000094027	265
4	3300032004	Ga0307414_10566997	Ga0307414_105669972	267
5	3300005445	Ga0070708_100136156	Ga0070708_1001361562	268
6	3300005471	Ga0070698_100054998	Ga0070698_1000549985	269
7	3300005518	Ga0070699_100314900	Ga0070699_1003149002	269
8	3300048911	Ga0496108_0285830	Ga0496108_0285830_32_943	274
9	iso_pu_bacteria	2857737099	2857738109	274
10	3300035695	Ga0373927_0014962	Ga0373927_0014962_1729_2793	275
11	3300037068	Ga0373925_0006749	Ga0373925_0006749_6392_7456	275
12	3300049569	Ga0501032_0004371	Ga0501032_0004371_9308_10195	275
13	3300049571	Ga0501034_0233744	Ga0501034_0233744_447_1334	275
14	3300049573	Ga0501037_0108837	Ga0501037_0108837_664_1551	275
15	3300049823	Ga0501044_0256921	Ga0501044_0256921_197_1084	275
16	3300039062	Ga0400483_079531	Ga0400483_079531_490_1425	276
17	3300049568	Ga0501031_0008308	Ga0501031_0008308_5037_5927	276
18	3300049569	Ga0501032_0054707	Ga0501032_0054707_740_1630	276
19	3300049571	Ga0501034_0312504	Ga0501034_0312504_243_1106	276
20	3300049574	Ga0501038_0042830	Ga0501038_0042830_657_1547	276
21	3300053139	Ga0500568_0003548	Ga0500568_0003548_234_1097	276
22	3300006028	Ga0070717_10148635	Ga0070717_101486352	277
23	3300047472	Ga0495686_0027464	Ga0495686_0027464_1261_2127	277
24	3300048924	Ga0496121_0167138	Ga0496121_0167138_150_1016	277
25	3300049571	Ga0501034_0003237	Ga0501034_0003237_17698_18564	277
26	3300049579	Ga0501043_0013975	Ga0501043_0013975_1622_2488	277
27	3300049586	Ga0501070_0001370	Ga0501070_0001370_16830_17696	277
28	3300049589	Ga0501073_0263834	Ga0501073_0263834_298_1164	277
29	3300049742	Ga0501080_0000056	Ga0501080_0000056_37120_37986	277
30	3300049744	Ga0501083_0014853	Ga0501083_0014853_1724_2590	277
31	3300053139	Ga0500568_0004703	Ga0500568_0004703_1142_2008	277
32	3300053153	Ga0500616_0000151	Ga0500616_0000151_109802_110665	277
33	3300044683	Ga0466965_0000011	Ga0466965_0000011_101823_102719	278
34	3300053139	Ga0500568_0003588	Ga0500568_0003588_4591_5490	279
35	3300046512	Ga0495610_0125615	Ga0495610_0125615_85_1056	280
36	3300050515	nmdc:mga0a205_234276_c1	nmdc:mga0a205_234276_c1_863_1705	280
37	3300005445	Ga0070708_100014875	Ga0070708_1000148753	282
38	3300005467	Ga0070706_100044100	Ga0070706_1000441003	282
39	3300049588	Ga0501072_0036909	Ga0501072_0036909_696_1676	283
40	3300048921	Ga0496118_0039780	Ga0496118_0039780_201_1184	284
41	3300048928	Ga0496125_0040136	Ga0496125_0040136_2165_3148	284
42	3300048929	Ga0496126_0004897	Ga0496126_0004897_11930_12913	284
43	3300048929	Ga0496126_0216570	Ga0496126_0216570_362_1345	284
44	3300005347	Ga0070668_100003538	Ga0070668_1000035386	285
45	3300005843	Ga0068860_100140688	Ga0068860_1001406883	285
46	3300005844	Ga0068862_100001142	Ga0068862_1000011426	285
47	3300005937	Ga0081455_10005042	Ga0081455_1000504212	285
48	3300009553	Ga0105249_10011399	Ga0105249_100113993	285
49	3300025961	Ga0207712_10006637	Ga0207712_100066379	285
50	3300025972	Ga0207668_10004720	Ga0207668_1000472011	285
51	3300025986	Ga0207658_10001121	Ga0207658_1000112122	285
52	3300028380	Ga0268265_10015269	Ga0268265_100152696	285
53	3300047320	Ga0495672_0050259	Ga0495672_0050259_1444_2430	285
54	3300048905	Ga0496102_0386224	Ga0496102_0386224_47_1033	285
55	3300048920	Ga0496117_0032919	Ga0496117_0032919_195_1181	285
56	3300048921	Ga0496118_0002693	Ga0496118_0002693_18788_19774	285
57	3300049576	Ga0501040_0231292	Ga0501040_0231292_306_1292	285
58	3300049591	Ga0501075_0062536	Ga0501075_0062536_615_1601	285
59	3300050508	nmdc:mga09592_12330_c1	nmdc:mga09592_12330_c1_3250_4203	285
60	3300050509	nmdc:mga0qj67_217_c1	nmdc:mga0qj67_217_c1_13351_14304	285
61	3300050510	nmdc:mga06r32_663_c1	nmdc:mga06r32_663_c1_15741_16694	285
62	3300053119	Ga0500595_012984	Ga0500595_012984_373_1359	285
63	3300006038	Ga0075365_10079480	Ga0075365_100794801	286
64	3300013105	Ga0157369_10295292	Ga0157369_102952921	286
65	3300038735	Ga0400485_05720	Ga0400485_05720_904_1974	286
66	3300044694	Ga0466963_0075898	Ga0466963_0075898_421_1455	286
67	3300045836	Ga0466958_0076449	Ga0466958_0076449_293_1333	286
68	3300046559	Ga0495667_0000038	Ga0495667_0000038_75821_76816	286
69	3300006871	Ga0075434_100000356	Ga0075434_10000035633	287
70	3300006914	Ga0075436_100006747	Ga0075436_1000067472	287
71	3300009093	Ga0105240_10543334	Ga0105240_105433341	287
72	3300025913	Ga0207695_10400864	Ga0207695_104008641	287
73	3300050514	nmdc:mga08x19_14775_c1	nmdc:mga08x19_14775_c1_3738_4649	287
74	3300005434	Ga0070709_10016934	Ga0070709_100169344	288
75	3300025910	Ga0207684_10126869	Ga0207684_101268692	288
76	3300025929	Ga0207664_10343621	Ga0207664_103436212	288
77	3300037588	Ga0316581_0028614	Ga0316581_0028614_395_1333	289
78	3300050510	nmdc:mga06r32_175317_c1	nmdc:mga06r32_175317_c1_207_1226	290
79	3300005337	Ga0070682_100000026	Ga0070682_100000026186	291
80	3300005355	Ga0070671_100015451	Ga0070671_1000154513	291
81	3300005578	Ga0068854_100000082	Ga0068854_10000008242	291
82	3300005937	Ga0081455_10002376	Ga0081455_1000237611	291
83	3300005937	Ga0081455_10011122	Ga0081455_100111224	291
84	3300005981	Ga0081538_10000105	Ga0081538_1000010520	291
85	3300005981	Ga0081538_10006122	Ga0081538_100061224	291
86	3300005981	Ga0081538_10039860	Ga0081538_100398602	291
87	3300006844	Ga0075428_100081073	Ga0075428_1000810732	291
88	3300009147	Ga0114129_10240984	Ga0114129_102409842	291
89	3300025931	Ga0207644_10335360	Ga0207644_103353602	291
90	3300042005	Ga0439448_0003212	Ga0439448_0003212_3249_4265	291
91	3300042008	Ga0439450_000102	Ga0439450_000102_4433_5449	291
92	3300042016	Ga0439463_001393	Ga0439463_001393_3623_4639	291
93	3300042439	Ga0439464_0005057	Ga0439464_0005057_2266_3282	291
94	3300042461	Ga0439460_0001170	Ga0439460_0001170_4564_5580	291
95	3300042993	Ga0439440_0001759	Ga0439440_0001759_1205_2221	291
96	3300049572	Ga0501036_0013793	Ga0501036_0013793_1380_2384	291
97	3300049573	Ga0501037_0016735	Ga0501037_0016735_3154_4158	291
98	3300049579	Ga0501043_0147127	Ga0501043_0147127_545_1549	291
99	3300049588	Ga0501072_0062344	Ga0501072_0062344_621_1625	291
100	3300049588	Ga0501072_0119123	Ga0501072_0119123_916_1953	291
101	3300049591	Ga0501075_0010211	Ga0501075_0010211_4319_5323	291
102	3300049592	Ga0501076_0004007	Ga0501076_0004007_8057_9061	291
103	3300049593	Ga0501077_0010284	Ga0501077_0010284_1380_2384	291
104	3300049741	Ga0501079_0014887	Ga0501079_0014887_3545_4549	291
105	3300049742	Ga0501080_0341414	Ga0501080_0341414_147_1151	291
106	3300049743	Ga0501081_0007958	Ga0501081_0007958_4604_5608	291
107	3300049744	Ga0501083_0126947	Ga0501083_0126947_64_1068	291
108	3300049822	Ga0501035_0145580	Ga0501035_0145580_187_1191	291
109	3300049824	Ga0501045_0010967	Ga0501045_0010967_3415_4419	291
110	3300050508	nmdc:mga09592_21712_c1	nmdc:mga09592_21712_c1_2899_3915	291
111	3300050510	nmdc:mga06r32_445838_c1	nmdc:mga06r32_445838_c1_204_1208	291
112	3300053085	Ga0495619_0000088	Ga0495619_0000088_60783_61769	291
113	3300054114	Ga0501084_0000104	Ga0501084_0000104_15971_17008	291
114	3300060353	Ga0501082_0037333	Ga0501082_0037333_1467_2471	291
115	3300061734	Ga0530510_0013739	Ga0530510_0013739_3474_4478	291
116	3300061734	Ga0530510_0069400	Ga0530510_0069400_484_1497	291
117	iso_pu_bacteria	2808606394	2809028160	291
118	3300005842	Ga0068858_100036468	Ga0068858_1000364682	292
119	3300025931	Ga0207644_10017944	Ga0207644_100179445	292
120	3300026035	Ga0207703_10029846	Ga0207703_100298462	292
121	3300048915	Ga0496112_0001298	Ga0496112_0001298_10941_11936	292
122	3300048916	Ga0496113_0000005	Ga0496113_0000005_102131_103126	292
123	3300005330	Ga0070690_100039161	Ga0070690_1000391612	293
124	3300005340	Ga0070689_100110005	Ga0070689_1001100052	293
125	3300005718	Ga0068866_10080681	Ga0068866_100806812	293
126	3300005842	Ga0068858_100053436	Ga0068858_1000534363	293
127	3300009148	Ga0105243_10032278	Ga0105243_100322782	293
128	3300009176	Ga0105242_10017399	Ga0105242_100173996	293
129	3300009553	Ga0105249_10079542	Ga0105249_100795423	293
130	3300013297	Ga0157378_10031394	Ga0157378_100313945	293
131	3300014968	Ga0157379_10019221	Ga0157379_100192215	293
132	3300025899	Ga0207642_10121463	Ga0207642_101214631	293
133	3300025923	Ga0207681_10229632	Ga0207681_102296322	293
134	3300025933	Ga0207706_10271785	Ga0207706_102717852	293
135	3300025934	Ga0207686_10112568	Ga0207686_101125682	293
136	3300025936	Ga0207670_10181180	Ga0207670_101811802	293
137	3300025938	Ga0207704_10397815	Ga0207704_103978152	293
138	3300025940	Ga0207691_10143766	Ga0207691_101437661	293
139	3300026089	Ga0207648_10001336	Ga0207648_1000133625	293
140	3300026118	Ga0207675_100308164	Ga0207675_1003081642	293
141	3300032002	Ga0307416_100261983	Ga0307416_1002619831	293
142	3300035398	Ga0316574_0091003	Ga0316574_0091003_130_1074	293
143	3300048904	Ga0496101_0063830	Ga0496101_0063830_1493_2443	293
144	3300048908	Ga0496105_0094339	Ga0496105_0094339_726_1676	293
145	3300048913	Ga0496110_0022374	Ga0496110_0022374_3645_4595	293
146	3300048917	Ga0496114_0004863	Ga0496114_0004863_6046_6996	293
147	3300050507	nmdc:mga05p37_662221_c1	nmdc:mga05p37_662221_c1_74_1024	293
148	3300054114	Ga0501084_0082224	Ga0501084_0082224_1383_2300	293
149	3300005467	Ga0070706_100011077	Ga0070706_1000110778	294
150	3300033527	Ga0316586_1001030	Ga0316586_10010301	294
151	3300033529	Ga0316587_1011710	Ga0316587_10117101	294
152	3300039062	Ga0400483_092270	Ga0400483_092270_2121_3068	294
153	3300049586	Ga0501070_0135131	Ga0501070_0135131_961_2004	294
154	3300005434	Ga0070709_10015386	Ga0070709_100153862	295
155	3300005445	Ga0070708_100200128	Ga0070708_1002001281	295
156	3300005458	Ga0070681_10057213	Ga0070681_100572132	295
157	3300005467	Ga0070706_100028025	Ga0070706_1000280255	295
158	3300005468	Ga0070707_100004177	Ga0070707_10000417716	295
159	3300005468	Ga0070707_100018775	Ga0070707_1000187756	295
160	3300005468	Ga0070707_100060676	Ga0070707_1000606763	295
161	3300005468	Ga0070707_100166808	Ga0070707_1001668081	295
162	3300005471	Ga0070698_100078532	Ga0070698_1000785322	295
163	3300005471	Ga0070698_100329106	Ga0070698_1003291062	295
164	3300005617	Ga0068859_100229136	Ga0068859_1002291362	295
165	3300005981	Ga0081538_10037636	Ga0081538_100376363	295
166	3300005985	Ga0081539_10038494	Ga0081539_100384943	295
167	3300006038	Ga0075365_10004563	Ga0075365_100045631	295
168	3300006038	Ga0075365_10032753	Ga0075365_100327532	295
169	3300006048	Ga0075363_100009449	Ga0075363_1000094494	295
170	3300006051	Ga0075364_10046718	Ga0075364_100467181	295
171	3300006051	Ga0075364_10141866	Ga0075364_101418662	295
172	3300006177	Ga0075362_10124556	Ga0075362_101245562	295
173	3300006844	Ga0075428_100028377	Ga0075428_1000283772	295
174	3300006844	Ga0075428_100438503	Ga0075428_1004385032	295
175	3300006846	Ga0075430_100006829	Ga0075430_1000068294	295
176	3300006846	Ga0075430_100015802	Ga0075430_1000158024	295
177	3300006847	Ga0075431_100000056	Ga0075431_10000005631	295
178	3300006847	Ga0075431_100011012	Ga0075431_1000110123	295
179	3300006880	Ga0075429_100005701	Ga0075429_1000057012	295
180	3300006931	Ga0097620_100229135	Ga0097620_1002291352	295
181	3300009098	Ga0105245_10010835	Ga0105245_100108354	295
182	3300009147	Ga0114129_10074343	Ga0114129_100743432	295
183	3300009174	Ga0105241_10377633	Ga0105241_103776331	295
184	3300009553	Ga0105249_10260326	Ga0105249_102603262	295
185	3300010375	Ga0105239_10777474	Ga0105239_107774741	295
186	3300011119	Ga0105246_10205460	Ga0105246_102054602	295
187	3300013297	Ga0157378_10169152	Ga0157378_101691522	295
188	3300013306	Ga0163162_10437071	Ga0163162_104370712	295
189	3300025906	Ga0207699_10178366	Ga0207699_101783662	295
190	3300025912	Ga0207707_10143129	Ga0207707_101431292	295
191	3300025922	Ga0207646_10008785	Ga0207646_100087854	295
192	3300025927	Ga0207687_10067672	Ga0207687_100676722	295
193	3300025961	Ga0207712_10213946	Ga0207712_102139462	295
194	3300026088	Ga0207641_10407842	Ga0207641_104078422	295
195	3300031727	Ga0316576_10012576	Ga0316576_100125762	295
196	3300031728	Ga0316578_10012226	Ga0316578_100122265	295
197	3300031733	Ga0316577_10032465	Ga0316577_100324653	295
198	3300031852	Ga0307410_10004681	Ga0307410_100046816	295
199	3300035118	Ga0373954_0150642	Ga0373954_0150642_12_1016	295
200	3300035398	Ga0316574_0071619	Ga0316574_0071619_1026_2000	295
201	3300036401	Ga0373937_0128490	Ga0373937_0128490_189_1157	295
202	3300039447	Ga0436361_0072893	Ga0436361_0072893_6553_7551	295
203	3300039453	Ga0436362_0242738	Ga0436362_0242738_5431_6405	295
204	3300044693	Ga0466961_0026662	Ga0466961_0026662_2451_3422	295
205	3300045976	Ga0466967_0109784	Ga0466967_0109784_558_1511	295
206	3300046454	Ga0495592_0292385	Ga0495592_0292385_55_1035	295
207	3300046462	Ga0495651_0005694	Ga0495651_0005694_3175_4143	295
208	3300046463	Ga0495653_0050072	Ga0495653_0050072_966_1934	295
209	3300046511	Ga0495608_0109944	Ga0495608_0109944_477_1457	295
210	3300046543	Ga0495645_0152051	Ga0495645_0152051_314_1399	295
211	3300046559	Ga0495667_0011435	Ga0495667_0011435_1834_2802	295
212	3300046675	Ga0495657_0011500	Ga0495657_0011500_3602_4570	295
213	3300046678	Ga0495599_0182324	Ga0495599_0182324_223_1191	295
214	3300046809	Ga0495600_0016607	Ga0495600_0016607_2305_3273	295
215	3300047317	Ga0495604_0030162	Ga0495604_0030162_2593_3561	295
216	3300047322	Ga0495680_0057724	Ga0495680_0057724_948_1916	295
217	3300047322	Ga0495680_0180118	Ga0495680_0180118_307_1287	295
218	3300047444	Ga0495675_0054175	Ga0495675_0054175_189_1157	295
219	3300048088	Ga0495602_0094730	Ga0495602_0094730_426_1394	295
220	3300048911	Ga0496108_0008807	Ga0496108_0008807_3238_4203	295
221	3300048911	Ga0496108_0209230	Ga0496108_0209230_565_1515	295
222	3300048912	Ga0496109_0014549	Ga0496109_0014549_3058_4023	295
223	3300048912	Ga0496109_0187555	Ga0496109_0187555_731_1696	295
224	3300048913	Ga0496110_0022785	Ga0496110_0022785_3194_4141	295
225	3300048915	Ga0496112_0022626	Ga0496112_0022626_602_1567	295
226	3300048915	Ga0496112_0047242	Ga0496112_0047242_2132_3097	295
227	3300048916	Ga0496113_0417538	Ga0496113_0417538_57_1022	295
228	3300048917	Ga0496114_0194578	Ga0496114_0194578_211_1176	295
229	3300049568	Ga0501031_0057883	Ga0501031_0057883_668_1555	295
230	3300049570	Ga0501033_0080413	Ga0501033_0080413_1031_1918	295
231	3300049576	Ga0501040_0037620	Ga0501040_0037620_1001_1888	295
232	3300049577	Ga0501041_0116714	Ga0501041_0116714_650_1537	295
233	3300049578	Ga0501042_0101354	Ga0501042_0101354_693_1580	295
234	3300049579	Ga0501043_0011646	Ga0501043_0011646_3424_4467	295
235	3300049579	Ga0501043_0021854	Ga0501043_0021854_3927_4814	295
236	3300049582	Ga0501048_0012311	Ga0501048_0012311_4052_4939	295
237	3300049582	Ga0501048_0113313	Ga0501048_0113313_605_1648	295
238	3300049584	Ga0501068_0006401	Ga0501068_0006401_4581_5468	295
239	3300049586	Ga0501070_0019981	Ga0501070_0019981_3263_4150	295
240	3300049587	Ga0501071_0001822	Ga0501071_0001822_7040_7927	295
241	3300049589	Ga0501073_0127173	Ga0501073_0127173_666_1553	295
242	3300049590	Ga0501074_0176942	Ga0501074_0176942_477_1364	295
243	3300049593	Ga0501077_0020656	Ga0501077_0020656_1880_2767	295
244	3300049741	Ga0501079_0038961	Ga0501079_0038961_2280_3167	295
245	3300049742	Ga0501080_0027767	Ga0501080_0027767_1240_2127	295
246	3300049743	Ga0501081_0011089	Ga0501081_0011089_4511_5398	295
247	3300049822	Ga0501035_0044711	Ga0501035_0044711_1683_2570	295
248	3300049824	Ga0501045_0009180	Ga0501045_0009180_336_1223	295
249	3300050492	nmdc:mga0yw44_104361_c1	nmdc:mga0yw44_104361_c1_245_1222	295
250	3300050492	nmdc:mga0yw44_30152_c1	nmdc:mga0yw44_30152_c1_686_1660	295
251	3300050507	nmdc:mga05p37_125645_c1	nmdc:mga05p37_125645_c1_649_1635	295
252	3300050508	nmdc:mga09592_10713_c1	nmdc:mga09592_10713_c1_5663_6649	295
253	3300050510	nmdc:mga06r32_11755_c1	nmdc:mga06r32_11755_c1_6718_7704	295
254	3300053084	Ga0495595_0014378	Ga0495595_0014378_1867_2835	295
255	3300053153	Ga0500616_0001517	Ga0500616_0001517_2435_3403	295
256	3300054114	Ga0501084_0044495	Ga0501084_0044495_1880_2767	295
257	3300060353	Ga0501082_0008395	Ga0501082_0008395_1776_2663	295
258	3300061734	Ga0530510_0037338	Ga0530510_0037338_1475_2362	295
259	3300005354	Ga0070675_100159127	Ga0070675_1001591271	296
260	3300009147	Ga0114129_10023233	Ga0114129_100232339	296
261	3300049568	Ga0501031_0096717	Ga0501031_0096717_375_1310	296
262	3300049570	Ga0501033_0175327	Ga0501033_0175327_486_1421	296
263	3300049572	Ga0501036_0108970	Ga0501036_0108970_208_1143	296
264	3300049574	Ga0501038_0052692	Ga0501038_0052692_988_1923	296
265	3300049576	Ga0501040_0005712	Ga0501040_0005712_5448_6383	296
266	3300049578	Ga0501042_0024553	Ga0501042_0024553_1573_2508	296
267	3300049582	Ga0501048_0045982	Ga0501048_0045982_1039_1974	296
268	3300049586	Ga0501070_0166423	Ga0501070_0166423_456_1391	296
269	3300049588	Ga0501072_0026552	Ga0501072_0026552_2609_3544	296
270	3300049590	Ga0501074_0043628	Ga0501074_0043628_934_1869	296
271	3300049591	Ga0501075_0009320	Ga0501075_0009320_4788_5723	296
272	3300049592	Ga0501076_0057377	Ga0501076_0057377_1294_2229	296
273	3300049593	Ga0501077_0062892	Ga0501077_0062892_1279_2214	296
274	3300049743	Ga0501081_0010230	Ga0501081_0010230_770_1705	296
275	3300049824	Ga0501045_0070406	Ga0501045_0070406_1558_2493	296
276	3300060353	Ga0501082_0065058	Ga0501082_0065058_1804_2739	296
277	3300061734	Ga0530510_0024446	Ga0530510_0024446_703_1638	296
278	3300039062	Ga0400483_023354	Ga0400483_023354_1258_2208	297
279	3300049590	Ga0501074_0263384	Ga0501074_0263384_111_1082	297
280	3300005535	Ga0070684_100159311	Ga0070684_1001593113	299
281	3300005539	Ga0068853_100317441	Ga0068853_1003174412	299
282	3300005564	Ga0070664_100139610	Ga0070664_1001396103	299
283	3300005577	Ga0068857_100004671	Ga0068857_1000046713	299
284	3300009094	Ga0111539_10000449	Ga0111539_1000044936	299
285	3300025944	Ga0207661_10093744	Ga0207661_100937444	299
286	3300025945	Ga0207679_10112977	Ga0207679_101129772	299
287	3300026116	Ga0207674_10003204	Ga0207674_1000320411	299
288	3300027907	Ga0207428_10005428	Ga0207428_1000542811	299
289	3300039062	Ga0400483_031601	Ga0400483_031601_17963_18976	299
290	3300039062	Ga0400483_230433	Ga0400483_230433_27124_28137	299
291	3300050511	nmdc:mga08y16_10571_c1	nmdc:mga08y16_10571_c1_2748_3650	299
292	3300001991	JGI24743J22301_10002073	JGI24743J22301_100020734	300
293	3300002075	JGI24738J21930_10007689	JGI24738J21930_100076893	300
294	3300003373	JGI25407J50210_10016703	JGI25407J50210_100167032	300
295	3300005327	Ga0070658_10060869	Ga0070658_100608694	300
296	3300005329	Ga0070683_100027732	Ga0070683_1000277325	300
297	3300005329	Ga0070683_100112232	Ga0070683_1001122323	300
298	3300005329	Ga0070683_100199838	Ga0070683_1001998382	300
299	3300005331	Ga0070670_100084533	Ga0070670_1000845332	300
300	3300005334	Ga0068869_100043803	Ga0068869_1000438032	300
301	3300005336	Ga0070680_100100769	Ga0070680_1001007694	300
302	3300005336	Ga0070680_100140003	Ga0070680_1001400032	300
303	3300005337	Ga0070682_100040946	Ga0070682_1000409462	300
304	3300005337	Ga0070682_100044622	Ga0070682_1000446223	300
305	3300005338	Ga0068868_100024062	Ga0068868_1000240627	300
306	3300005339	Ga0070660_100010492	Ga0070660_1000104925	300
307	3300005339	Ga0070660_100044189	Ga0070660_1000441894	300
308	3300005339	Ga0070660_100255679	Ga0070660_1002556792	300
309	3300005340	Ga0070689_100015926	Ga0070689_1000159267	300
310	3300005341	Ga0070691_10016718	Ga0070691_100167184	300
311	3300005344	Ga0070661_100048667	Ga0070661_1000486672	300
312	3300005344	Ga0070661_100187239	Ga0070661_1001872392	300
313	3300005345	Ga0070692_10006300	Ga0070692_100063002	300
314	3300005354	Ga0070675_100077658	Ga0070675_1000776582	300
315	3300005354	Ga0070675_100087078	Ga0070675_1000870783	300
316	3300005355	Ga0070671_100022183	Ga0070671_1000221837	300
317	3300005356	Ga0070674_100012058	Ga0070674_1000120584	300
318	3300005364	Ga0070673_100016100	Ga0070673_1000161007	300
319	3300005365	Ga0070688_100001975	Ga0070688_1000019758	300
320	3300005366	Ga0070659_100025815	Ga0070659_1000258155	300
321	3300005366	Ga0070659_100052030	Ga0070659_1000520303	300
322	3300005367	Ga0070667_100286204	Ga0070667_1002862042	300
323	3300005438	Ga0070701_10072506	Ga0070701_100725062	300
324	3300005441	Ga0070700_100101299	Ga0070700_1001012992	300
325	3300005441	Ga0070700_100120151	Ga0070700_1001201512	300
326	3300005455	Ga0070663_100019615	Ga0070663_1000196156	300
327	3300005455	Ga0070663_100073687	Ga0070663_1000736872	300
328	3300005456	Ga0070678_100015299	Ga0070678_1000152992	300
329	3300005456	Ga0070678_100081720	Ga0070678_1000817203	300
330	3300005457	Ga0070662_100034134	Ga0070662_1000341342	300
331	3300005457	Ga0070662_100060614	Ga0070662_1000606143	300
332	3300005458	Ga0070681_10146752	Ga0070681_101467522	300
333	3300005459	Ga0068867_100100746	Ga0068867_1001007462	300
334	3300005466	Ga0070685_10018642	Ga0070685_100186424	300
335	3300005530	Ga0070679_100182975	Ga0070679_1001829751	300
336	3300005530	Ga0070679_100253362	Ga0070679_1002533622	300
337	3300005535	Ga0070684_100041522	Ga0070684_1000415226	300
338	3300005539	Ga0068853_100021929	Ga0068853_1000219292	300
339	3300005543	Ga0070672_100059653	Ga0070672_1000596534	300
340	3300005544	Ga0070686_100010299	Ga0070686_1000102997	300
341	3300005545	Ga0070695_100063588	Ga0070695_1000635883	300
342	3300005547	Ga0070693_100038753	Ga0070693_1000387533	300
343	3300005548	Ga0070665_100084556	Ga0070665_1000845563	300
344	3300005563	Ga0068855_100118735	Ga0068855_1001187353	300
345	3300005563	Ga0068855_100273801	Ga0068855_1002738012	300
346	3300005564	Ga0070664_100127073	Ga0070664_1001270732	300
347	3300005578	Ga0068854_100030811	Ga0068854_1000308112	300
348	3300005578	Ga0068854_100084357	Ga0068854_1000843572	300
349	3300005578	Ga0068854_100085914	Ga0068854_1000859142	300
350	3300005615	Ga0070702_100115900	Ga0070702_1001159002	300
351	3300005616	Ga0068852_100205526	Ga0068852_1002055262	300
352	3300005718	Ga0068866_10067288	Ga0068866_100672882	300
353	3300005719	Ga0068861_100293881	Ga0068861_1002938812	300
354	3300005834	Ga0068851_10040146	Ga0068851_100401463	300
355	3300005840	Ga0068870_10202043	Ga0068870_102020431	300
356	3300005842	Ga0068858_100015291	Ga0068858_1000152912	300
357	3300005981	Ga0081538_10013679	Ga0081538_100136795	300
358	3300006358	Ga0068871_100117013	Ga0068871_1001170132	300
359	3300006358	Ga0068871_100265361	Ga0068871_1002653612	300
360	3300006881	Ga0068865_100056787	Ga0068865_1000567872	300
361	3300009094	Ga0111539_10017044	Ga0111539_100170442	300
362	3300009094	Ga0111539_10226151	Ga0111539_102261512	300
363	3300009098	Ga0105245_10015151	Ga0105245_100151512	300
364	3300009098	Ga0105245_10187064	Ga0105245_101870642	300
365	3300009148	Ga0105243_10057881	Ga0105243_100578814	300
366	3300009148	Ga0105243_10072936	Ga0105243_100729363	300
367	3300009176	Ga0105242_10054296	Ga0105242_100542962	300
368	3300009176	Ga0105242_10243097	Ga0105242_102430972	300
369	3300009551	Ga0105238_10058177	Ga0105238_100581772	300
370	3300009551	Ga0105238_10499883	Ga0105238_104998832	300
371	3300009553	Ga0105249_10401936	Ga0105249_104019362	300
372	3300009553	Ga0105249_10424915	Ga0105249_104249152	300
373	3300010375	Ga0105239_10124153	Ga0105239_101241533	300
374	3300010375	Ga0105239_10201435	Ga0105239_102014352	300
375	3300013100	Ga0157373_10189268	Ga0157373_101892681	300
376	3300013102	Ga0157371_10058092	Ga0157371_100580922	300
377	3300013296	Ga0157374_10047926	Ga0157374_100479264	300
378	3300013297	Ga0157378_10329390	Ga0157378_103293902	300
379	3300013306	Ga0163162_10930691	Ga0163162_109306911	300
380	3300013307	Ga0157372_10149462	Ga0157372_101494623	300
381	3300014326	Ga0157380_10032839	Ga0157380_100328392	300
382	3300014745	Ga0157377_10055890	Ga0157377_100558904	300
383	3300014745	Ga0157377_10068675	Ga0157377_100686752	300
384	3300014968	Ga0157379_10035466	Ga0157379_100354664	300
385	3300020082	Ga0206353_10842230	Ga0206353_108422302	300
386	3300025321	Ga0207656_10018733	Ga0207656_100187332	300
387	3300025893	Ga0207682_10009047	Ga0207682_100090473	300
388	3300025901	Ga0207688_10043807	Ga0207688_100438073	300
389	3300025901	Ga0207688_10050275	Ga0207688_100502752	300
390	3300025901	Ga0207688_10239190	Ga0207688_102391902	300
391	3300025904	Ga0207647_10056000	Ga0207647_100560002	300
392	3300025907	Ga0207645_10126115	Ga0207645_101261152	300
393	3300025917	Ga0207660_10111470	Ga0207660_101114702	300
394	3300025918	Ga0207662_10028999	Ga0207662_100289992	300
395	3300025919	Ga0207657_10006124	Ga0207657_100061244	300
396	3300025920	Ga0207649_10042792	Ga0207649_100427922	300
397	3300025920	Ga0207649_10259685	Ga0207649_102596852	300
398	3300025921	Ga0207652_10349060	Ga0207652_103490602	300
399	3300025926	Ga0207659_10060913	Ga0207659_100609131	300
400	3300025926	Ga0207659_10385670	Ga0207659_103856702	300
401	3300025927	Ga0207687_10202430	Ga0207687_102024301	300
402	3300025932	Ga0207690_10010789	Ga0207690_100107897	300
403	3300025932	Ga0207690_10496902	Ga0207690_104969021	300
404	3300025933	Ga0207706_10015361	Ga0207706_1001536110	300
405	3300025933	Ga0207706_10022030	Ga0207706_100220303	300
406	3300025933	Ga0207706_10114478	Ga0207706_101144782	300
407	3300025934	Ga0207686_10044923	Ga0207686_100449232	300
408	3300025935	Ga0207709_10035394	Ga0207709_100353944	300
409	3300025936	Ga0207670_10158857	Ga0207670_101588572	300
410	3300025937	Ga0207669_10054128	Ga0207669_100541282	300
411	3300025938	Ga0207704_10113350	Ga0207704_101133502	300
412	3300025938	Ga0207704_10232604	Ga0207704_102326042	300
413	3300025940	Ga0207691_10068837	Ga0207691_100688372	300
414	3300025940	Ga0207691_10089799	Ga0207691_100897993	300
415	3300025941	Ga0207711_10133998	Ga0207711_101339982	300
416	3300025942	Ga0207689_10064480	Ga0207689_100644802	300
417	3300025944	Ga0207661_10039621	Ga0207661_100396214	300
418	3300025949	Ga0207667_10107924	Ga0207667_101079242	300
419	3300025981	Ga0207640_10045752	Ga0207640_100457522	300
420	3300025981	Ga0207640_10295970	Ga0207640_102959702	300
421	3300025986	Ga0207658_10387882	Ga0207658_103878822	300
422	3300026023	Ga0207677_10064176	Ga0207677_100641762	300
423	3300026041	Ga0207639_10336192	Ga0207639_103361922	300
424	3300026067	Ga0207678_10070491	Ga0207678_100704912	300
425	3300026067	Ga0207678_10158302	Ga0207678_101583022	300
426	3300026075	Ga0207708_10035451	Ga0207708_100354514	300
427	3300026075	Ga0207708_10167187	Ga0207708_101671872	300
428	3300026088	Ga0207641_10243443	Ga0207641_102434432	300
429	3300026089	Ga0207648_10045253	Ga0207648_100452532	300
430	3300026095	Ga0207676_10187137	Ga0207676_101871372	300
431	3300026118	Ga0207675_100016689	Ga0207675_1000166893	300
432	3300026118	Ga0207675_100245959	Ga0207675_1002459592	300
433	3300026121	Ga0207683_10021406	Ga0207683_100214066	300
434	3300026121	Ga0207683_10149314	Ga0207683_101493142	300
435	3300026142	Ga0207698_10052395	Ga0207698_100523952	300
436	3300026142	Ga0207698_10184626	Ga0207698_101846262	300
437	3300027907	Ga0207428_10199232	Ga0207428_101992322	300
438	3300048903	Ga0496100_0177806	Ga0496100_0177806_548_1450	300
439	3300048904	Ga0496101_0038317	Ga0496101_0038317_1417_2319	300
440	3300048904	Ga0496101_0151327	Ga0496101_0151327_301_1203	300
441	3300048905	Ga0496102_0232067	Ga0496102_0232067_739_1641	300
442	3300048907	Ga0496104_0015518	Ga0496104_0015518_4902_5804	300
443	3300048909	Ga0496106_0339460	Ga0496106_0339460_162_1064	300
444	3300048910	Ga0496107_0027390	Ga0496107_0027390_1325_2227	300
445	3300048911	Ga0496108_0013267	Ga0496108_0013267_199_1101	300
446	3300048913	Ga0496110_0107834	Ga0496110_0107834_160_1071	300
447	3300048913	Ga0496110_0470158	Ga0496110_0470158_146_1048	300
448	3300048916	Ga0496113_0012392	Ga0496113_0012392_3391_4293	300
449	3300048917	Ga0496114_0005323	Ga0496114_0005323_362_1264	300
450	3300048917	Ga0496114_0056187	Ga0496114_0056187_1241_2143	300
451	3300049572	Ga0501036_0269038	Ga0501036_0269038_457_1359	300
452	3300049824	Ga0501045_0204753	Ga0501045_0204753_136_1038	300
453	3300050511	nmdc:mga08y16_354495_c1	nmdc:mga08y16_354495_c1_585_1496	300
454	3300050511	nmdc:mga08y16_39028_c1	nmdc:mga08y16_39028_c1_2123_3025	300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

57

201

0.98 PF13732

DUF4162

Domain of unknown function (DUF4162)

255

343

0.87 PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

112

235

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8eop-assembly1.cif.gz_A	cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state	0.9316	1	220
7ahd-assembly1.cif.gz_D	opua (e190q) occluded	0.9296	6	217
6xgz-assembly3.cif.gz_E	crystal structure of e. coli mlafb abc transport subunits in the monomeric state	0.9245	1	218
7v8i-assembly1.cif.gz_F	lolcd(e171q)e with bound amppnp in nanodiscs	0.9244	4	213
4p33-assembly1.cif.gz_A	crystal structure of e. coli lptb-e163q in complex with atp-sodium	0.9239	6	219

ID	Description	Score	Start	End	Superfamily
af_O86311_2_235_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9561	4	220	3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9483	4	221	3.40.50.300
af_O33189_10_251_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9463	2	221	3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9436	2	212	3.40.50.300
af_Q9TXV8_581_832_3.40.50.300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases	0.9431	4	220	3.40.50.300

ID	Description	Score	Start	End	GO Terms
AF-A0A328VDH5-F1-model_v4	ABC transporter domain-containing protein	0.9553	4	213	GO:0005524 GO:0016887
AF-A0A7X7K1P0-F1-model_v4	ABC transporter ATP-binding protein	0.9545	4	221	GO:0005524 GO:0016887
AF-A0A520NVZ7-F1-model_v4	ABC transporter ATP-binding protein	0.9542	1	220	GO:0005524 GO:0016887
AF-A0A4Q3AX05-F1-model_v4	ATP-binding cassette domain-containing protein	0.9536	4	206	GO:0005524 GO:0016887
AF-D9SS60-F1-model_v4	ABC transporter related	0.95	4	220	GO:0005524 GO:0016887

Feature Viewer

pLDDT	pTM	Quality
90.33	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F447345

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00005

ABC_tran

ABC transporter

57

201

0.98

PF13732

DUF4162

Domain of unknown function (DUF4162)

255

343

0.87

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

112

235

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map