F447287

General Info

Members Datasets Scaffolds Average Seq Length
453 366 906 171

Family's Representative Sequence

Representative Sequence 3300053125|Ga0500618_001093|Ga0500618_001093_10018_10602
Length 194
Sequence VADDQSCSNHVKGQTTVTAPDNKPTIRILDARQARAANADLSETLSDCINGGASLGFMLPFAASDAEGYWHEIADAVEAGGIILAVAEIEGRVVGTVQVGLASKPNQPHRGDLMKLLVHRCARGLGLSRRLMAAVEAEAAGRGRTLLVLDTATGSEAEMIYPRFGWQRVGVIPDYALWPDGGFCATTLFYKRIG

Samples

Sample ID Description Type Environment
1 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
74 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
88 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
89 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
148 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
149 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
152 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
153 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
154 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
176 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
202 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
203 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
204 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
205 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
206 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
207 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
224 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
230 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
235 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
236 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
237 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
238 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
239 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
240 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
241 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
242 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
243 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
244 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
245 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
246 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
247 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
248 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
249 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
250 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
251 2519899620 Rhizobium sp. Pop5 Isolate Nodule
252 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
253 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
254 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
255 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
256 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
257 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
258 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
259 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
260 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
261 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
262 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
263 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
264 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
265 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
266 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
267 2643221557 Ensifer sp. Root558 Isolate Unclassified
268 2643221558 Rhizobium sp. Root149 Isolate Unclassified
269 2643221599 Rhizobium sp. Root708 Isolate Unclassified
270 2643221610 Ensifer sp. Root74 Isolate Unclassified
271 2643221618 Ensifer sp. Root231 Isolate Unclassified
272 2643221626 Ensifer sp. Root31 Isolate Unclassified
273 2643221655 Ensifer sp. Root1252 Isolate Unclassified
274 2643221659 Ensifer sp. Root127 Isolate Unclassified
275 2643221668 Ensifer sp. Root423 Isolate Unclassified
276 2643221675 Ensifer sp. Root1298 Isolate Unclassified
277 2643221680 Ensifer sp. Root1312 Isolate Unclassified
278 2643221698 Ensifer sp. Root142 Isolate Unclassified
279 2643221712 Ensifer sp. Root258 Isolate Unclassified
280 2643221723 Ensifer sp. Root278 Isolate Unclassified
281 2643221726 Ensifer sp. Root954 Isolate Unclassified
282 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
283 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
284 2773857925 Microvirga vignae BR3299 Isolate Unclassified
285 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
286 2791355261 Rhizobium sp. J15 Isolate Nodule
287 2791355263 Rhizobium chutanense C5 Isolate Nodule
288 2791355266 Rhizobium sp. L43 Isolate Nodule
289 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
290 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
291 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
292 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
293 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
294 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
295 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
296 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
297 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
298 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
299 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
300 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
301 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
302 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
303 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
304 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
305 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
306 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
307 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
308 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
309 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
310 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
311 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
312 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
313 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
314 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
315 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
316 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
317 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
318 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
319 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
320 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
321 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
322 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
323 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
324 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
325 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
326 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
327 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
328 2844163670 Ensifer sp. 1H6 Isolate Unclassified
329 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
330 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
331 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
332 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
333 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
334 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
335 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
336 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
337 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
338 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
339 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
340 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
341 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
342 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
343 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
344 2936381700 Rhizobium chutanense C16 Isolate Unclassified
345 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
346 2996893221 Rhizobium sp. R635 Isolate Nodule
347 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
348 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
349 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
350 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
351 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
352 8005382845 Rhizobium sp. R634 Isolate Nodule
353 8005395548 Rhizobium sp. R339 Isolate Nodule
354 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
355 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
356 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
357 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
358 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
359 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
360 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
361 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
362 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
363 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
364 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
365 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
366 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 70.42
Metatranscriptomes 0.22
Isolates 29.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.78
Nodule 19.65
Rhizoplane 2.87
Rhizosphere 41.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500618_001093 3300053125 Bacteria 13314
2 JGI24751J29686_10021906 3300002459 Bacteria 1325
3 JGI25152J39213_1003928 3300002773 Bacteria 4872
4 JGI25159J45721_1000015 3300002987 Bacteria 142431
5 JGI25151J46595_10044890 3300003187 Bacteria 1565
6 JGI25406J46586_10011591 3300003203 Bacteria 3862
7 JGI25165J46597_1021374 3300003214 Bacteria 846
8 JGI25153J46596_10006501 3300003215 Bacteria 5897
9 JGI25153J46596_10028960 3300003215 Bacteria 1910
10 rootH1_10177936 3300003323 Bacteria 4409
11 JGI25160J50197_1000003 3300003354 Bacteria 482719
12 JGI25161J50226_1000802 3300003374 Bacteria 11843
13 Ga0055526_1000831 3300003771 Bacteria 23077
14 Ga0055524_1003261 3300003775 Bacteria 7944
15 Ga0055524_1010382 3300003775 Bacteria 3711
16 Ga0055536_1002603 3300003781 Bacteria 10054
17 Ga0055536_1009922 3300003781 Bacteria 3861
18 Ga0055528_1015806 3300003790 Bacteria 2704
19 Ga0055530_10012189 3300003791 Bacteria 3016
20 Ga0055540_1001932 3300003792 Bacteria 11586
21 Ga0055540_1024726 3300003792 Bacteria 1485
22 Ga0055531_10012554 3300003794 Bacteria 3975
23 Ga0055543_1000034 3300004625 Bacteria 128668
24 Ga0065165_1000047 3300005262 Bacteria 197811
25 Ga0065165_1005160 3300005262 Bacteria 7554
26 Ga0065165_1017849 3300005262 Bacteria 2596
27 Ga0070670_100581870 3300005331 Bacteria 1001
28 Ga0070670_100905404 3300005331 Bacteria 800
29 Ga0070677_10079328 3300005333 Bacteria 1400
30 Ga0068869_100260740 3300005334 Bacteria 1387
31 Ga0070689_100837590 3300005340 Bacteria 811
32 Ga0070671_100344993 3300005355 Bacteria 1270
33 Ga0070674_101211514 3300005356 Bacteria 670
34 Ga0070673_100499610 3300005364 Bacteria 1100
35 Ga0070688_100121792 3300005365 Bacteria 1748
36 Ga0070667_100731475 3300005367 Bacteria 916
37 Ga0070678_100386209 3300005456 Bacteria 1212
38 Ga0070662_100863172 3300005457 Bacteria 771
39 Ga0070681_10679353 3300005458 Bacteria 945
40 Ga0068853_100499865 3300005539 Bacteria 1148
41 Ga0070672_100113312 3300005543 Bacteria 2213
42 Ga0070695_100871889 3300005545 Bacteria 725
43 Ga0070696_100089762 3300005546 Bacteria 2186
44 Ga0070665_100061630 3300005548 Bacteria 3761
45 Ga0070665_100073736 3300005548 Bacteria 3419
46 Ga0070665_100079213 3300005548 Bacteria 3292
47 Ga0070665_100283820 3300005548 Bacteria 1658
48 Ga0070664_100435182 3300005564 Bacteria 1203
49 Ga0068854_100110346 3300005578 Bacteria 2074
50 Ga0068852_100027883 3300005616 Bacteria 4611
51 Ga0068859_100106551 3300005617 Bacteria 2862
52 Ga0068864_100683001 3300005618 Bacteria 1002
53 Ga0068861_100538840 3300005719 Bacteria 1062
54 Ga0068851_10067348 3300005834 Bacteria 1846
55 Ga0068858_100450159 3300005842 Bacteria 1241
56 Ga0068862_100329371 3300005844 Bacteria 1412
57 Ga0081538_10015425 3300005981 Bacteria 5913
58 Ga0081539_10002854 3300005985 Bacteria 22994
59 Ga0075365_10045765 3300006038 Bacteria 2872
60 Ga0075365_10338570 3300006038 Bacteria 1060
61 Ga0075368_10088173 3300006042 Bacteria 1267
62 Ga0075363_100000153 3300006048 Bacteria 17191
63 Ga0075363_100267625 3300006048 Bacteria 987
64 Ga0075364_10000060 3300006051 Bacteria 41109
65 Ga0075364_10013035 3300006051 Bacteria 5101
66 Ga0070712_101128415 3300006175 Bacteria 681
67 Ga0070712_101419739 3300006175 Bacteria 606
68 Ga0075362_10002859 3300006177 Bacteria 5899
69 Ga0075369_10196143 3300006186 Bacteria 931
70 Ga0075366_10001594 3300006195 Bacteria 11350
71 Ga0097621_100529030 3300006237 Bacteria 1071
72 Ga0075370_10054365 3300006353 Bacteria 2274
73 Ga0075428_100593148 3300006844 Bacteria 1183
74 Ga0097620_100106548 3300006931 Bacteria 2862
75 Ga0079104_1000082 3300006946 Bacteria 137722
76 Ga0105240_10000024 3300009093 Bacteria 375919
77 Ga0105240_11182708 3300009093 Bacteria 810
78 Ga0111539_10244767 3300009094 Bacteria 2088
79 Ga0105245_10156340 3300009098 Bacteria 2160
80 Ga0105245_10889252 3300009098 Bacteria 932
81 Ga0105247_10026201 3300009101 Bacteria 3519
82 Ga0114129_10762569 3300009147 Bacteria 1238
83 Ga0114129_12090425 3300009147 Bacteria 683
84 Ga0105243_10180458 3300009148 Bacteria 1835
85 Ga0105243_10601745 3300009148 Bacteria 1058
86 Ga0105243_11244158 3300009148 Bacteria 759
87 Ga0105241_10872421 3300009174 Bacteria 834
88 Ga0105248_10276650 3300009177 Bacteria 1890
89 Ga0105237_10016746 3300009545 Bacteria 7611
90 Ga0105237_10069485 3300009545 Bacteria 3518
91 Ga0105238_10016481 3300009551 Bacteria 7480
92 Ga0105249_10815681 3300009553 Bacteria 997
93 Ga0123341_1000024 3300009765 Bacteria 73026
94 Ga0123342_1011075 3300009766 Bacteria 10037
95 Ga0105246_11387935 3300011119 Bacteria 655
96 Ga0157373_10686807 3300013100 Bacteria 749
97 Ga0157373_10986817 3300013100 Bacteria 628
98 Ga0157370_10012230 3300013104 Bacteria 8916
99 Ga0157369_10265664 3300013105 Bacteria 1789
100 Ga0157369_10299737 3300013105 Bacteria 1672
101 Ga0157378_10784793 3300013297 Bacteria 977
102 Ga0157375_10981525 3300013308 Bacteria 985
103 Ga0163163_10681497 3300014325 Bacteria 1091
104 Ga0157380_11209604 3300014326 Bacteria 799
105 Ga0182008_10039540 3300014497 Bacteria 2357
106 Ga0157379_11667556 3300014968 Bacteria 624
107 Ga0157376_10585011 3300014969 Bacteria 1109
108 Ga0182007_10022241 3300015262 Bacteria 2242
109 Ga0183363_1097 3300015690 Bacteria 24804
110 Ga0213874_10002957 3300021377 Bacteria 3714
111 Ga0213874_10003639 3300021377 Bacteria 3445
112 Ga0213874_10039875 3300021377 Bacteria 1400
113 Ga0213876_10003389 3300021384 Bacteria 9122
114 Ga0209437_110802 3300025233 Bacteria 1385
115 Ga0209677_100497 3300025253 Bacteria 22110
116 Ga0209233_1000385 3300025261 Bacteria 38087
117 Ga0209673_1005065 3300025273 Bacteria 6782
118 Ga0209673_1044968 3300025273 Bacteria 1218
119 Ga0209130_1000005 3300025284 Bacteria 599620
120 Ga0209130_1018602 3300025284 Bacteria 1627
121 Ga0209676_1001950 3300025292 Bacteria 16595
122 Ga0209676_1015027 3300025292 Bacteria 2873
123 Ga0209025_1000814 3300025294 Bacteria 50030
124 Ga0209564_1000113 3300025295 Bacteria 211564
125 Ga0209758_1000383 3300025297 Bacteria 76487
126 Ga0209758_1004981 3300025297 Bacteria 10615
127 Ga0209758_1010373 3300025297 Bacteria 5587
128 Ga0209050_1004879 3300025298 Bacteria 8789
129 Ga0209050_1009396 3300025298 Bacteria 5012
130 Ga0209256_1003022 3300025299 Bacteria 12442
131 Ga0209256_1006391 3300025299 Bacteria 6266
132 Ga0209256_1014537 3300025299 Bacteria 2824
133 Ga0207426_1000015 3300025302 Bacteria 599316
134 Ga0209051_1002339 3300025303 Bacteria 13731
135 Ga0209051_1004987 3300025303 Bacteria 7922
136 Ga0209257_1009588 3300025304 Bacteria 5138
137 Ga0209257_1019587 3300025304 Bacteria 2541
138 Ga0207682_10000865 3300025893 Bacteria 14063
139 Ga0207688_10054484 3300025901 Bacteria 2244
140 Ga0207688_10232493 3300025901 Bacteria 1113
141 Ga0207647_10453680 3300025904 Bacteria 718
142 Ga0207645_10009884 3300025907 Bacteria 6574
143 Ga0207643_10295805 3300025908 Bacteria 1007
144 Ga0207707_11153683 3300025912 Bacteria 629
145 Ga0207695_10000036 3300025913 Bacteria 477897
146 Ga0207695_10805122 3300025913 Bacteria 820
147 Ga0207671_10000345 3300025914 Bacteria 68112
148 Ga0207662_10112405 3300025918 Bacteria 1700
149 Ga0207694_10022504 3300025924 Bacteria 4782
150 Ga0207650_10670362 3300025925 Bacteria 875
151 Ga0207659_10142252 3300025926 Bacteria 1863
152 Ga0207704_10106101 3300025938 Bacteria 1886
153 Ga0207691_10013813 3300025940 Bacteria 7712
154 Ga0207711_10933922 3300025941 Bacteria 806
155 Ga0207689_10081623 3300025942 Bacteria 2658
156 Ga0207679_10754186 3300025945 Bacteria 885
157 Ga0207651_10785673 3300025960 Bacteria 843
158 Ga0207712_10512784 3300025961 Bacteria 1026
159 Ga0207640_10087485 3300025981 Bacteria 2148
160 Ga0207703_10148458 3300026035 Bacteria 2042
161 Ga0207703_11147351 3300026035 Bacteria 747
162 Ga0207641_10642201 3300026088 Bacteria 1042
163 Ga0207648_10874631 3300026089 Bacteria 839
164 Ga0207676_11621330 3300026095 Bacteria 645
165 Ga0207674_10089531 3300026116 Bacteria 3070
166 Ga0207675_100110609 3300026118 Bacteria 2592
167 Ga0207683_10011597 3300026121 Bacteria 7525
168 Ga0207698_10117201 3300026142 Bacteria 2246
169 Ga0209281_1000043 3300027111 Bacteria 341543
170 Ga0268266_10043982 3300028379 Bacteria 3817
171 Ga0268266_10153457 3300028379 Bacteria 2078
172 Ga0268266_10601324 3300028379 Bacteria 1056
173 Ga0307515_10065461 3300028794 Bacteria 5057
174 Ga0265340_10034055 3300031247 Bacteria 2534
175 Ga0307513_10057713 3300031456 Bacteria 4133
176 Ga0307513_10454161 3300031456 Bacteria 1005
177 Ga0307413_11047794 3300031824 Bacteria 702
178 Ga0307406_10509589 3300031901 Bacteria 977
179 Ga0307409_100154362 3300031995 Bacteria 1998
180 Ga0307414_10104688 3300032004 Bacteria 2138
181 Ga0373933_0041173 3300035724 Bacteria 2726
182 Ga0373937_0001807 3300036401 Bacteria 17957
183 Ga0395905_0042662 3300037471 Bacteria 4256
184 Ga0436365_0299198 3300039437 Bacteria 3235
185 Ga0436365_0710996 3300039437 Bacteria 751
186 Ga0436365_1482009 3300039437 Bacteria 23378
187 Ga0436363_1413147 3300039450 Bacteria 1540
188 Ga0439465_0008375 3300041413 Bacteria 3264
189 Ga0451789_1196681 3300041443 Bacteria 945
190 Ga0451841_0400048 3300041498 Bacteria 1230
191 Ga0451846_47508 3300041502 Bacteria 1589
192 Ga0451849_0793336 3300041505 Bacteria 1597
193 Ga0451851_0277716 3300041507 Bacteria 1050
194 Ga0451843_1086932 3300041509 Bacteria 915
195 Ga0451855_0731588 3300041511 Bacteria 1869
196 Ga0451853_1328833 3300041512 Bacteria 2361
197 Ga0439432_032803 3300042006 Bacteria 1673
198 Ga0439462_0076567 3300042015 Bacteria 911
199 Ga0439434_0026893 3300042435 Bacteria 1738
200 Ga0466972_0045730 3300044658 Bacteria 2121
201 Ga0466960_0091436 3300044901 Bacteria 1552
202 Ga0495603_0163678 3300046455 Bacteria 1290
203 Ga0495638_0216342 3300046460 Bacteria 1073
204 Ga0495651_0146476 3300046462 Bacteria 1707
205 Ga0495605_0055781 3300046474 Bacteria 1907
206 Ga0495605_0226224 3300046474 Bacteria 807
207 Ga0495585_0025241 3300046492 Bacteria 3407
208 Ga0495585_0072610 3300046492 Bacteria 1874
209 Ga0495596_0113316 3300046500 Bacteria 1053
210 Ga0495583_0068024 3300046506 Bacteria 1572
211 Ga0495606_0019925 3300046507 Bacteria 4967
212 Ga0495606_0058907 3300046507 Bacteria 2466
213 Ga0495610_0043745 3300046512 Bacteria 2228
214 Ga0495620_0159260 3300046515 Bacteria 877
215 Ga0495631_0071392 3300046518 Bacteria 1500
216 Ga0495632_0005489 3300046519 Bacteria 8377
217 Ga0495632_0029248 3300046519 Bacteria 2870
218 Ga0495632_0244117 3300046519 Bacteria 807
219 Ga0495643_0030728 3300046522 Bacteria 2996
220 Ga0495643_0047476 3300046522 Bacteria 2325
221 Ga0495654_0000070 3300046530 Bacteria 117357
222 Ga0495654_0055745 3300046530 Bacteria 1912
223 Ga0495598_0111288 3300046537 Bacteria 918
224 Ga0495609_0075528 3300046538 Bacteria 1477
225 Ga0495621_0006678 3300046539 Bacteria 3379
226 Ga0495597_0051969 3300046542 Bacteria 1805
227 Ga0495633_0018102 3300046558 Bacteria 3583
228 Ga0495633_0080011 3300046558 Bacteria 1521
229 Ga0495656_0091490 3300046615 Bacteria 1392
230 Ga0495668_0083248 3300046616 Bacteria 1755
231 Ga0495625_0022086 3300046660 Bacteria 4885
232 Ga0495625_0028059 3300046660 Bacteria 4225
233 Ga0495625_0369844 3300046660 Bacteria 902
234 Ga0495661_0094088 3300046665 Bacteria 1699
235 Ga0495588_0072101 3300046674 Bacteria 1797
236 Ga0495588_0077429 3300046674 Bacteria 1734
237 Ga0495649_0058545 3300046694 Bacteria 2076
238 Ga0495649_0212082 3300046694 Bacteria 1003
239 Ga0495589_0040282 3300046794 Bacteria 2333
240 Ga0495660_0025061 3300046810 Bacteria 3390
241 Ga0495681_0126245 3300047470 Bacteria 1093
242 Ga0495681_0253632 3300047470 Bacteria 694
243 Ga0495686_0004105 3300047472 Bacteria 12125
244 Ga0495686_0033107 3300047472 Bacteria 3340
245 Ga0495686_0069967 3300047472 Bacteria 2162
246 Ga0495615_0002577 3300048090 Bacteria 2925
247 Ga0496100_0068357 3300048903 Bacteria 2362
248 Ga0496102_0267271 3300048905 Bacteria 1612
249 Ga0496102_1721350 3300048905 Bacteria 545
250 Ga0496103_0007919 3300048906 Bacteria 6320
251 Ga0496104_0732544 3300048907 Bacteria 896
252 Ga0496106_0198769 3300048909 Bacteria 1595
253 Ga0496111_0000591 3300048914 Bacteria 19050
254 Ga0496113_0086755 3300048916 Bacteria 2405
255 Ga0496115_0169962 3300048918 Bacteria 1803
256 Ga0496116_0059110 3300048919 Bacteria 2495
257 Ga0496116_0108416 3300048919 Bacteria 1639
258 Ga0496117_0009511 3300048920 Bacteria 9030
259 Ga0496118_0010279 3300048921 Bacteria 9284
260 Ga0496118_0328081 3300048921 Bacteria 827
261 Ga0496119_0010062 3300048922 Bacteria 7997
262 Ga0496120_0084434 3300048923 Bacteria 1711
263 Ga0496121_0005420 3300048924 Bacteria 16378
264 Ga0496121_0012847 3300048924 Bacteria 9060
265 Ga0496121_0061525 3300048924 Bacteria 3080
266 Ga0496121_0062716 3300048924 Bacteria 3042
267 Ga0496121_0150722 3300048924 Bacteria 1711
268 Ga0496122_0000018 3300048925 Bacteria 426350
269 Ga0496122_0023068 3300048925 Bacteria 5505
270 Ga0496122_0026620 3300048925 Bacteria 4977
271 Ga0496122_0052828 3300048925 Bacteria 3070
272 Ga0496122_0080950 3300048925 Bacteria 2262
273 Ga0496123_0000015 3300048926 Bacteria 426088
274 Ga0496123_0063414 3300048926 Bacteria 2361
275 Ga0496123_0079874 3300048926 Bacteria 1996
276 Ga0496123_0089702 3300048926 Bacteria 1830
277 Ga0496123_0194358 3300048926 Bacteria 1046
278 Ga0496124_0089588 3300048927 Bacteria 2511
279 Ga0496124_0100956 3300048927 Bacteria 2338
280 Ga0496124_0102984 3300048927 Bacteria 2309
281 Ga0496124_0126008 3300048927 Bacteria 2040
282 Ga0496124_0143764 3300048927 Bacteria 1879
283 Ga0496124_0144771 3300048927 Bacteria 1871
284 Ga0496124_0296883 3300048927 Bacteria 1169
285 Ga0496124_0475317 3300048927 Bacteria 845
286 Ga0496125_0019735 3300048928 Bacteria 6345
287 Ga0496126_0225628 3300048929 Bacteria 1571
288 Ga0496126_0319936 3300048929 Bacteria 1275
289 Ga0501031_0264872 3300049568 Bacteria 1116
290 Ga0501034_0242302 3300049571 Bacteria 1749
291 Ga0501067_0419296 3300049583 Bacteria 747
292 Ga0501068_0022311 3300049584 Bacteria 3701
293 Ga0501069_0083678 3300049585 Bacteria 1799
294 Ga0501073_0082883 3300049589 Bacteria 2231
295 Ga0501079_0719994 3300049741 Bacteria 785
296 Ga0501080_0068329 3300049742 Bacteria 3305
297 Ga0501080_0190718 3300049742 Bacteria 1883
298 Ga0501035_0001208 3300049822 Bacteria 26922
299 Ga0501044_0283287 3300049823 Bacteria 1590
300 nmdc:mga03683_14719_c1 3300050489 Bacteria 2901
301 nmdc:mga03n38_9771_c1 3300050490 Bacteria 3501
302 nmdc:mga00v17_26_c1 3300050491 Bacteria 37082
303 nmdc:mga00v17_537085_c1 3300050491 Bacteria 756
304 nmdc:mga00v17_81723_c1 3300050491 Bacteria 2019
305 nmdc:mga0yw44_35741_c1 3300050492 Bacteria 2922
306 nmdc:mga0k408_9627_c1 3300050493 Bacteria 5215
307 nmdc:mga04h51_37202_c1 3300050495 Bacteria 1570
308 nmdc:mga05p37_608417_c1 3300050507 Bacteria 1232
309 nmdc:mga08y16_114053_c1 3300050511 Bacteria 2813
310 Ga0500578_0162523 3300053086 Bacteria 1384
311 Ga0500566_0239433 3300053094 Bacteria 890
312 Ga0500569_033932 3300053109 Bacteria 1453
313 Ga0500618_000096 3300053125 Bacteria 72003
314 Ga0500618_007203 3300053125 Bacteria 3196
315 Ga0500618_010087 3300053125 Bacteria 2547
316 Ga0500618_061128 3300053125 Bacteria 847
317 Ga0500658_0000667 3300053134 Bacteria 14151
318 Ga0500616_0001686 3300053153 Bacteria 20346
319 Ga0500622_0038069 3300053156 Bacteria 2511
320 Ga0501082_0379769 3300060353 Bacteria 1233
321 2509444527 2509276033 Bacteria 7180565
322 2510135726 2510065019 Bacteria 6903379
323 2511174212 2510917026 Bacteria 7046020
324 2513570888 2513237084 Bacteria 7231967
325 2513574905 2513237085 Bacteria 7695351
326 2513633681 2513237093 Bacteria 7545552
327 2513707529 2513237103 Bacteria 7647401
328 2513924354 2513237146 Bacteria 7166346
329 2514024057 2513237162 Bacteria 7468464
330 2515114895 2515075009 Bacteria 7288508
331 2515635753 2515154113 Bacteria 7807172
332 2515641366 2515154114 Bacteria 7848616
333 2515741132 2515154134 Bacteria 7220242
334 2517038510 2516653077 Bacteria 7555578
335 2517078777 2516653085 Bacteria 7346596
336 2517097529 2517093000 Bacteria 7412387
337 2517408975 2517287029 Bacteria 6905599
338 2520375886 2519899620 Bacteria 6499161
339 2530648293 2529292951 Bacteria 6916614
340 2585259590 2582581304 Bacteria 5831370
341 2585330546 2582581316 Bacteria 7774528
342 2585523891 2585427526 Bacteria 7258840
343 2585533899 2585427527 Bacteria 7273426
344 2585553557 2585427530 Bacteria 7383882
345 2585843579 2585427594 Bacteria 6180594
346 2585998472 2585427633 Bacteria 6413184
347 2586003035 2585427634 Bacteria 6455027
348 2599419687 2599185170 Bacteria 7295545
349 2599718765 2599185236 Bacteria 6875203
350 2600195299 2599185352 Bacteria 7228948
351 2600376705 2600254933 Bacteria 4750527
352 2616293900 2615840624 Bacteria 6557588
353 2616309514 2615840626 Bacteria 7921970
354 2643805814 2643221557 Bacteria 7184309
355 2643812553 2643221558 Bacteria 5460675
356 2644004211 2643221599 Bacteria 6292121
357 2644065990 2643221610 Bacteria 7480339
358 2644103766 2643221618 Bacteria 7717186
359 2644144647 2643221626 Bacteria 8069654
360 2644306696 2643221655 Bacteria 7722067
361 2644330887 2643221659 Bacteria 7890716
362 2644380294 2643221668 Bacteria 7306521
363 2644417321 2643221675 Bacteria 7473456
364 2644450717 2643221680 Bacteria 7473610
365 2644541106 2643221698 Bacteria 7756764
366 2644612307 2643221712 Bacteria 7729434
367 2644671492 2643221723 Bacteria 7095460
368 2644692858 2643221726 Bacteria 7455827
369 2725947648 2724679232 Bacteria 7646494
370 2766067102 2765235942 Bacteria 7445910
371 2774872990 2773857925 Bacteria 6472445
372 2793314162 2791355259 Bacteria 7254731
373 2793327628 2791355261 Bacteria 6661293
374 2793341096 2791355263 Bacteria 6872478
375 2793358468 2791355266 Bacteria 7116587
376 2819640911 2818991453 Bacteria 7181617
377 2819685857 2818991461 Bacteria 7026071
378 2821123270 2821123053 Bacteria 7836056
379 2838026907 2838022645 Bacteria 6494267
380 2838039780 2838035591 Bacteria 7166484
381 2838664062 2838661181 Bacteria 7385261
382 2838680069 2838680041 Bacteria 6545511
383 2838689790 2838686498 Bacteria 7807632
384 2838695900 2838694306 Bacteria 6853137
385 2838709275 2838707686 Bacteria 6619912
386 2838731514 2838729681 Bacteria 7400765
387 2838739707 2838736955 Bacteria 5760694
388 2838744455 2838742623 Bacteria 7396178
389 2841844169 2841840854 Bacteria 5761912
390 2841852995 2841851746 Bacteria 7532261
391 2842079489 2842077413 Bacteria 6508645
392 2842112689 2842110456 Bacteria 7656360
393 2842120107 2842118031 Bacteria 7033875
394 2842143890 2842140634 Bacteria 5759631
395 2842160322 2842156927 Bacteria 6894975
396 2842165700 2842163707 Bacteria 6916235
397 2842184012 2842180545 Bacteria 6888678
398 2842202376 2842198810 Bacteria 6608673
399 2842219370 2842217011 Bacteria 7497767
400 2842231594 2842229732 Bacteria 7475766
401 2842238686 2842237096 Bacteria 6620661
402 2842245937 2842243621 Bacteria 7421798
403 2842260315 2842257432 Bacteria 7401195
404 2842273726 2842271015 Bacteria 7807131
405 2842286341 2842285085 Bacteria 6011953
406 2842293150 2842291075 Bacteria 7076806
407 2842308413 2842304105 Bacteria 7023636
408 2842370531 2842370503 Bacteria 7038661
409 2842379547 2842377471 Bacteria 7140707
410 2842386618 2842384541 Bacteria 7057858
411 2842397789 2842395702 Bacteria 6780583
412 2842404106 2842402390 Bacteria 6681310
413 2842410191 2842409023 Bacteria 6687331
414 2842416839 2842415677 Bacteria 6596907
415 2844164710 2844163670 Bacteria 7266046
416 2844456538 2844454524 Bacteria 7952546
417 2854900815 2854896431 Bacteria 5869725
418 2854918843 2854916844 Bacteria 5725939
419 2857520825 2857516855 Bacteria 7787325
420 2857533778 2857531043 Bacteria 6754041
421 2882461507 2882456835 Bacteria 6863978
422 2919172438 2919171160 Bacteria 6499771
423 2920822854 2920822456 Bacteria 6897201
424 2933019108 2933016740 Bacteria 6355406
425 2933574862 2933570622 Bacteria 7023390
426 2933588422 2933586486 Bacteria 7667493
427 2935896420 2935894831 Bacteria 6620579
428 2935902375 2935901341 Bacteria 7341747
429 2936369472 2936367885 Bacteria 7324495
430 2936380164 2936375103 Bacteria 6652732
431 2936388021 2936381700 Bacteria 7006523
432 2941503998 2941499720 Bacteria 7599444
433 2996897660 2996893221 Bacteria 5823108
434 3005410684 3005409236 Bacteria 7188837
435 639646126 639633055 Bacteria 7751309
436 8005305535 8005301065 Bacteria 6614431
437 8005310305 8005307578 Bacteria 7395396
438 8005377980 8005376324 Bacteria 6590079
439 8005384038 8005382845 Bacteria 6732062
440 8005399666 8005395548 Bacteria 6806915
441 8005465591 8005460587 Bacteria 7157962
442 8005543081 8005542996 Bacteria 7077758
443 8005560036 8005556819 Bacteria 6908598
444 8005692712 8005688590 Bacteria 6610080
445 8005701401 8005695170 Bacteria 6912330
446 8018132616 8018127388 Bacteria 7351159
447 8018154630 8018150411 Bacteria 5549903
448 8023681218 8023680758 Bacteria 7729763
449 8024479748 8024479707 Bacteria 6954785
450 8046769703 8046767195 Bacteria 7547379
451 8056878713 8056875544 Bacteria 4355797
452 8057582387 8057575449 Bacteria 7367519
453 8057878640 8057874678 Bacteria 7494653
454 Ga0500618_001093
455 JGI24751J29686_10021906
456 JGI25152J39213_1003928
457 JGI25159J45721_1000015
458 JGI25151J46595_10044890
459 JGI25406J46586_10011591
460 JGI25165J46597_1021374
461 JGI25153J46596_10006501
462 JGI25153J46596_10028960
463 rootH1_10177936
464 JGI25160J50197_1000003
465 JGI25161J50226_1000802
466 Ga0055526_1000831
467 Ga0055524_1003261
468 Ga0055524_1010382
469 Ga0055536_1002603
470 Ga0055536_1009922
471 Ga0055528_1015806
472 Ga0055530_10012189
473 Ga0055540_1001932
474 Ga0055540_1024726
475 Ga0055531_10012554
476 Ga0055543_1000034
477 Ga0065165_1000047
478 Ga0065165_1005160
479 Ga0065165_1017849
480 Ga0070670_100581870
481 Ga0070670_100905404
482 Ga0070677_10079328
483 Ga0068869_100260740
484 Ga0070689_100837590
485 Ga0070671_100344993
486 Ga0070674_101211514
487 Ga0070673_100499610
488 Ga0070688_100121792
489 Ga0070667_100731475
490 Ga0070678_100386209
491 Ga0070662_100863172
492 Ga0070681_10679353
493 Ga0068853_100499865
494 Ga0070672_100113312
495 Ga0070695_100871889
496 Ga0070696_100089762
497 Ga0070665_100061630
498 Ga0070665_100073736
499 Ga0070665_100079213
500 Ga0070665_100283820
501 Ga0070664_100435182
502 Ga0068854_100110346
503 Ga0068852_100027883
504 Ga0068859_100106551
505 Ga0068864_100683001
506 Ga0068861_100538840
507 Ga0068851_10067348
508 Ga0068858_100450159
509 Ga0068862_100329371
510 Ga0081538_10015425
511 Ga0081539_10002854
512 Ga0075365_10045765
513 Ga0075365_10338570
514 Ga0075368_10088173
515 Ga0075363_100000153
516 Ga0075363_100267625
517 Ga0075364_10000060
518 Ga0075364_10013035
519 Ga0070712_101128415
520 Ga0070712_101419739
521 Ga0075362_10002859
522 Ga0075369_10196143
523 Ga0075366_10001594
524 Ga0097621_100529030
525 Ga0075370_10054365
526 Ga0075428_100593148
527 Ga0097620_100106548
528 Ga0079104_1000082
529 Ga0105240_10000024
530 Ga0105240_11182708
531 Ga0111539_10244767
532 Ga0105245_10156340
533 Ga0105245_10889252
534 Ga0105247_10026201
535 Ga0114129_10762569
536 Ga0114129_12090425
537 Ga0105243_10180458
538 Ga0105243_10601745
539 Ga0105243_11244158
540 Ga0105241_10872421
541 Ga0105248_10276650
542 Ga0105237_10016746
543 Ga0105237_10069485
544 Ga0105238_10016481
545 Ga0105249_10815681
546 Ga0123341_1000024
547 Ga0123342_1011075
548 Ga0105246_11387935
549 Ga0157373_10686807
550 Ga0157373_10986817
551 Ga0157370_10012230
552 Ga0157369_10265664
553 Ga0157369_10299737
554 Ga0157378_10784793
555 Ga0157375_10981525
556 Ga0163163_10681497
557 Ga0157380_11209604
558 Ga0182008_10039540
559 Ga0157379_11667556
560 Ga0157376_10585011
561 Ga0182007_10022241
562 Ga0183363_1097
563 Ga0213874_10002957
564 Ga0213874_10003639
565 Ga0213874_10039875
566 Ga0213876_10003389
567 Ga0209437_110802
568 Ga0209677_100497
569 Ga0209233_1000385
570 Ga0209673_1005065
571 Ga0209673_1044968
572 Ga0209130_1000005
573 Ga0209130_1018602
574 Ga0209676_1001950
575 Ga0209676_1015027
576 Ga0209025_1000814
577 Ga0209564_1000113
578 Ga0209758_1000383
579 Ga0209758_1004981
580 Ga0209758_1010373
581 Ga0209050_1004879
582 Ga0209050_1009396
583 Ga0209256_1003022
584 Ga0209256_1006391
585 Ga0209256_1014537
586 Ga0207426_1000015
587 Ga0209051_1002339
588 Ga0209051_1004987
589 Ga0209257_1009588
590 Ga0209257_1019587
591 Ga0207682_10000865
592 Ga0207688_10054484
593 Ga0207688_10232493
594 Ga0207647_10453680
595 Ga0207645_10009884
596 Ga0207643_10295805
597 Ga0207707_11153683
598 Ga0207695_10000036
599 Ga0207695_10805122
600 Ga0207671_10000345
601 Ga0207662_10112405
602 Ga0207694_10022504
603 Ga0207650_10670362
604 Ga0207659_10142252
605 Ga0207704_10106101
606 Ga0207691_10013813
607 Ga0207711_10933922
608 Ga0207689_10081623
609 Ga0207679_10754186
610 Ga0207651_10785673
611 Ga0207712_10512784
612 Ga0207640_10087485
613 Ga0207703_10148458
614 Ga0207703_11147351
615 Ga0207641_10642201
616 Ga0207648_10874631
617 Ga0207676_11621330
618 Ga0207674_10089531
619 Ga0207675_100110609
620 Ga0207683_10011597
621 Ga0207698_10117201
622 Ga0209281_1000043
623 Ga0268266_10043982
624 Ga0268266_10153457
625 Ga0268266_10601324
626 Ga0307515_10065461
627 Ga0265340_10034055
628 Ga0307513_10057713
629 Ga0307513_10454161
630 Ga0307413_11047794
631 Ga0307406_10509589
632 Ga0307409_100154362
633 Ga0307414_10104688
634 Ga0373933_0041173
635 Ga0373937_0001807
636 Ga0395905_0042662
637 Ga0436365_0299198
638 Ga0436365_0710996
639 Ga0436365_1482009
640 Ga0436363_1413147
641 Ga0439465_0008375
642 Ga0451789_1196681
643 Ga0451841_0400048
644 Ga0451846_47508
645 Ga0451849_0793336
646 Ga0451851_0277716
647 Ga0451843_1086932
648 Ga0451855_0731588
649 Ga0451853_1328833
650 Ga0439432_032803
651 Ga0439462_0076567
652 Ga0439434_0026893
653 Ga0466972_0045730
654 Ga0466960_0091436
655 Ga0495603_0163678
656 Ga0495638_0216342
657 Ga0495651_0146476
658 Ga0495605_0055781
659 Ga0495605_0226224
660 Ga0495585_0025241
661 Ga0495585_0072610
662 Ga0495596_0113316
663 Ga0495583_0068024
664 Ga0495606_0019925
665 Ga0495606_0058907
666 Ga0495610_0043745
667 Ga0495620_0159260
668 Ga0495631_0071392
669 Ga0495632_0005489
670 Ga0495632_0029248
671 Ga0495632_0244117
672 Ga0495643_0030728
673 Ga0495643_0047476
674 Ga0495654_0000070
675 Ga0495654_0055745
676 Ga0495598_0111288
677 Ga0495609_0075528
678 Ga0495621_0006678
679 Ga0495597_0051969
680 Ga0495633_0018102
681 Ga0495633_0080011
682 Ga0495656_0091490
683 Ga0495668_0083248
684 Ga0495625_0022086
685 Ga0495625_0028059
686 Ga0495625_0369844
687 Ga0495661_0094088
688 Ga0495588_0072101
689 Ga0495588_0077429
690 Ga0495649_0058545
691 Ga0495649_0212082
692 Ga0495589_0040282
693 Ga0495660_0025061
694 Ga0495681_0126245
695 Ga0495681_0253632
696 Ga0495686_0004105
697 Ga0495686_0033107
698 Ga0495686_0069967
699 Ga0495615_0002577
700 Ga0496100_0068357
701 Ga0496102_0267271
702 Ga0496102_1721350
703 Ga0496103_0007919
704 Ga0496104_0732544
705 Ga0496106_0198769
706 Ga0496111_0000591
707 Ga0496113_0086755
708 Ga0496115_0169962
709 Ga0496116_0059110
710 Ga0496116_0108416
711 Ga0496117_0009511
712 Ga0496118_0010279
713 Ga0496118_0328081
714 Ga0496119_0010062
715 Ga0496120_0084434
716 Ga0496121_0005420
717 Ga0496121_0012847
718 Ga0496121_0061525
719 Ga0496121_0062716
720 Ga0496121_0150722
721 Ga0496122_0000018
722 Ga0496122_0023068
723 Ga0496122_0026620
724 Ga0496122_0052828
725 Ga0496122_0080950
726 Ga0496123_0000015
727 Ga0496123_0063414
728 Ga0496123_0079874
729 Ga0496123_0089702
730 Ga0496123_0194358
731 Ga0496124_0089588
732 Ga0496124_0100956
733 Ga0496124_0102984
734 Ga0496124_0126008
735 Ga0496124_0143764
736 Ga0496124_0144771
737 Ga0496124_0296883
738 Ga0496124_0475317
739 Ga0496125_0019735
740 Ga0496126_0225628
741 Ga0496126_0319936
742 Ga0501031_0264872
743 Ga0501034_0242302
744 Ga0501067_0419296
745 Ga0501068_0022311
746 Ga0501069_0083678
747 Ga0501073_0082883
748 Ga0501079_0719994
749 Ga0501080_0068329
750 Ga0501080_0190718
751 Ga0501035_0001208
752 Ga0501044_0283287
753 nmdc:mga03683_14719_c1
754 nmdc:mga03n38_9771_c1
755 nmdc:mga00v17_26_c1
756 nmdc:mga00v17_537085_c1
757 nmdc:mga00v17_81723_c1
758 nmdc:mga0yw44_35741_c1
759 nmdc:mga0k408_9627_c1
760 nmdc:mga04h51_37202_c1
761 nmdc:mga05p37_608417_c1
762 nmdc:mga08y16_114053_c1
763 Ga0500578_0162523
764 Ga0500566_0239433
765 Ga0500569_033932
766 Ga0500618_000096
767 Ga0500618_007203
768 Ga0500618_010087
769 Ga0500618_061128
770 Ga0500658_0000667
771 Ga0500616_0001686
772 Ga0500622_0038069
773 Ga0501082_0379769
774 2509444527
775 2510135726
776 2511174212
777 2513570888
778 2513574905
779 2513633681
780 2513707529
781 2513924354
782 2514024057
783 2515114895
784 2515635753
785 2515641366
786 2515741132
787 2517038510
788 2517078777
789 2517097529
790 2517408975
791 2520375886
792 2530648293
793 2585259590
794 2585330546
795 2585523891
796 2585533899
797 2585553557
798 2585843579
799 2585998472
800 2586003035
801 2599419687
802 2599718765
803 2600195299
804 2600376705
805 2616293900
806 2616309514
807 2643805814
808 2643812553
809 2644004211
810 2644065990
811 2644103766
812 2644144647
813 2644306696
814 2644330887
815 2644380294
816 2644417321
817 2644450717
818 2644541106
819 2644612307
820 2644671492
821 2644692858
822 2725947648
823 2766067102
824 2774872990
825 2793314162
826 2793327628
827 2793341096
828 2793358468
829 2819640911
830 2819685857
831 2821123270
832 2838026907
833 2838039780
834 2838664062
835 2838680069
836 2838689790
837 2838695900
838 2838709275
839 2838731514
840 2838739707
841 2838744455
842 2841844169
843 2841852995
844 2842079489
845 2842112689
846 2842120107
847 2842143890
848 2842160322
849 2842165700
850 2842184012
851 2842202376
852 2842219370
853 2842231594
854 2842238686
855 2842245937
856 2842260315
857 2842273726
858 2842286341
859 2842293150
860 2842308413
861 2842370531
862 2842379547
863 2842386618
864 2842397789
865 2842404106
866 2842410191
867 2842416839
868 2844164710
869 2844456538
870 2854900815
871 2854918843
872 2857520825
873 2857533778
874 2882461507
875 2919172438
876 2920822854
877 2933019108
878 2933574862
879 2933588422
880 2935896420
881 2935902375
882 2936369472
883 2936380164
884 2936388021
885 2941503998
886 2996897660
887 3005410684
888 639646126
889 8005305535
890 8005310305
891 8005377980
892 8005384038
893 8005399666
894 8005465591
895 8005543081
896 8005560036
897 8005692712
898 8005701401
899 8018132616
900 8018154630
901 8023681218
902 8024479748
903 8046769703
904 8056878713
905 8057582387
906 8057878640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

93

172

0.92

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

65

173

0.81

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

55

166

0.77

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

80

168

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9652 4 171
1j4j-assembly2.cif.gz_B crystal structure of tabtoxin resistance protein (form ii) complexed with an acyl coenzyme a 0.9487 4 171
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.8671 2 171
3bln-assembly1.cif.gz_A-2 crystal structure of acetyltransferase gnat family (np_981174.1) from bacillus cereus atcc 10987 at 1.31 a resolution 0.8638 1 170
4mbu-assembly1.cif.gz_A crystal structure of n-acetyltransferase from staphylococcus aureus mu50 0.8606 1 170
ID Description Score Start End Superfamily
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9417 4 171 3.40.630.30
af_Q54KJ9_7_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9337 17 171 3.40.630.30
1j4jA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9309 4 171 3.40.630.30
af_Q54KJ7_19_192_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9034 17 169 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8813 123 169 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A1M7ZGT3-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9897 3 171 GO:0005840
GO:0016747
AF-A0A4V2EA66-F1-model_v4 GNAT family N-acetyltransferase 0.9848 37 171 GO:0016747
AF-A0A2T1HT34-F1-model_v4 GNAT family N-acetyltransferase 0.9843 1 171 GO:0016747
AF-A0A4Q3S6A9-F1-model_v4 GNAT family N-acetyltransferase 0.983 2 171 GO:0016747
AF-A0A2G8MCS2-F1-model_v4 deleted 0.9828 2 171

Map