F447242

General Info

Members Datasets Scaffolds Average Seq Length
453 289 906 261

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0010405|Ga0466965_0010405_473_1276
Length 258
Sequence VTEHTPGQHPSLTYSSYLALDDVLSAQHPRSDEHDELLFIVIHQVYELWFKQMLHELAGLQERLEAGDTPRALHTLGRVLTILKVNVAQVDVLETMTPRQFTSFRGRLDASSGFQSAQFRELEASLGRRDARVFEHYPAGSEGRERIAAAMSRPSVFDSFLRYLVTQGYDVPRAALDRDLTVAWEPSPDVQRLLLAQVAERLVDLDEGLQEWRYRHVKMVERTIGAKPGTGGSSGATYLWSTVTRSLFPDLWAIRSEM

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
163 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
164 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
165 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
166 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
210 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
211 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
212 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
213 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
214 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
218 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
238 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2643221576 Nocardioides sp. Root614 Isolate Unclassified
280 2643221590 Nocardioides sp. Root682 Isolate Unclassified
281 2643221604 Nocardioides sp. Root190 Isolate Unclassified
282 2643221617 Nocardioides sp. Root79 Isolate Unclassified
283 2643221620 Nocardioides sp. Root240 Isolate Unclassified
284 2738541305 Nocardioides sp. CF167 Isolate Unclassified
285 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
286 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
287 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
288 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
289 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0.88
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 6.62
Rhizosphere 89.85
Stem 0
Stem Tuber 0.22
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0010405 3300044683 Bacteria 4337
2 JGI25406J46586_10029021 3300003203 Bacteria 2100
3 JGI25407J50210_10010772 3300003373 Bacteria 2331
4 JGI25407J50210_10012878 3300003373 Bacteria 2145
5 Ga0006562J51391_1155376 3300003578 Bacteria 1068
6 JGI25405J52794_10034220 3300003911 Bacteria 1062
7 Ga0065707_10126300 3300005295 Bacteria 2002
8 Ga0070658_10187647 3300005327 Bacteria 1742
9 Ga0070676_10131574 3300005328 Bacteria 1583
10 Ga0070676_10212505 3300005328 Bacteria 1274
11 Ga0070683_100114484 3300005329 Bacteria 2545
12 Ga0070690_100143458 3300005330 Bacteria 1622
13 Ga0070677_10040297 3300005333 Bacteria 1838
14 Ga0068869_100060946 3300005334 Bacteria 2766
15 Ga0070680_100379338 3300005336 Bacteria 1204
16 Ga0070660_100302070 3300005339 Bacteria 1312
17 Ga0070689_100070577 3300005340 Bacteria 2728
18 Ga0070687_100062999 3300005343 Bacteria 1965
19 Ga0070692_10026813 3300005345 Bacteria 2852
20 Ga0070675_100087604 3300005354 Bacteria 2603
21 Ga0070674_100079983 3300005356 Bacteria 2333
22 Ga0070673_100033760 3300005364 Bacteria 3866
23 Ga0070688_100209601 3300005365 Bacteria 1367
24 Ga0070688_100241295 3300005365 Bacteria 1283
25 Ga0070714_100000471 3300005435 Bacteria 29248
26 Ga0070714_100100651 3300005435 Bacteria 2546
27 Ga0070701_10044318 3300005438 Bacteria 2279
28 Ga0070711_100091769 3300005439 Bacteria 2190
29 Ga0070705_100008277 3300005440 Bacteria 5149
30 Ga0070708_100056511 3300005445 Bacteria 3491
31 Ga0070678_100032391 3300005456 Bacteria 3618
32 Ga0070678_100218411 3300005456 Bacteria 1583
33 Ga0070681_10120753 3300005458 Bacteria 2555
34 Ga0068867_100046685 3300005459 Bacteria 3182
35 Ga0070706_100195179 3300005467 Bacteria 1891
36 Ga0070706_100269908 3300005467 Bacteria 1588
37 Ga0070707_100032319 3300005468 Bacteria 4985
38 Ga0070699_100003866 3300005518 Bacteria 13238
39 Ga0070699_100005049 3300005518 Bacteria 11615
40 Ga0070679_100244166 3300005530 Bacteria 1753
41 Ga0070684_100102415 3300005535 Bacteria 2559
42 Ga0070697_100001773 3300005536 Bacteria 16475
43 Ga0070697_100324163 3300005536 Bacteria 1327
44 Ga0070697_100350930 3300005536 Bacteria 1274
45 Ga0068853_100047248 3300005539 Bacteria 3693
46 Ga0070686_100166550 3300005544 Bacteria 1555
47 Ga0070686_100283432 3300005544 Bacteria 1223
48 Ga0070695_100021791 3300005545 Bacteria 3926
49 Ga0070696_100000408 3300005546 Bacteria 26747
50 Ga0070693_100023979 3300005547 Bacteria 3267
51 Ga0068855_100147376 3300005563 Bacteria 2678
52 Ga0070664_100021893 3300005564 Bacteria 5270
53 Ga0068857_100015993 3300005577 Bacteria 6572
54 Ga0068857_100230687 3300005577 Bacteria 1693
55 Ga0068857_100396555 3300005577 Bacteria 1283
56 Ga0068854_100097175 3300005578 Bacteria 2201
57 Ga0068856_100656300 3300005614 Bacteria 1069
58 Ga0068852_100229670 3300005616 Bacteria 1768
59 Ga0068859_100114170 3300005617 Bacteria 2764
60 Ga0068864_100149658 3300005618 Bacteria 2113
61 Ga0068866_10223928 3300005718 Bacteria 1136
62 Ga0068851_10018669 3300005834 Bacteria 3344
63 Ga0068862_100117290 3300005844 Bacteria 2343
64 Ga0081455_10000018 3300005937 Bacteria 173683
65 Ga0081455_10007492 3300005937 Bacteria 11485
66 Ga0081455_10023427 3300005937 Bacteria 5745
67 Ga0081455_10040891 3300005937 Bacteria 4085
68 Ga0081455_10086534 3300005937 Bacteria 2553
69 Ga0081455_10172621 3300005937 Bacteria 1645
70 Ga0081538_10001704 3300005981 Bacteria 22405
71 Ga0081538_10002493 3300005981 Bacteria 17948
72 Ga0081538_10006247 3300005981 Bacteria 10538
73 Ga0081538_10024671 3300005981 Bacteria 4277
74 Ga0081538_10031441 3300005981 Bacteria 3580
75 Ga0081540_1002515 3300005983 Bacteria 14885
76 Ga0081539_10000218 3300005985 Bacteria 134538
77 Ga0081539_10071348 3300005985 Bacteria 1860
78 Ga0070717_10019444 3300006028 Bacteria 5325
79 Ga0070717_10214668 3300006028 Bacteria 1689
80 Ga0070715_10099522 3300006163 Bacteria 1353
81 Ga0070716_100068913 3300006173 Bacteria 2071
82 Ga0097621_100598443 3300006237 Bacteria 1007
83 Ga0075428_100013644 3300006844 Bacteria 9047
84 Ga0075428_100015545 3300006844 Bacteria 8437
85 Ga0075428_100025811 3300006844 Bacteria 6507
86 Ga0075428_100090414 3300006844 Bacteria 3339
87 Ga0075428_100218259 3300006844 Bacteria 2060
88 Ga0075430_100002294 3300006846 Bacteria 15857
89 Ga0075430_100002932 3300006846 Bacteria 14265
90 Ga0075430_100044937 3300006846 Bacteria 3733
91 Ga0075430_100058420 3300006846 Bacteria 3242
92 Ga0075430_100085029 3300006846 Bacteria 2649
93 Ga0075431_100006267 3300006847 Bacteria 11819
94 Ga0075431_100009773 3300006847 Bacteria 9633
95 Ga0075431_100020876 3300006847 Bacteria 6694
96 Ga0075431_100026385 3300006847 Bacteria 5961
97 Ga0075431_100456590 3300006847 Bacteria 1273
98 Ga0075431_100532552 3300006847 Bacteria 1163
99 Ga0075433_10006207 3300006852 Bacteria 9428
100 Ga0075434_100001827 3300006871 Bacteria 18379
101 Ga0075434_100028634 3300006871 Bacteria 5476
102 Ga0075429_100014715 3300006880 Bacteria 6782
103 Ga0075429_100014988 3300006880 Bacteria 6723
104 Ga0075429_100041398 3300006880 Bacteria 4012
105 Ga0075429_100139135 3300006880 Bacteria 2125
106 Ga0075429_100443137 3300006880 Bacteria 1138
107 Ga0075436_100132788 3300006914 Bacteria 1746
108 Ga0097620_100114167 3300006931 Bacteria 2764
109 Ga0075435_100302717 3300007076 Bacteria 1367
110 Ga0075435_100384565 3300007076 Bacteria 1206
111 Ga0099794_10006384 3300007265 Bacteria 4771
112 Ga0111539_10003303 3300009094 Bacteria 21316
113 Ga0111539_10151172 3300009094 Bacteria 2717
114 Ga0111539_10218036 3300009094 Bacteria 2222
115 Ga0114129_10006181 3300009147 Bacteria 16994
116 Ga0114129_10015602 3300009147 Bacteria 10802
117 Ga0114129_10184310 3300009147 Bacteria 2838
118 Ga0114129_10508744 3300009147 Bacteria 1572
119 Ga0114129_10734560 3300009147 Bacteria 1265
120 Ga0105241_10039925 3300009174 Bacteria 3541
121 Ga0105249_10075199 3300009553 Bacteria 3128
122 Ga0157336_1001849 3300012477 Bacteria 1141
123 Ga0157371_10173988 3300013102 Bacteria 1539
124 Ga0163162_10370042 3300013306 Bacteria 1566
125 Ga0157377_10098011 3300014745 Bacteria 1742
126 Ga0157376_10083557 3300014969 Bacteria 2747
127 Ga0157376_10154473 3300014969 Bacteria 2073
128 Ga0157376_10712697 3300014969 Bacteria 1010
129 Ga0206354_11686112 3300020081 Bacteria 990
130 Ga0206353_10403140 3300020082 Bacteria 1207
131 Ga0213872_10069111 3300021361 Bacteria 1593
132 Ga0213875_10091837 3300021388 Bacteria 1416
133 Ga0224712_10023080 3300022467 Bacteria 2155
134 Ga0207653_10019856 3300025885 Bacteria 2121
135 Ga0207653_10047427 3300025885 Bacteria 1423
136 Ga0207682_10023606 3300025893 Bacteria 2431
137 Ga0207692_10080215 3300025898 Bacteria 1743
138 Ga0207710_10201707 3300025900 Bacteria 983
139 Ga0207688_10056528 3300025901 Bacteria 2204
140 Ga0207680_10107316 3300025903 Bacteria 1805
141 Ga0207645_10141355 3300025907 Bacteria 1568
142 Ga0207643_10015641 3300025908 Bacteria 4131
143 Ga0207705_10140595 3300025909 Bacteria 1802
144 Ga0207684_10204522 3300025910 Bacteria 1703
145 Ga0207684_10281844 3300025910 Bacteria 1433
146 Ga0207684_10558316 3300025910 Bacteria 979
147 Ga0207707_10122653 3300025912 Bacteria 2272
148 Ga0207671_10050095 3300025914 Bacteria 3092
149 Ga0207663_10381231 3300025916 Bacteria 1074
150 Ga0207662_10002253 3300025918 Bacteria 9642
151 Ga0207657_10031593 3300025919 Bacteria 4795
152 Ga0207652_10163306 3300025921 Bacteria 1997
153 Ga0207646_10007726 3300025922 Bacteria 10885
154 Ga0207659_10121314 3300025926 Bacteria 2004
155 Ga0207700_10033001 3300025928 Bacteria 3700
156 Ga0207700_10222064 3300025928 Bacteria 1602
157 Ga0207664_10001641 3300025929 Bacteria 14739
158 Ga0207664_10044896 3300025929 Bacteria 3463
159 Ga0207664_10156379 3300025929 Bacteria 1941
160 Ga0207644_10294267 3300025931 Bacteria 1306
161 Ga0207706_10160518 3300025933 Bacteria 1976
162 Ga0207709_10118111 3300025935 Bacteria 1786
163 Ga0207670_10232976 3300025936 Bacteria 1415
164 Ga0207704_10127671 3300025938 Bacteria 1754
165 Ga0207665_10038608 3300025939 Bacteria 3180
166 Ga0207691_10016319 3300025940 Bacteria 7051
167 Ga0207689_10005794 3300025942 Bacteria 10965
168 Ga0207661_10099905 3300025944 Bacteria 2434
169 Ga0207667_10800638 3300025949 Bacteria 939
170 Ga0207651_10175808 3300025960 Bacteria 1693
171 Ga0207658_10200179 3300025986 Bacteria 1667
172 Ga0207678_10308397 3300026067 Bacteria 1361
173 Ga0207708_10072315 3300026075 Bacteria 2642
174 Ga0207641_10122187 3300026088 Bacteria 2325
175 Ga0207648_10061753 3300026089 Bacteria 3267
176 Ga0207648_10369832 3300026089 Bacteria 1295
177 Ga0207676_10393285 3300026095 Bacteria 1293
178 Ga0207674_10001077 3300026116 Bacteria 35473
179 Ga0207674_10255071 3300026116 Bacteria 1701
180 Ga0207675_100088845 3300026118 Bacteria 2903
181 Ga0207683_10003048 3300026121 Bacteria 14650
182 Ga0207683_10260943 3300026121 Bacteria 1582
183 Ga0207428_10023734 3300027907 Bacteria 5152
184 Ga0207428_10056167 3300027907 Bacteria 3128
185 Ga0207428_10166165 3300027907 Bacteria 1673
186 Ga0268265_10404443 3300028380 Bacteria 1263
187 Ga0268264_10842000 3300028381 Bacteria 918
188 Ga0307512_10007206 3300030522 Bacteria 11064
189 Ga0307405_10259255 3300031731 Bacteria 1298
190 Ga0307413_10000083 3300031824 Bacteria 23507
191 Ga0307416_100130711 3300032002 Bacteria 2259
192 Ga0373926_0002163 3300035083 Bacteria 6186
193 Ga0373934_0018004 3300035086 Bacteria 2701
194 Ga0373944_0011264 3300035089 Bacteria 2447
195 Ga0373944_0013868 3300035089 Bacteria 2242
196 Ga0373951_0014889 3300035091 Bacteria 1750
197 Ga0373952_0037505 3300035092 Bacteria 1106
198 Ga0373932_0055118 3300035112 Bacteria 1192
199 Ga0373936_0002120 3300035113 Bacteria 7373
200 Ga0373936_0014365 3300035113 Bacteria 3025
201 Ga0373945_0004914 3300035116 Bacteria 4259
202 Ga0373953_0016486 3300035117 Bacteria 2697
203 Ga0373954_0045768 3300035118 Bacteria 2044
204 Ga0373956_0065897 3300035119 Bacteria 1646
205 Ga0373957_0001759 3300035120 Bacteria 5969
206 Ga0373943_0002134 3300035170 Bacteria 8989
207 Ga0373943_0039937 3300035170 Bacteria 2263
208 Ga0373946_0003284 3300035171 Bacteria 5745
209 Ga0373946_0021119 3300035171 Bacteria 2521
210 Ga0373942_0012351 3300035207 Bacteria 2038
211 Ga0373961_0014032 3300035241 Bacteria 2030
212 Ga0373924_0074560 3300035410 Bacteria 1435
213 Ga0373931_0086182 3300035691 Bacteria 1742
214 Ga0373935_0057839 3300035692 Bacteria 2474
215 Ga0373935_0119990 3300035692 Bacteria 1755
216 Ga0373935_0160428 3300035692 Bacteria 1532
217 Ga0373927_0017318 3300035695 Bacteria 4744
218 Ga0373933_0042794 3300035724 Bacteria 2677
219 Ga0373947_0018036 3300035725 Bacteria 4061
220 Ga0373947_0094956 3300035725 Bacteria 1865
221 Ga0373937_0371171 3300036401 Bacteria 1356
222 Ga0373925_0015934 3300037068 Bacteria 5440
223 Ga0373925_0232500 3300037068 Bacteria 1474
224 Ga0395898_0107590 3300037466 Bacteria 2674
225 Ga0395905_0157433 3300037471 Bacteria 2136
226 Ga0436364_0982432 3300037853 Bacteria 4296
227 Ga0395901_0031521 3300038443 Bacteria 5467
228 Ga0395901_0267672 3300038443 Bacteria 1778
229 Ga0436365_0073494 3300039437 Bacteria 1694
230 Ga0436361_1210980 3300039447 Bacteria 3579
231 Ga0451853_1060161 3300041512 Bacteria 1059
232 Ga0439450_003499 3300042008 Bacteria 2601
233 Ga0439454_000420 3300042011 Bacteria 3342
234 Ga0439435_0042847 3300042436 Bacteria 1272
235 Ga0439464_0003949 3300042439 Bacteria 3774
236 Ga0439460_0073547 3300042461 Unclassified 1062
237 Ga0439460_0095706 3300042461 Bacteria 948
238 Ga0451577_0029572 3300042876 Bacteria 4953
239 Ga0439440_0005616 3300042993 Bacteria 2495
240 Ga0453683_0093097 3300044673 Bacteria 1890
241 Ga0466961_0013871 3300044693 Bacteria 5164
242 Ga0466963_0218959 3300044694 Bacteria 1333
243 Ga0466971_0026511 3300044719 Bacteria 2591
244 Ga0466968_0027508 3300044735 Bacteria 2341
245 Ga0466968_0130502 3300044735 Bacteria 1143
246 Ga0466970_0018729 3300044765 Bacteria 3587
247 Ga0466970_0050751 3300044765 Bacteria 2213
248 Ga0466957_0183787 3300044842 Bacteria 1366
249 Ga0466960_0030459 3300044901 Bacteria 2483
250 Ga0451576_0025348 3300045051 Bacteria 6389
251 Ga0466967_0086002 3300045976 Bacteria 2848
252 Ga0495592_0094952 3300046454 Bacteria 2134
253 Ga0495592_0262615 3300046454 Bacteria 1136
254 Ga0495603_0007795 3300046455 Bacteria 6453
255 Ga0495603_0144291 3300046455 Bacteria 1384
256 Ga0495641_0006280 3300046461 Bacteria 7734
257 Ga0495641_0047083 3300046461 Bacteria 1980
258 Ga0495651_0015616 3300046462 Bacteria 5877
259 Ga0495651_0296339 3300046462 Bacteria 1086
260 Ga0495653_0153786 3300046463 Bacteria 1605
261 Ga0495653_0192656 3300046463 Bacteria 1389
262 Ga0495580_0009693 3300046472 Bacteria 7556
263 Ga0495582_0005860 3300046473 Bacteria 6848
264 Ga0495582_0253003 3300046473 Bacteria 1010
265 Ga0495639_0041302 3300046475 Bacteria 2077
266 Ga0495639_0070110 3300046475 Bacteria 1618
267 Ga0495639_0161708 3300046475 Bacteria 1084
268 Ga0495662_0005165 3300046476 Bacteria 6545
269 Ga0495664_0016967 3300046477 Bacteria 4158
270 Ga0495664_0294150 3300046477 Bacteria 980
271 Ga0495594_0014135 3300046499 Bacteria 4180
272 Ga0495594_0015986 3300046499 Bacteria 3947
273 Ga0495594_0114884 3300046499 Bacteria 1519
274 Ga0495608_0016940 3300046511 Bacteria 5042
275 Ga0495608_0316452 3300046511 Bacteria 965
276 Ga0495618_0051682 3300046514 Bacteria 2596
277 Ga0495628_0066218 3300046516 Bacteria 2824
278 Ga0495630_0031525 3300046517 Bacteria 3947
279 Ga0495644_0016125 3300046523 Bacteria 2862
280 Ga0495652_0071771 3300046529 Bacteria 2888
281 Ga0495652_0262044 3300046529 Bacteria 1275
282 Ga0495652_0441818 3300046529 Bacteria 912
283 Ga0495665_0006544 3300046531 Bacteria 6292
284 Ga0495640_0040405 3300046533 Bacteria 3266
285 Ga0495640_0194417 3300046533 Bacteria 1288
286 Ga0495586_0206742 3300046535 Bacteria 1113
287 Ga0495587_0007829 3300046536 Bacteria 6903
288 Ga0495587_0014073 3300046536 Bacteria 5023
289 Ga0495645_0055501 3300046543 Bacteria 2876
290 Ga0495667_0027057 3300046559 Bacteria 3865
291 Ga0495667_0258583 3300046559 Bacteria 1107
292 Ga0495656_0033398 3300046615 Bacteria 2100
293 Ga0495634_0015524 3300046642 Bacteria 5468
294 Ga0495634_0110022 3300046642 Bacteria 1772
295 Ga0495635_0123387 3300046663 Bacteria 1766
296 Ga0495635_0236852 3300046663 Bacteria 1232
297 Ga0495635_0266149 3300046663 Bacteria 1153
298 Ga0495659_0000802 3300046664 Bacteria 11247
299 Ga0495588_0008188 3300046674 Bacteria 4785
300 Ga0495657_0221550 3300046675 Bacteria 1146
301 Ga0495599_0040974 3300046678 Bacteria 2908
302 Ga0495599_0294507 3300046678 Bacteria 980
303 Ga0495623_0006593 3300046679 Bacteria 7556
304 Ga0495646_0154188 3300046680 Bacteria 1275
305 Ga0495647_0005741 3300046681 Bacteria 4081
306 Ga0495647_0021778 3300046681 Bacteria 2311
307 Ga0495658_0084431 3300046683 Bacteria 1869
308 Ga0495613_0042020 3300046689 Bacteria 3383
309 Ga0495624_0018760 3300046690 Bacteria 4623
310 Ga0495624_0115439 3300046690 Bacteria 1650
311 Ga0495600_0100888 3300046809 Bacteria 1881
312 Ga0495581_0002766 3300047315 Bacteria 9993
313 Ga0495604_0153374 3300047317 Bacteria 1634
314 Ga0495604_0253945 3300047317 Bacteria 1197
315 Ga0495674_0071570 3300047319 Bacteria 2992
316 Ga0495676_0015912 3300047321 Bacteria 6684
317 Ga0495676_0077414 3300047321 Bacteria 2536
318 Ga0495676_0201064 3300047321 Bacteria 1384
319 Ga0495680_0026989 3300047322 Bacteria 4725
320 Ga0495680_0072660 3300047322 Bacteria 2616
321 Ga0495675_0023760 3300047444 Bacteria 3906
322 Ga0495684_0065705 3300047471 Bacteria 2758
323 Ga0495684_0144059 3300047471 Bacteria 1785
324 Ga0495684_0176940 3300047471 Bacteria 1583
325 Ga0495593_0008327 3300047673 Bacteria 6034
326 Ga0496101_0080398 3300048904 Bacteria 2408
327 Ga0496102_0070810 3300048905 Bacteria 3202
328 Ga0496102_0079691 3300048905 Bacteria 3016
329 Ga0496103_0057274 3300048906 Bacteria 2419
330 Ga0496103_0169410 3300048906 Bacteria 1402
331 Ga0496104_0025847 3300048907 Bacteria 5415
332 Ga0496104_0026258 3300048907 Bacteria 5375
333 Ga0496104_0387618 3300048907 Bacteria 1309
334 Ga0496104_0624372 3300048907 Bacteria 987
335 Ga0496105_0012648 3300048908 Bacteria 6685
336 Ga0496105_0032000 3300048908 Bacteria 4314
337 Ga0496106_0419429 3300048909 Bacteria 1075
338 Ga0496107_0123169 3300048910 Bacteria 1910
339 Ga0496108_0004281 3300048911 Bacteria 11491
340 Ga0496108_0004534 3300048911 Bacteria 11185
341 Ga0496108_0686398 3300048911 Bacteria 888
342 Ga0496109_0008669 3300048912 Bacteria 8654
343 Ga0496109_0014596 3300048912 Bacteria 6834
344 Ga0496109_0094549 3300048912 Bacteria 2766
345 Ga0496110_0009054 3300048913 Bacteria 8033
346 Ga0496110_0065809 3300048913 Bacteria 3204
347 Ga0496110_0129991 3300048913 Bacteria 2273
348 Ga0496111_0001506 3300048914 Bacteria 13351
349 Ga0496111_0004144 3300048914 Bacteria 9111
350 Ga0496111_0076755 3300048914 Bacteria 2435
351 Ga0496113_0008592 3300048916 Bacteria 6661
352 Ga0496113_0156945 3300048916 Bacteria 1797
353 Ga0496113_0184445 3300048916 Bacteria 1654
354 Ga0496114_0135899 3300048917 Bacteria 2126
355 Ga0496115_0072600 3300048918 Bacteria 2792
356 Ga0501031_0039323 3300049568 Bacteria 3086
357 Ga0501031_0110103 3300049568 Bacteria 1798
358 Ga0501033_0039835 3300049570 Bacteria 3509
359 Ga0501036_0143282 3300049572 Bacteria 2016
360 Ga0501036_0475048 3300049572 Bacteria 1041
361 Ga0501038_0065190 3300049574 Bacteria 3104
362 Ga0501038_0196776 3300049574 Bacteria 1620
363 Ga0501038_0200168 3300049574 Bacteria 1603
364 Ga0501039_0036277 3300049575 Bacteria 3804
365 Ga0501040_0045418 3300049576 Bacteria 2996
366 Ga0501040_0301977 3300049576 Bacteria 1144
367 Ga0501041_0019768 3300049577 Bacteria 4023
368 Ga0501042_0004057 3300049578 Bacteria 9287
369 Ga0501043_0164307 3300049579 Bacteria 1733
370 Ga0501046_0142958 3300049580 Bacteria 1809
371 Ga0501048_0129147 3300049582 Bacteria 1787
372 Ga0501068_0012953 3300049584 Bacteria 4739
373 Ga0501068_0118759 3300049584 Bacteria 1648
374 Ga0501071_0024749 3300049587 Bacteria 4199
375 Ga0501071_0026314 3300049587 Bacteria 4083
376 Ga0501072_0021738 3300049588 Bacteria 4975
377 Ga0501072_0089329 3300049588 Bacteria 2445
378 Ga0501074_0053499 3300049590 Bacteria 2912
379 Ga0501075_0010646 3300049591 Bacteria 6471
380 Ga0501075_0061374 3300049591 Bacteria 2833
381 Ga0501075_0198882 3300049591 Bacteria 1528
382 Ga0501076_0036451 3300049592 Bacteria 3853
383 Ga0501076_0045500 3300049592 Bacteria 3465
384 Ga0501076_0266648 3300049592 Bacteria 1402
385 Ga0501077_0015131 3300049593 Bacteria 4851
386 Ga0501077_0028845 3300049593 Bacteria 3527
387 Ga0501077_0105373 3300049593 Bacteria 1787
388 Ga0501079_0068958 3300049741 Bacteria 2729
389 Ga0501079_0282949 3300049741 Bacteria 1297
390 Ga0501080_0061405 3300049742 Bacteria 3499
391 Ga0501080_0229041 3300049742 Bacteria 1699
392 Ga0501081_0030296 3300049743 Bacteria 3662
393 Ga0501081_0102830 3300049743 Bacteria 2021
394 Ga0501081_0153551 3300049743 Bacteria 1655
395 Ga0501083_0166215 3300049744 Bacteria 1442
396 Ga0501035_0190006 3300049822 Bacteria 1766
397 Ga0501045_0017549 3300049824 Bacteria 5082
398 Ga0501045_0045038 3300049824 Bacteria 3212
399 Ga0501045_0174694 3300049824 Bacteria 1600
400 nmdc:mga05p37_405481_c1 3300050507 Bacteria 1591
401 nmdc:mga05p37_450734_c1 3300050507 Bacteria 1489
402 nmdc:mga05p37_503680_c1 3300050507 Bacteria 1389
403 nmdc:mga05p37_7631_c1 3300050507 Bacteria 12766
404 nmdc:mga09592_230048_c1 3300050508 Bacteria 1606
405 nmdc:mga09592_4383_c1 3300050508 Bacteria 11414
406 nmdc:mga09592_48467_c1 3300050508 Bacteria 3581
407 nmdc:mga09592_50154_c1 3300050508 Bacteria 3521
408 nmdc:mga09592_94406_c1 3300050508 Bacteria 2558
409 nmdc:mga0qj67_11993_c1 3300050509 Bacteria 6512
410 nmdc:mga0qj67_164823_c1 3300050509 Bacteria 1799
411 nmdc:mga0qj67_1848_c1 3300050509 Bacteria 14996
412 nmdc:mga0qj67_203358_c1 3300050509 Bacteria 1609
413 nmdc:mga0qj67_82373_c1 3300050509 Bacteria 2580
414 nmdc:mga06r32_19061_c1 3300050510 Bacteria 6292
415 nmdc:mga06r32_214275_c1 3300050510 Bacteria 1133
416 nmdc:mga06r32_232953_c1 3300050510 Bacteria 1830
417 nmdc:mga06r32_371070_c1 3300050510 Bacteria 1414
418 nmdc:mga06r32_5470_c1 3300050510 Bacteria 11437
419 nmdc:mga06r32_84374_c1 3300050510 Bacteria 3096
420 nmdc:mga08y16_31740_c1 3300050511 Bacteria 5554
421 nmdc:mga08y16_67074_c1 3300050511 Bacteria 3744
422 nmdc:mga0n895_200058_c1 3300050512 Bacteria 2029
423 nmdc:mga0n895_6121_c1 3300050512 Bacteria 10161
424 nmdc:mga0rr50_253581_c1 3300050513 Bacteria 1462
425 nmdc:mga0rr50_287766_c1 3300050513 Bacteria 1372
426 nmdc:mga0a205_107201_c1 3300050515 Bacteria 2692
427 nmdc:mga0a205_303983_c1 3300050515 Bacteria 1468
428 nmdc:mga0a205_652636_c1 3300050515 Bacteria 903
429 Ga0495601_0115749 3300053077 Bacteria 1738
430 Ga0495612_0006201 3300053078 Bacteria 4921
431 Ga0495595_0038052 3300053084 Bacteria 2190
432 Ga0495595_0196892 3300053084 Bacteria 1002
433 Ga0495619_0031631 3300053085 Bacteria 3429
434 Ga0500559_0015005 3300053136 Bacteria 3275
435 Ga0500577_0010319 3300053142 Bacteria 2746
436 Ga0501084_0014588 3300054114 Bacteria 6514
437 Ga0501084_0062921 3300054114 Bacteria 3106
438 Ga0501082_0028660 3300060353 Bacteria 4796
439 Ga0501082_0029931 3300060353 Bacteria 4691
440 Ga0501082_0192853 3300060353 Bacteria 1772
441 Ga0530510_0033674 3300061734 Bacteria 3687
442 Ga0530510_0124173 3300061734 Bacteria 1896
443 2643893092 2643221576 Bacteria 5214352
444 2643961849 2643221590 Bacteria 5214697
445 2644034159 2643221604 Bacteria 5014917
446 2644102467 2643221617 Bacteria 5139111
447 2644118130 2643221620 Bacteria 5134593
448 2738871375 2738541305 Bacteria 4910150
449 2791915823 2791354901 Bacteria 8322202
450 2795793238 2795385472 Bacteria 6627535
451 2873318407 2873314349 Bacteria 8512634
452 2895427877 2895427314 Bacteria 13147766
453 2899371250 2899370129 Bacteria 6781179
454 Ga0466965_0010405
455 JGI25406J46586_10029021
456 JGI25407J50210_10010772
457 JGI25407J50210_10012878
458 Ga0006562J51391_1155376
459 JGI25405J52794_10034220
460 Ga0065707_10126300
461 Ga0070658_10187647
462 Ga0070676_10131574
463 Ga0070676_10212505
464 Ga0070683_100114484
465 Ga0070690_100143458
466 Ga0070677_10040297
467 Ga0068869_100060946
468 Ga0070680_100379338
469 Ga0070660_100302070
470 Ga0070689_100070577
471 Ga0070687_100062999
472 Ga0070692_10026813
473 Ga0070675_100087604
474 Ga0070674_100079983
475 Ga0070673_100033760
476 Ga0070688_100209601
477 Ga0070688_100241295
478 Ga0070714_100000471
479 Ga0070714_100100651
480 Ga0070701_10044318
481 Ga0070711_100091769
482 Ga0070705_100008277
483 Ga0070708_100056511
484 Ga0070678_100032391
485 Ga0070678_100218411
486 Ga0070681_10120753
487 Ga0068867_100046685
488 Ga0070706_100195179
489 Ga0070706_100269908
490 Ga0070707_100032319
491 Ga0070699_100003866
492 Ga0070699_100005049
493 Ga0070679_100244166
494 Ga0070684_100102415
495 Ga0070697_100001773
496 Ga0070697_100324163
497 Ga0070697_100350930
498 Ga0068853_100047248
499 Ga0070686_100166550
500 Ga0070686_100283432
501 Ga0070695_100021791
502 Ga0070696_100000408
503 Ga0070693_100023979
504 Ga0068855_100147376
505 Ga0070664_100021893
506 Ga0068857_100015993
507 Ga0068857_100230687
508 Ga0068857_100396555
509 Ga0068854_100097175
510 Ga0068856_100656300
511 Ga0068852_100229670
512 Ga0068859_100114170
513 Ga0068864_100149658
514 Ga0068866_10223928
515 Ga0068851_10018669
516 Ga0068862_100117290
517 Ga0081455_10000018
518 Ga0081455_10007492
519 Ga0081455_10023427
520 Ga0081455_10040891
521 Ga0081455_10086534
522 Ga0081455_10172621
523 Ga0081538_10001704
524 Ga0081538_10002493
525 Ga0081538_10006247
526 Ga0081538_10024671
527 Ga0081538_10031441
528 Ga0081540_1002515
529 Ga0081539_10000218
530 Ga0081539_10071348
531 Ga0070717_10019444
532 Ga0070717_10214668
533 Ga0070715_10099522
534 Ga0070716_100068913
535 Ga0097621_100598443
536 Ga0075428_100013644
537 Ga0075428_100015545
538 Ga0075428_100025811
539 Ga0075428_100090414
540 Ga0075428_100218259
541 Ga0075430_100002294
542 Ga0075430_100002932
543 Ga0075430_100044937
544 Ga0075430_100058420
545 Ga0075430_100085029
546 Ga0075431_100006267
547 Ga0075431_100009773
548 Ga0075431_100020876
549 Ga0075431_100026385
550 Ga0075431_100456590
551 Ga0075431_100532552
552 Ga0075433_10006207
553 Ga0075434_100001827
554 Ga0075434_100028634
555 Ga0075429_100014715
556 Ga0075429_100014988
557 Ga0075429_100041398
558 Ga0075429_100139135
559 Ga0075429_100443137
560 Ga0075436_100132788
561 Ga0097620_100114167
562 Ga0075435_100302717
563 Ga0075435_100384565
564 Ga0099794_10006384
565 Ga0111539_10003303
566 Ga0111539_10151172
567 Ga0111539_10218036
568 Ga0114129_10006181
569 Ga0114129_10015602
570 Ga0114129_10184310
571 Ga0114129_10508744
572 Ga0114129_10734560
573 Ga0105241_10039925
574 Ga0105249_10075199
575 Ga0157336_1001849
576 Ga0157371_10173988
577 Ga0163162_10370042
578 Ga0157377_10098011
579 Ga0157376_10083557
580 Ga0157376_10154473
581 Ga0157376_10712697
582 Ga0206354_11686112
583 Ga0206353_10403140
584 Ga0213872_10069111
585 Ga0213875_10091837
586 Ga0224712_10023080
587 Ga0207653_10019856
588 Ga0207653_10047427
589 Ga0207682_10023606
590 Ga0207692_10080215
591 Ga0207710_10201707
592 Ga0207688_10056528
593 Ga0207680_10107316
594 Ga0207645_10141355
595 Ga0207643_10015641
596 Ga0207705_10140595
597 Ga0207684_10204522
598 Ga0207684_10281844
599 Ga0207684_10558316
600 Ga0207707_10122653
601 Ga0207671_10050095
602 Ga0207663_10381231
603 Ga0207662_10002253
604 Ga0207657_10031593
605 Ga0207652_10163306
606 Ga0207646_10007726
607 Ga0207659_10121314
608 Ga0207700_10033001
609 Ga0207700_10222064
610 Ga0207664_10001641
611 Ga0207664_10044896
612 Ga0207664_10156379
613 Ga0207644_10294267
614 Ga0207706_10160518
615 Ga0207709_10118111
616 Ga0207670_10232976
617 Ga0207704_10127671
618 Ga0207665_10038608
619 Ga0207691_10016319
620 Ga0207689_10005794
621 Ga0207661_10099905
622 Ga0207667_10800638
623 Ga0207651_10175808
624 Ga0207658_10200179
625 Ga0207678_10308397
626 Ga0207708_10072315
627 Ga0207641_10122187
628 Ga0207648_10061753
629 Ga0207648_10369832
630 Ga0207676_10393285
631 Ga0207674_10001077
632 Ga0207674_10255071
633 Ga0207675_100088845
634 Ga0207683_10003048
635 Ga0207683_10260943
636 Ga0207428_10023734
637 Ga0207428_10056167
638 Ga0207428_10166165
639 Ga0268265_10404443
640 Ga0268264_10842000
641 Ga0307512_10007206
642 Ga0307405_10259255
643 Ga0307413_10000083
644 Ga0307416_100130711
645 Ga0373926_0002163
646 Ga0373934_0018004
647 Ga0373944_0011264
648 Ga0373944_0013868
649 Ga0373951_0014889
650 Ga0373952_0037505
651 Ga0373932_0055118
652 Ga0373936_0002120
653 Ga0373936_0014365
654 Ga0373945_0004914
655 Ga0373953_0016486
656 Ga0373954_0045768
657 Ga0373956_0065897
658 Ga0373957_0001759
659 Ga0373943_0002134
660 Ga0373943_0039937
661 Ga0373946_0003284
662 Ga0373946_0021119
663 Ga0373942_0012351
664 Ga0373961_0014032
665 Ga0373924_0074560
666 Ga0373931_0086182
667 Ga0373935_0057839
668 Ga0373935_0119990
669 Ga0373935_0160428
670 Ga0373927_0017318
671 Ga0373933_0042794
672 Ga0373947_0018036
673 Ga0373947_0094956
674 Ga0373937_0371171
675 Ga0373925_0015934
676 Ga0373925_0232500
677 Ga0395898_0107590
678 Ga0395905_0157433
679 Ga0436364_0982432
680 Ga0395901_0031521
681 Ga0395901_0267672
682 Ga0436365_0073494
683 Ga0436361_1210980
684 Ga0451853_1060161
685 Ga0439450_003499
686 Ga0439454_000420
687 Ga0439435_0042847
688 Ga0439464_0003949
689 Ga0439460_0073547
690 Ga0439460_0095706
691 Ga0451577_0029572
692 Ga0439440_0005616
693 Ga0453683_0093097
694 Ga0466961_0013871
695 Ga0466963_0218959
696 Ga0466971_0026511
697 Ga0466968_0027508
698 Ga0466968_0130502
699 Ga0466970_0018729
700 Ga0466970_0050751
701 Ga0466957_0183787
702 Ga0466960_0030459
703 Ga0451576_0025348
704 Ga0466967_0086002
705 Ga0495592_0094952
706 Ga0495592_0262615
707 Ga0495603_0007795
708 Ga0495603_0144291
709 Ga0495641_0006280
710 Ga0495641_0047083
711 Ga0495651_0015616
712 Ga0495651_0296339
713 Ga0495653_0153786
714 Ga0495653_0192656
715 Ga0495580_0009693
716 Ga0495582_0005860
717 Ga0495582_0253003
718 Ga0495639_0041302
719 Ga0495639_0070110
720 Ga0495639_0161708
721 Ga0495662_0005165
722 Ga0495664_0016967
723 Ga0495664_0294150
724 Ga0495594_0014135
725 Ga0495594_0015986
726 Ga0495594_0114884
727 Ga0495608_0016940
728 Ga0495608_0316452
729 Ga0495618_0051682
730 Ga0495628_0066218
731 Ga0495630_0031525
732 Ga0495644_0016125
733 Ga0495652_0071771
734 Ga0495652_0262044
735 Ga0495652_0441818
736 Ga0495665_0006544
737 Ga0495640_0040405
738 Ga0495640_0194417
739 Ga0495586_0206742
740 Ga0495587_0007829
741 Ga0495587_0014073
742 Ga0495645_0055501
743 Ga0495667_0027057
744 Ga0495667_0258583
745 Ga0495656_0033398
746 Ga0495634_0015524
747 Ga0495634_0110022
748 Ga0495635_0123387
749 Ga0495635_0236852
750 Ga0495635_0266149
751 Ga0495659_0000802
752 Ga0495588_0008188
753 Ga0495657_0221550
754 Ga0495599_0040974
755 Ga0495599_0294507
756 Ga0495623_0006593
757 Ga0495646_0154188
758 Ga0495647_0005741
759 Ga0495647_0021778
760 Ga0495658_0084431
761 Ga0495613_0042020
762 Ga0495624_0018760
763 Ga0495624_0115439
764 Ga0495600_0100888
765 Ga0495581_0002766
766 Ga0495604_0153374
767 Ga0495604_0253945
768 Ga0495674_0071570
769 Ga0495676_0015912
770 Ga0495676_0077414
771 Ga0495676_0201064
772 Ga0495680_0026989
773 Ga0495680_0072660
774 Ga0495675_0023760
775 Ga0495684_0065705
776 Ga0495684_0144059
777 Ga0495684_0176940
778 Ga0495593_0008327
779 Ga0496101_0080398
780 Ga0496102_0070810
781 Ga0496102_0079691
782 Ga0496103_0057274
783 Ga0496103_0169410
784 Ga0496104_0025847
785 Ga0496104_0026258
786 Ga0496104_0387618
787 Ga0496104_0624372
788 Ga0496105_0012648
789 Ga0496105_0032000
790 Ga0496106_0419429
791 Ga0496107_0123169
792 Ga0496108_0004281
793 Ga0496108_0004534
794 Ga0496108_0686398
795 Ga0496109_0008669
796 Ga0496109_0014596
797 Ga0496109_0094549
798 Ga0496110_0009054
799 Ga0496110_0065809
800 Ga0496110_0129991
801 Ga0496111_0001506
802 Ga0496111_0004144
803 Ga0496111_0076755
804 Ga0496113_0008592
805 Ga0496113_0156945
806 Ga0496113_0184445
807 Ga0496114_0135899
808 Ga0496115_0072600
809 Ga0501031_0039323
810 Ga0501031_0110103
811 Ga0501033_0039835
812 Ga0501036_0143282
813 Ga0501036_0475048
814 Ga0501038_0065190
815 Ga0501038_0196776
816 Ga0501038_0200168
817 Ga0501039_0036277
818 Ga0501040_0045418
819 Ga0501040_0301977
820 Ga0501041_0019768
821 Ga0501042_0004057
822 Ga0501043_0164307
823 Ga0501046_0142958
824 Ga0501048_0129147
825 Ga0501068_0012953
826 Ga0501068_0118759
827 Ga0501071_0024749
828 Ga0501071_0026314
829 Ga0501072_0021738
830 Ga0501072_0089329
831 Ga0501074_0053499
832 Ga0501075_0010646
833 Ga0501075_0061374
834 Ga0501075_0198882
835 Ga0501076_0036451
836 Ga0501076_0045500
837 Ga0501076_0266648
838 Ga0501077_0015131
839 Ga0501077_0028845
840 Ga0501077_0105373
841 Ga0501079_0068958
842 Ga0501079_0282949
843 Ga0501080_0061405
844 Ga0501080_0229041
845 Ga0501081_0030296
846 Ga0501081_0102830
847 Ga0501081_0153551
848 Ga0501083_0166215
849 Ga0501035_0190006
850 Ga0501045_0017549
851 Ga0501045_0045038
852 Ga0501045_0174694
853 nmdc:mga05p37_405481_c1
854 nmdc:mga05p37_450734_c1
855 nmdc:mga05p37_503680_c1
856 nmdc:mga05p37_7631_c1
857 nmdc:mga09592_230048_c1
858 nmdc:mga09592_4383_c1
859 nmdc:mga09592_48467_c1
860 nmdc:mga09592_50154_c1
861 nmdc:mga09592_94406_c1
862 nmdc:mga0qj67_11993_c1
863 nmdc:mga0qj67_164823_c1
864 nmdc:mga0qj67_1848_c1
865 nmdc:mga0qj67_203358_c1
866 nmdc:mga0qj67_82373_c1
867 nmdc:mga06r32_19061_c1
868 nmdc:mga06r32_214275_c1
869 nmdc:mga06r32_232953_c1
870 nmdc:mga06r32_371070_c1
871 nmdc:mga06r32_5470_c1
872 nmdc:mga06r32_84374_c1
873 nmdc:mga08y16_31740_c1
874 nmdc:mga08y16_67074_c1
875 nmdc:mga0n895_200058_c1
876 nmdc:mga0n895_6121_c1
877 nmdc:mga0rr50_253581_c1
878 nmdc:mga0rr50_287766_c1
879 nmdc:mga0a205_107201_c1
880 nmdc:mga0a205_303983_c1
881 nmdc:mga0a205_652636_c1
882 Ga0495601_0115749
883 Ga0495612_0006201
884 Ga0495595_0038052
885 Ga0495595_0196892
886 Ga0495619_0031631
887 Ga0500559_0015005
888 Ga0500577_0010319
889 Ga0501084_0014588
890 Ga0501084_0062921
891 Ga0501082_0028660
892 Ga0501082_0029931
893 Ga0501082_0192853
894 Ga0530510_0033674
895 Ga0530510_0124173
896 2643893092
897 2643961849
898 2644034159
899 2644102467
900 2644118130
901 2738871375
902 2791915823
903 2795793238
904 2873318407
905 2895427877
906 2899371250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

2

147

0.94

PF03301

Trp_dioxygenase

Tryptophan 2,3-dioxygenase

187

258

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bk9-assembly2.cif.gz_G h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris 0.9102 13 268
2nox-assembly3.cif.gz_I crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.909 13 268
2nox-assembly2.cif.gz_G crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.9065 13 268
2nox-assembly4.cif.gz_O crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.9038 12 268
2nox-assembly4.cif.gz_M crystal structure of tryptophan 2,3-dioxygenase from ralstonia metallidurans 0.9025 13 268
ID Description Score Start End Superfamily
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9095 14 268 1.20.58.480
2noxJ00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.896 14 268 1.20.58.480
1yw0A00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8901 14 266 1.20.58.480
3bk9C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8824 1 268 1.20.58.480
3bk9C00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8793 1 268 1.20.58.480
ID Description Score Start End GO Terms
AF-A0A1G6TXT4-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9505 47 268 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A388P2M3-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9503 39 268 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A388P2M3-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9423 39 268 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A1G6TXT4-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9422 47 268 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872
AF-A0A3N5FYD6-F1-model_v4 Tryptophan 2,3-dioxygenase 0.9386 13 232 GO:0004833
GO:0019441
GO:0019442
GO:0020037
GO:0046872

Map