F447215

General Info

Members Datasets Scaffolds Average Seq Length
453 221 906 432

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100031984|Ga0307408_1000319843
Length 438
Sequence MAYEPVLTNHVREPNAFTLDFYLQKARGYEGLRKALTLKPNDIIEQVKASGLRGRGGAGFPTGLKWQFVLKDTPKPKYIACNADESEPGTFKDHVLMERNPHLLIEGCAIGCYAIGAKVAYIYIRGEFLHVQETLERAVAEAYRAGHLGKNIYGSGFDCDVFIHRGAGAYEAGEETALIESLEGKRAQPRLKPPFPAVEGVYNCPTAVNNVETLCNVPLIVLNGPEWFAGLGPEKNGGPKLFCISGHVKRPGTYEASMHTTLRDLVFGDQYAQGMKDGRAFKAIIPGGSSVPILLEKDLDTPASFDHIQKAGSLLGSAGLIVMDDTVCMVWLAMNLLHFYRHESCGKCTPCREGGDWLYKLLQRVERGEGQMKDIDLLFGVATNIVGKTLCAFGDAAATPVLTTLNHFRNEFEAHIHEGRCTLPAQWRAKGPMLAGAH

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
138 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
218 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
219 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.31
Rhizosphere 96.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100031984 3300031548 Bacteria 3667
2 JGI24751J29686_10002884 3300002459 Bacteria 3466
3 Ga0065704_10124895 3300005289 Bacteria 1711
4 Ga0065712_10000240 3300005290 Bacteria 24235
5 Ga0065715_10000461 3300005293 Bacteria 26573
6 Ga0065707_10143191 3300005295 Bacteria 1746
7 Ga0070690_100005931 3300005330 Bacteria 6897
8 Ga0070690_100018642 3300005330 Bacteria 4195
9 Ga0070670_100001520 3300005331 Bacteria 18661
10 Ga0070670_100004554 3300005331 Bacteria 11624
11 Ga0070670_100093026 3300005331 Bacteria 2593
12 Ga0070666_10031807 3300005335 Bacteria 3485
13 Ga0070666_10063323 3300005335 Bacteria 2506
14 Ga0068868_100013464 3300005338 Bacteria 5997
15 Ga0070660_100002101 3300005339 Bacteria 13741
16 Ga0070689_100014041 3300005340 Bacteria 5812
17 Ga0070689_100022262 3300005340 Bacteria 4731
18 Ga0070691_10019456 3300005341 Bacteria 3133
19 Ga0070687_100049493 3300005343 Bacteria 2166
20 Ga0070692_10002464 3300005345 Bacteria 7196
21 Ga0070692_10048392 3300005345 Bacteria 2203
22 Ga0070668_100039690 3300005347 Bacteria 3600
23 Ga0070669_100000356 3300005353 Bacteria 35464
24 Ga0070669_100096113 3300005353 Bacteria 2229
25 Ga0070675_100000126 3300005354 Bacteria 45585
26 Ga0070675_100003326 3300005354 Bacteria 12193
27 Ga0070675_100007860 3300005354 Bacteria 8265
28 Ga0070675_100070303 3300005354 Bacteria 2901
29 Ga0070671_100001545 3300005355 Bacteria 17310
30 Ga0070671_100039661 3300005355 Bacteria 3909
31 Ga0070674_100007238 3300005356 Bacteria 6534
32 Ga0070673_100084508 3300005364 Bacteria 2581
33 Ga0070673_100091465 3300005364 Bacteria 2488
34 Ga0070688_100020144 3300005365 Bacteria 3874
35 Ga0070688_100020709 3300005365 Bacteria 3829
36 Ga0070688_100042989 3300005365 Bacteria 2782
37 Ga0070659_100027011 3300005366 Bacteria 4420
38 Ga0070709_10014751 3300005434 Bacteria 4427
39 Ga0070714_100050533 3300005435 Bacteria 3542
40 Ga0070701_10013890 3300005438 Bacteria 3676
41 Ga0070705_100000680 3300005440 Bacteria 19483
42 Ga0070705_100037348 3300005440 Bacteria 2739
43 Ga0070705_100085284 3300005440 Bacteria 1952
44 Ga0070700_100088286 3300005441 Bacteria 2018
45 Ga0070694_100006774 3300005444 Bacteria 6960
46 Ga0070694_100171221 3300005444 Bacteria 1600
47 Ga0070708_100031961 3300005445 Bacteria 4561
48 Ga0070678_100015885 3300005456 Bacteria 4798
49 Ga0070678_100101719 3300005456 Bacteria 2228
50 Ga0070681_10007600 3300005458 Bacteria 10595
51 Ga0068867_100068397 3300005459 Bacteria 2650
52 Ga0068867_100072160 3300005459 Bacteria 2584
53 Ga0068867_100075709 3300005459 Bacteria 2525
54 Ga0068867_100144840 3300005459 Bacteria 1861
55 Ga0070685_10003607 3300005466 Bacteria 7854
56 Ga0070707_100043580 3300005468 Bacteria 4294
57 Ga0070698_100005030 3300005471 Bacteria 14481
58 Ga0070698_100009236 3300005471 Bacteria 10578
59 Ga0070698_100081158 3300005471 Bacteria 3238
60 Ga0070699_100001266 3300005518 Bacteria 23295
61 Ga0070699_100003933 3300005518 Bacteria 13128
62 Ga0070699_100009305 3300005518 Bacteria 8508
63 Ga0070679_100017657 3300005530 Bacteria 6907
64 Ga0070679_100135302 3300005530 Bacteria 2446
65 Ga0070679_100147983 3300005530 Bacteria 2326
66 Ga0070684_100053249 3300005535 Bacteria 3522
67 Ga0070672_100027002 3300005543 Bacteria 4279
68 Ga0070672_100130710 3300005543 Bacteria 2063
69 Ga0070672_100201646 3300005543 Bacteria 1664
70 Ga0070686_100010301 3300005544 Bacteria 5267
71 Ga0070686_100020483 3300005544 Bacteria 3913
72 Ga0070695_100000031 3300005545 Bacteria 53175
73 Ga0070695_100152420 3300005545 Bacteria 1614
74 Ga0070665_100014862 3300005548 Bacteria 7814
75 Ga0070665_100123568 3300005548 Bacteria 2590
76 Ga0070704_100003975 3300005549 Bacteria 8524
77 Ga0070704_100030216 3300005549 Bacteria 3628
78 Ga0070704_100052329 3300005549 Bacteria 2880
79 Ga0070704_100052703 3300005549 Bacteria 2872
80 Ga0070704_100068951 3300005549 Bacteria 2560
81 Ga0070704_100155726 3300005549 Bacteria 1802
82 Ga0070704_100195046 3300005549 Bacteria 1631
83 Ga0068855_100040964 3300005563 Bacteria 5492
84 Ga0070664_100140454 3300005564 Bacteria 2127
85 Ga0068854_100016855 3300005578 Bacteria 4878
86 Ga0070702_100042824 3300005615 Bacteria 2548
87 Ga0068859_100002556 3300005617 Bacteria 18468
88 Ga0068859_100019393 3300005617 Bacteria 6833
89 Ga0068864_100021080 3300005618 Bacteria 5457
90 Ga0068864_100040686 3300005618 Bacteria 3975
91 Ga0068864_100049157 3300005618 Bacteria 3628
92 Ga0068861_100010257 3300005719 Bacteria 6502
93 Ga0068861_100015359 3300005719 Bacteria 5395
94 Ga0068861_100091692 3300005719 Bacteria 2399
95 Ga0068861_100192135 3300005719 Bacteria 1707
96 Ga0068870_10009122 3300005840 Bacteria 4495
97 Ga0068863_100012765 3300005841 Bacteria 8102
98 Ga0068863_100020030 3300005841 Bacteria 6399
99 Ga0068858_100032694 3300005842 Bacteria 4831
100 Ga0068858_100043870 3300005842 Bacteria 4146
101 Ga0068858_100065112 3300005842 Bacteria 3372
102 Ga0068860_100075693 3300005843 Bacteria 3202
103 Ga0068860_100205296 3300005843 Bacteria 1911
104 Ga0068862_100000604 3300005844 Bacteria 37343
105 Ga0068862_100003771 3300005844 Bacteria 12929
106 Ga0068862_100151642 3300005844 Bacteria 2063
107 Ga0081455_10032518 3300005937 Bacteria 4699
108 Ga0081539_10011631 3300005985 Bacteria 6928
109 Ga0097621_100086769 3300006237 Bacteria 2612
110 Ga0097621_100170666 3300006237 Bacteria 1875
111 Ga0075428_100001871 3300006844 Bacteria 22557
112 Ga0075428_100004388 3300006844 Bacteria 15572
113 Ga0075428_100016696 3300006844 Bacteria 8106
114 Ga0075430_100007082 3300006846 Bacteria 9457
115 Ga0075431_100006876 3300006847 Bacteria 11301
116 Ga0075431_100112037 3300006847 Bacteria 2816
117 Ga0075433_10032578 3300006852 Bacteria 4464
118 Ga0075433_10181327 3300006852 Bacteria 1874
119 Ga0075433_10219717 3300006852 Bacteria 1688
120 Ga0075433_10248189 3300006852 Bacteria 1579
121 Ga0075434_100006082 3300006871 Bacteria 11042
122 Ga0075434_100010197 3300006871 Bacteria 8798
123 Ga0075434_100016691 3300006871 Bacteria 7062
124 Ga0075434_100098789 3300006871 Bacteria 2924
125 Ga0075434_100154122 3300006871 Bacteria 2318
126 Ga0075429_100022768 3300006880 Bacteria 5432
127 Ga0075429_100023000 3300006880 Bacteria 5403
128 Ga0075429_100166170 3300006880 Bacteria 1933
129 Ga0075436_100003619 3300006914 Bacteria 10603
130 Ga0075436_100009419 3300006914 Bacteria 6676
131 Ga0075436_100012220 3300006914 Bacteria 5883
132 Ga0075436_100028119 3300006914 Bacteria 3869
133 Ga0097620_100002556 3300006931 Bacteria 18468
134 Ga0097620_100019393 3300006931 Bacteria 6833
135 Ga0075435_100000177 3300007076 Bacteria 37596
136 Ga0075435_100000948 3300007076 Bacteria 18280
137 Ga0075435_100001094 3300007076 Bacteria 17238
138 Ga0075435_100071083 3300007076 Bacteria 2841
139 Ga0075435_100154058 3300007076 Bacteria 1933
140 Ga0075435_100209362 3300007076 Bacteria 1654
141 Ga0105240_10026350 3300009093 Bacteria 7627
142 Ga0105240_10099671 3300009093 Bacteria 3536
143 Ga0111539_10000282 3300009094 Bacteria 61040
144 Ga0111539_10013636 3300009094 Bacteria 10152
145 Ga0111539_10019538 3300009094 Bacteria 8358
146 Ga0111539_10046551 3300009094 Bacteria 5187
147 Ga0111539_10115649 3300009094 Bacteria 3145
148 Ga0111539_10241481 3300009094 Bacteria 2103
149 Ga0105245_10010813 3300009098 Bacteria 7941
150 Ga0105245_10136819 3300009098 Bacteria 2303
151 Ga0105247_10073921 3300009101 Bacteria 2137
152 Ga0114129_10002402 3300009147 Bacteria 26018
153 Ga0114129_10003573 3300009147 Bacteria 21875
154 Ga0114129_10004190 3300009147 Bacteria 20370
155 Ga0114129_10014054 3300009147 Bacteria 11404
156 Ga0114129_10018498 3300009147 Bacteria 9920
157 Ga0114129_10031673 3300009147 Bacteria 7475
158 Ga0114129_10040416 3300009147 Bacteria 6574
159 Ga0114129_10044870 3300009147 Bacteria 6217
160 Ga0114129_10058076 3300009147 Bacteria 5412
161 Ga0114129_10058845 3300009147 Bacteria 5375
162 Ga0114129_10212593 3300009147 Bacteria 2614
163 Ga0105243_10006530 3300009148 Bacteria 9010
164 Ga0105243_10288360 3300009148 Bacteria 1482
165 Ga0105242_10002492 3300009176 Bacteria 14439
166 Ga0105248_10007341 3300009177 Bacteria 12095
167 Ga0105248_10014047 3300009177 Bacteria 8813
168 Ga0105248_10062898 3300009177 Bacteria 4166
169 Ga0105248_10136618 3300009177 Bacteria 2766
170 Ga0105249_10017055 3300009553 Bacteria 6445
171 Ga0105249_10070497 3300009553 Bacteria 3226
172 Ga0157378_10074857 3300013297 Bacteria 3047
173 Ga0163162_10036085 3300013306 Bacteria 4926
174 Ga0163162_10042458 3300013306 Bacteria 4551
175 Ga0163162_10067943 3300013306 Bacteria 3615
176 Ga0163162_10140511 3300013306 Bacteria 2528
177 Ga0157375_10027167 3300013308 Bacteria 5346
178 Ga0157375_10102313 3300013308 Bacteria 2949
179 Ga0157375_10134879 3300013308 Bacteria 2591
180 Ga0157375_10245366 3300013308 Bacteria 1951
181 Ga0157375_10429624 3300013308 Bacteria 1487
182 Ga0163163_10032453 3300014325 Bacteria 5043
183 Ga0163163_10068461 3300014325 Bacteria 3532
184 Ga0163163_10126058 3300014325 Bacteria 2598
185 Ga0157380_10024377 3300014326 Bacteria 4579
186 Ga0157380_10129343 3300014326 Bacteria 2152
187 Ga0157377_10010613 3300014745 Bacteria 4563
188 Ga0157379_10023958 3300014968 Bacteria 5417
189 Ga0157379_10088518 3300014968 Bacteria 2777
190 Ga0157376_10055015 3300014969 Bacteria 3319
191 Ga0207642_10015816 3300025899 Bacteria 2824
192 Ga0207680_10034618 3300025903 Bacteria 2892
193 Ga0207680_10118748 3300025903 Bacteria 1726
194 Ga0207645_10001495 3300025907 Bacteria 19114
195 Ga0207643_10004952 3300025908 Bacteria 7128
196 Ga0207643_10011395 3300025908 Bacteria 4800
197 Ga0207707_10081231 3300025912 Bacteria 2830
198 Ga0207695_10125517 3300025913 Bacteria 2529
199 Ga0207695_10218725 3300025913 Bacteria 1813
200 Ga0207662_10045991 3300025918 Bacteria 2581
201 Ga0207662_10049240 3300025918 Bacteria 2499
202 Ga0207657_10040558 3300025919 Bacteria 4124
203 Ga0207652_10026423 3300025921 Bacteria 4835
204 Ga0207681_10001518 3300025923 Bacteria 14965
205 Ga0207681_10012372 3300025923 Bacteria 5265
206 Ga0207681_10033348 3300025923 Bacteria 3375
207 Ga0207681_10061763 3300025923 Bacteria 2577
208 Ga0207650_10016323 3300025925 Bacteria 5189
209 Ga0207650_10103706 3300025925 Bacteria 2193
210 Ga0207659_10005817 3300025926 Bacteria 7516
211 Ga0207687_10006141 3300025927 Bacteria 7947
212 Ga0207690_10070511 3300025932 Bacteria 2407
213 Ga0207706_10027640 3300025933 Bacteria 5072
214 Ga0207686_10004134 3300025934 Bacteria 7788
215 Ga0207686_10022429 3300025934 Bacteria 3636
216 Ga0207686_10143737 3300025934 Bacteria 1652
217 Ga0207670_10016026 3300025936 Bacteria 4495
218 Ga0207670_10027556 3300025936 Bacteria 3594
219 Ga0207669_10107979 3300025937 Bacteria 1857
220 Ga0207669_10113148 3300025937 Bacteria 1824
221 Ga0207665_10053854 3300025939 Bacteria 2712
222 Ga0207691_10019196 3300025940 Bacteria 6472
223 Ga0207691_10032408 3300025940 Bacteria 4871
224 Ga0207691_10035782 3300025940 Bacteria 4604
225 Ga0207691_10072641 3300025940 Bacteria 3103
226 Ga0207691_10230937 3300025940 Bacteria 1602
227 Ga0207711_10008784 3300025941 Bacteria 8448
228 Ga0207711_10013921 3300025941 Bacteria 6680
229 Ga0207711_10023960 3300025941 Bacteria 5109
230 Ga0207711_10028025 3300025941 Bacteria 4736
231 Ga0207711_10031580 3300025941 Bacteria 4472
232 Ga0207711_10284800 3300025941 Bacteria 1522
233 Ga0207711_10310134 3300025941 Bacteria 1457
234 Ga0207689_10100205 3300025942 Bacteria 2380
235 Ga0207667_10039375 3300025949 Bacteria 5038
236 Ga0207651_10025628 3300025960 Bacteria 3669
237 Ga0207651_10101004 3300025960 Bacteria 2140
238 Ga0207651_10114041 3300025960 Bacteria 2035
239 Ga0207651_10160176 3300025960 Bacteria 1763
240 Ga0207712_10001123 3300025961 Bacteria 18659
241 Ga0207640_10007916 3300025981 Bacteria 5867
242 Ga0207640_10088128 3300025981 Bacteria 2142
243 Ga0207658_10017274 3300025986 Bacteria 4970
244 Ga0207677_10035721 3300026023 Bacteria 3231
245 Ga0207677_10103520 3300026023 Bacteria 2102
246 Ga0207703_10014602 3300026035 Bacteria 6128
247 Ga0207703_10031326 3300026035 Bacteria 4204
248 Ga0207703_10034518 3300026035 Bacteria 4014
249 Ga0207703_10191632 3300026035 Bacteria 1811
250 Ga0207708_10032560 3300026075 Bacteria 3958
251 Ga0207708_10058962 3300026075 Bacteria 2929
252 Ga0207641_10004659 3300026088 Bacteria 11834
253 Ga0207641_10291208 3300026088 Bacteria 1539
254 Ga0207648_10044696 3300026089 Bacteria 3887
255 Ga0207648_10091863 3300026089 Bacteria 2654
256 Ga0207648_10200652 3300026089 Bacteria 1769
257 Ga0207676_10031493 3300026095 Bacteria 3990
258 Ga0207676_10033860 3300026095 Bacteria 3864
259 Ga0207674_10004709 3300026116 Bacteria 16358
260 Ga0207675_100000149 3300026118 Bacteria 61117
261 Ga0207675_100020098 3300026118 Bacteria 6228
262 Ga0207683_10015260 3300026121 Bacteria 6538
263 Ga0207683_10028431 3300026121 Bacteria 4835
264 Ga0207428_10000482 3300027907 Bacteria 48138
265 Ga0207428_10017704 3300027907 Bacteria 6111
266 Ga0207428_10041732 3300027907 Bacteria 3713
267 Ga0207428_10067479 3300027907 Bacteria 2816
268 Ga0207428_10101914 3300027907 Bacteria 2217
269 Ga0207428_10128202 3300027907 Bacteria 1942
270 Ga0268266_10009614 3300028379 Bacteria 8502
271 Ga0268266_10013632 3300028379 Bacteria 7000
272 Ga0268266_10037203 3300028379 Bacteria 4147
273 Ga0268266_10120241 3300028379 Bacteria 2337
274 Ga0268265_10000160 3300028380 Bacteria 81960
275 Ga0268265_10033137 3300028380 Bacteria 3753
276 Ga0268265_10238619 3300028380 Bacteria 1602
277 Ga0268264_10009802 3300028381 Bacteria 7928
278 Ga0268264_10138004 3300028381 Bacteria 2171
279 Ga0268264_10383770 3300028381 Bacteria 1346
280 Ga0307405_10064639 3300031731 Bacteria 2326
281 Ga0307413_10017849 3300031824 Bacteria 3706
282 Ga0307413_10019682 3300031824 Bacteria 3573
283 Ga0307410_10001166 3300031852 Bacteria 11585
284 Ga0307410_10008648 3300031852 Bacteria 5659
285 Ga0307406_10005052 3300031901 Bacteria 7196
286 Ga0307407_10002138 3300031903 Bacteria 7602
287 Ga0307407_10022564 3300031903 Bacteria 3268
288 Ga0307412_10004341 3300031911 Bacteria 7907
289 Ga0307412_10056385 3300031911 Bacteria 2618
290 Ga0307409_100002213 3300031995 Bacteria 10051
291 Ga0307409_100002826 3300031995 Bacteria 9180
292 Ga0307409_100047959 3300031995 Bacteria 3247
293 Ga0307416_100003201 3300032002 Bacteria 9592
294 Ga0307416_100036776 3300032002 Bacteria 3759
295 Ga0307416_100136201 3300032002 Bacteria 2222
296 Ga0307414_10031676 3300032004 Bacteria 3472
297 Ga0307414_10069017 3300032004 Bacteria 2539
298 Ga0307414_10139598 3300032004 Bacteria 1895
299 Ga0307411_10005825 3300032005 Bacteria 6105
300 Ga0307411_10014794 3300032005 Bacteria 4356
301 Ga0307411_10037261 3300032005 Bacteria 3056
302 Ga0307415_100002523 3300032126 Bacteria 9145
303 Ga0373948_0001643 3300034817 Bacteria 3155
304 Ga0373958_0000318 3300034819 Bacteria 5819
305 Ga0373959_0000290 3300034820 Bacteria 10682
306 Ga0373959_0014175 3300034820 Bacteria 1448
307 Ga0373944_0017227 3300035089 Bacteria 2048
308 Ga0373949_0005555 3300035090 Bacteria 2811
309 Ga0373951_0001651 3300035091 Bacteria 5853
310 Ga0373932_0004164 3300035112 Bacteria 3437
311 Ga0373941_0014094 3300035115 Bacteria 2129
312 Ga0373957_0086757 3300035120 Bacteria 1240
313 Ga0373960_0000213 3300035121 Bacteria 10646
314 Ga0373943_0003818 3300035170 Bacteria 6847
315 Ga0373946_0019747 3300035171 Bacteria 2599
316 Ga0373942_0003944 3300035207 Bacteria 3464
317 Ga0373931_0006673 3300035691 Bacteria 5408
318 Ga0373927_0017106 3300035695 Bacteria 4778
319 Ga0373947_0052293 3300035725 Bacteria 2460
320 Ga0373937_0126968 3300036401 Bacteria 2380
321 Ga0373937_0235832 3300036401 Bacteria 1723
322 Ga0451577_0113349 3300042876 Bacteria 2427
323 Ga0451576_0006002 3300045051 Bacteria 15020
324 Ga0451576_0043767 3300045051 Bacteria 4722
325 Ga0451576_0153008 3300045051 Bacteria 2406
326 Ga0495592_0047331 3300046454 Bacteria 3203
327 Ga0495603_0046807 3300046455 Bacteria 2577
328 Ga0495629_0002703 3300046459 Bacteria 13584
329 Ga0495651_0093435 3300046462 Bacteria 2252
330 Ga0495580_0045647 3300046472 Bacteria 3112
331 Ga0495594_0029050 3300046499 Bacteria 2987
332 Ga0495628_0029704 3300046516 Bacteria 4430
333 Ga0495630_0091145 3300046517 Bacteria 2303
334 Ga0495630_0164762 3300046517 Bacteria 1688
335 Ga0495640_0148049 3300046533 Bacteria 1510
336 Ga0495587_0022433 3300046536 Bacteria 3888
337 Ga0495598_0010392 3300046537 Bacteria 2229
338 Ga0495621_0000941 3300046539 Bacteria 7414
339 Ga0495621_0002895 3300046539 Bacteria 4677
340 Ga0495621_0027568 3300046539 Bacteria 1925
341 Ga0495645_0004560 3300046543 Bacteria 9451
342 Ga0495645_0071478 3300046543 Bacteria 2502
343 Ga0495645_0113380 3300046543 Bacteria 1916
344 Ga0495667_0101132 3300046559 Bacteria 1865
345 Ga0495659_0005678 3300046664 Bacteria 3934
346 Ga0495659_0009866 3300046664 Bacteria 3054
347 Ga0495588_0014392 3300046674 Bacteria 3786
348 Ga0495658_0037863 3300046683 Bacteria 2668
349 Ga0495658_0041280 3300046683 Bacteria 2569
350 Ga0495658_0109419 3300046683 Bacteria 1660
351 Ga0495658_0114332 3300046683 Bacteria 1626
352 Ga0495669_0008199 3300046684 Bacteria 4386
353 Ga0495613_0000318 3300046689 Bacteria 43663
354 Ga0495604_0054485 3300047317 Bacteria 3085
355 Ga0495636_0004228 3300047318 Bacteria 5634
356 Ga0495674_0259043 3300047319 Bacteria 1429
357 Ga0495684_0000053 3300047471 Bacteria 82157
358 Ga0495684_0004547 3300047471 Bacteria 10837
359 Ga0496101_0000476 3300048904 Bacteria 25304
360 Ga0496102_0103884 3300048905 Bacteria 2643
361 Ga0496104_0009688 3300048907 Bacteria 8583
362 Ga0496104_0076016 3300048907 Bacteria 3198
363 Ga0496104_0169390 3300048907 Bacteria 2094
364 Ga0496105_0052055 3300048908 Bacteria 3381
365 Ga0496105_0058099 3300048908 Bacteria 3193
366 Ga0496105_0321477 3300048908 Bacteria 1240
367 Ga0496106_0054575 3300048909 Bacteria 3019
368 Ga0496109_0033847 3300048912 Bacteria 4600
369 Ga0496112_0001501 3300048915 Bacteria 17968
370 Ga0496112_0228424 3300048915 Bacteria 1816
371 Ga0496113_0080630 3300048916 Bacteria 2493
372 Ga0496114_0006827 3300048917 Bacteria 8989
373 Ga0496114_0206736 3300048917 Bacteria 1721
374 Ga0501033_0188195 3300049570 Bacteria 1478
375 Ga0501036_0094212 3300049572 Bacteria 2531
376 Ga0501040_0178331 3300049576 Bacteria 1505
377 Ga0501041_0008287 3300049577 Bacteria 6116
378 Ga0501041_0121788 3300049577 Bacteria 1621
379 Ga0501042_0055131 3300049578 Bacteria 2836
380 Ga0501042_0126502 3300049578 Bacteria 1840
381 Ga0501046_0040021 3300049580 Bacteria 3749
382 Ga0501048_0049970 3300049582 Bacteria 2979
383 Ga0501067_0070130 3300049583 Bacteria 1941
384 Ga0501071_0001346 3300049587 Bacteria 14048
385 Ga0501072_0000670 3300049588 Bacteria 24731
386 Ga0501072_0018967 3300049588 Bacteria 5310
387 Ga0501074_0122765 3300049590 Bacteria 1858
388 Ga0501075_0004581 3300049591 Bacteria 9372
389 Ga0501075_0140527 3300049591 Bacteria 1840
390 Ga0501076_0061243 3300049592 Bacteria 2995
391 Ga0501076_0075342 3300049592 Bacteria 2704
392 Ga0501081_0092161 3300049743 Bacteria 2132
393 Ga0501081_0100091 3300049743 Bacteria 2048
394 Ga0501081_0205008 3300049743 Bacteria 1431
395 Ga0501045_0006402 3300049824 Bacteria 8152
396 Ga0501045_0006867 3300049824 Bacteria 7886
397 Ga0501045_0202493 3300049824 Bacteria 1479
398 nmdc:mga05p37_106821_c1 3300050507 Bacteria 3444
399 nmdc:mga05p37_1291_c1 3300050507 Bacteria 29083
400 nmdc:mga05p37_14935_c1 3300050507 Bacteria 9323
401 nmdc:mga05p37_15762_c1 3300050507 Bacteria 9089
402 nmdc:mga05p37_174254_c1 3300050507 Bacteria 2622
403 nmdc:mga05p37_193417_c1 3300050507 Bacteria 2468
404 nmdc:mga05p37_2046_c1 3300050507 Bacteria 23526
405 nmdc:mga05p37_21247_c1 3300050507 Bacteria 7858
406 nmdc:mga05p37_270211_c1 3300050507 Bacteria 2032
407 nmdc:mga05p37_29004_c1 3300050507 Bacteria 6753
408 nmdc:mga05p37_298481_c1 3300050507 Bacteria 1915
409 nmdc:mga05p37_70944_c1 3300050507 Bacteria 4285
410 nmdc:mga05p37_77947_c1 3300050507 Bacteria 4080
411 nmdc:mga05p37_9617_c1 3300050507 Bacteria 11451
412 nmdc:mga09592_161935_c1 3300050508 Bacteria 1933
413 nmdc:mga09592_202950_c1 3300050508 Bacteria 1717
414 nmdc:mga09592_20926_c1 3300050508 Bacteria 5387
415 nmdc:mga09592_29230_c1 3300050508 Bacteria 4583
416 nmdc:mga09592_5812_c1 3300050508 Bacteria 10063
417 nmdc:mga0qj67_10603_c1 3300050509 Bacteria 6885
418 nmdc:mga06r32_241518_c1 3300050510 Bacteria 1794
419 nmdc:mga06r32_29910_c1 3300050510 Bacteria 5109
420 nmdc:mga08y16_10217_c1 3300050511 Bacteria 9852
421 nmdc:mga08y16_124593_c1 3300050511 Bacteria 2681
422 nmdc:mga08y16_14470_c1 3300050511 Bacteria 8300
423 nmdc:mga08y16_2850_c1 3300050511 Bacteria 17782
424 nmdc:mga08y16_38650_c1 3300050511 Bacteria 5009
425 nmdc:mga08y16_8620_c1 3300050511 Bacteria 10691
426 nmdc:mga0n895_102979_c1 3300050512 Bacteria 2866
427 nmdc:mga0n895_14130_c1 3300050512 Bacteria 7239
428 nmdc:mga0n895_20941_c1 3300050512 Bacteria 6108
429 nmdc:mga0n895_52436_c1 3300050512 Bacteria 4004
430 nmdc:mga0n895_780_c1 3300050512 Bacteria 22660
431 nmdc:mga0rr50_135931_c1 3300050513 Bacteria 1973
432 nmdc:mga0rr50_16_c1 3300050513 Bacteria 175739
433 nmdc:mga0rr50_189941_c1 3300050513 Bacteria 1683
434 nmdc:mga08x19_112782_c1 3300050514 Bacteria 1815
435 nmdc:mga08x19_137_c1 3300050514 Bacteria 65227
436 nmdc:mga08x19_9271_c1 3300050514 Bacteria 5883
437 nmdc:mga0a205_186358_c1 3300050515 Bacteria 1968
438 nmdc:mga0a205_36387_c1 3300050515 Bacteria 4729
439 nmdc:mga0a205_8237_c2 3300050515 Bacteria 7691
440 nmdc:mga0a205_89293_c1 3300050515 Bacteria 2979
441 Ga0495601_0040322 3300053077 Bacteria 2925
442 Ga0495601_0046182 3300053077 Bacteria 2741
443 Ga0495595_0019280 3300053084 Bacteria 2959
444 Ga0495595_0052245 3300053084 Bacteria 1896
445 Ga0495619_0003752 3300053085 Bacteria 9786
446 Ga0495619_0010615 3300053085 Bacteria 5795
447 Ga0501084_0027475 3300054114 Bacteria 4754
448 Ga0590071_000076 3300059421 Bacteria 26729
449 Ga0590074_000253 3300059423 Bacteria 7155
450 Ga0590075_000397 3300059424 Bacteria 11941
451 Ga0590077_000561 3300059426 Bacteria 10275
452 Ga0501082_0001197 3300060353 Bacteria 22849
453 Ga0530510_0001246 3300061734 Bacteria 16983
454 Ga0307408_100031984
455 JGI24751J29686_10002884
456 Ga0065704_10124895
457 Ga0065712_10000240
458 Ga0065715_10000461
459 Ga0065707_10143191
460 Ga0070690_100005931
461 Ga0070690_100018642
462 Ga0070670_100001520
463 Ga0070670_100004554
464 Ga0070670_100093026
465 Ga0070666_10031807
466 Ga0070666_10063323
467 Ga0068868_100013464
468 Ga0070660_100002101
469 Ga0070689_100014041
470 Ga0070689_100022262
471 Ga0070691_10019456
472 Ga0070687_100049493
473 Ga0070692_10002464
474 Ga0070692_10048392
475 Ga0070668_100039690
476 Ga0070669_100000356
477 Ga0070669_100096113
478 Ga0070675_100000126
479 Ga0070675_100003326
480 Ga0070675_100007860
481 Ga0070675_100070303
482 Ga0070671_100001545
483 Ga0070671_100039661
484 Ga0070674_100007238
485 Ga0070673_100084508
486 Ga0070673_100091465
487 Ga0070688_100020144
488 Ga0070688_100020709
489 Ga0070688_100042989
490 Ga0070659_100027011
491 Ga0070709_10014751
492 Ga0070714_100050533
493 Ga0070701_10013890
494 Ga0070705_100000680
495 Ga0070705_100037348
496 Ga0070705_100085284
497 Ga0070700_100088286
498 Ga0070694_100006774
499 Ga0070694_100171221
500 Ga0070708_100031961
501 Ga0070678_100015885
502 Ga0070678_100101719
503 Ga0070681_10007600
504 Ga0068867_100068397
505 Ga0068867_100072160
506 Ga0068867_100075709
507 Ga0068867_100144840
508 Ga0070685_10003607
509 Ga0070707_100043580
510 Ga0070698_100005030
511 Ga0070698_100009236
512 Ga0070698_100081158
513 Ga0070699_100001266
514 Ga0070699_100003933
515 Ga0070699_100009305
516 Ga0070679_100017657
517 Ga0070679_100135302
518 Ga0070679_100147983
519 Ga0070684_100053249
520 Ga0070672_100027002
521 Ga0070672_100130710
522 Ga0070672_100201646
523 Ga0070686_100010301
524 Ga0070686_100020483
525 Ga0070695_100000031
526 Ga0070695_100152420
527 Ga0070665_100014862
528 Ga0070665_100123568
529 Ga0070704_100003975
530 Ga0070704_100030216
531 Ga0070704_100052329
532 Ga0070704_100052703
533 Ga0070704_100068951
534 Ga0070704_100155726
535 Ga0070704_100195046
536 Ga0068855_100040964
537 Ga0070664_100140454
538 Ga0068854_100016855
539 Ga0070702_100042824
540 Ga0068859_100002556
541 Ga0068859_100019393
542 Ga0068864_100021080
543 Ga0068864_100040686
544 Ga0068864_100049157
545 Ga0068861_100010257
546 Ga0068861_100015359
547 Ga0068861_100091692
548 Ga0068861_100192135
549 Ga0068870_10009122
550 Ga0068863_100012765
551 Ga0068863_100020030
552 Ga0068858_100032694
553 Ga0068858_100043870
554 Ga0068858_100065112
555 Ga0068860_100075693
556 Ga0068860_100205296
557 Ga0068862_100000604
558 Ga0068862_100003771
559 Ga0068862_100151642
560 Ga0081455_10032518
561 Ga0081539_10011631
562 Ga0097621_100086769
563 Ga0097621_100170666
564 Ga0075428_100001871
565 Ga0075428_100004388
566 Ga0075428_100016696
567 Ga0075430_100007082
568 Ga0075431_100006876
569 Ga0075431_100112037
570 Ga0075433_10032578
571 Ga0075433_10181327
572 Ga0075433_10219717
573 Ga0075433_10248189
574 Ga0075434_100006082
575 Ga0075434_100010197
576 Ga0075434_100016691
577 Ga0075434_100098789
578 Ga0075434_100154122
579 Ga0075429_100022768
580 Ga0075429_100023000
581 Ga0075429_100166170
582 Ga0075436_100003619
583 Ga0075436_100009419
584 Ga0075436_100012220
585 Ga0075436_100028119
586 Ga0097620_100002556
587 Ga0097620_100019393
588 Ga0075435_100000177
589 Ga0075435_100000948
590 Ga0075435_100001094
591 Ga0075435_100071083
592 Ga0075435_100154058
593 Ga0075435_100209362
594 Ga0105240_10026350
595 Ga0105240_10099671
596 Ga0111539_10000282
597 Ga0111539_10013636
598 Ga0111539_10019538
599 Ga0111539_10046551
600 Ga0111539_10115649
601 Ga0111539_10241481
602 Ga0105245_10010813
603 Ga0105245_10136819
604 Ga0105247_10073921
605 Ga0114129_10002402
606 Ga0114129_10003573
607 Ga0114129_10004190
608 Ga0114129_10014054
609 Ga0114129_10018498
610 Ga0114129_10031673
611 Ga0114129_10040416
612 Ga0114129_10044870
613 Ga0114129_10058076
614 Ga0114129_10058845
615 Ga0114129_10212593
616 Ga0105243_10006530
617 Ga0105243_10288360
618 Ga0105242_10002492
619 Ga0105248_10007341
620 Ga0105248_10014047
621 Ga0105248_10062898
622 Ga0105248_10136618
623 Ga0105249_10017055
624 Ga0105249_10070497
625 Ga0157378_10074857
626 Ga0163162_10036085
627 Ga0163162_10042458
628 Ga0163162_10067943
629 Ga0163162_10140511
630 Ga0157375_10027167
631 Ga0157375_10102313
632 Ga0157375_10134879
633 Ga0157375_10245366
634 Ga0157375_10429624
635 Ga0163163_10032453
636 Ga0163163_10068461
637 Ga0163163_10126058
638 Ga0157380_10024377
639 Ga0157380_10129343
640 Ga0157377_10010613
641 Ga0157379_10023958
642 Ga0157379_10088518
643 Ga0157376_10055015
644 Ga0207642_10015816
645 Ga0207680_10034618
646 Ga0207680_10118748
647 Ga0207645_10001495
648 Ga0207643_10004952
649 Ga0207643_10011395
650 Ga0207707_10081231
651 Ga0207695_10125517
652 Ga0207695_10218725
653 Ga0207662_10045991
654 Ga0207662_10049240
655 Ga0207657_10040558
656 Ga0207652_10026423
657 Ga0207681_10001518
658 Ga0207681_10012372
659 Ga0207681_10033348
660 Ga0207681_10061763
661 Ga0207650_10016323
662 Ga0207650_10103706
663 Ga0207659_10005817
664 Ga0207687_10006141
665 Ga0207690_10070511
666 Ga0207706_10027640
667 Ga0207686_10004134
668 Ga0207686_10022429
669 Ga0207686_10143737
670 Ga0207670_10016026
671 Ga0207670_10027556
672 Ga0207669_10107979
673 Ga0207669_10113148
674 Ga0207665_10053854
675 Ga0207691_10019196
676 Ga0207691_10032408
677 Ga0207691_10035782
678 Ga0207691_10072641
679 Ga0207691_10230937
680 Ga0207711_10008784
681 Ga0207711_10013921
682 Ga0207711_10023960
683 Ga0207711_10028025
684 Ga0207711_10031580
685 Ga0207711_10284800
686 Ga0207711_10310134
687 Ga0207689_10100205
688 Ga0207667_10039375
689 Ga0207651_10025628
690 Ga0207651_10101004
691 Ga0207651_10114041
692 Ga0207651_10160176
693 Ga0207712_10001123
694 Ga0207640_10007916
695 Ga0207640_10088128
696 Ga0207658_10017274
697 Ga0207677_10035721
698 Ga0207677_10103520
699 Ga0207703_10014602
700 Ga0207703_10031326
701 Ga0207703_10034518
702 Ga0207703_10191632
703 Ga0207708_10032560
704 Ga0207708_10058962
705 Ga0207641_10004659
706 Ga0207641_10291208
707 Ga0207648_10044696
708 Ga0207648_10091863
709 Ga0207648_10200652
710 Ga0207676_10031493
711 Ga0207676_10033860
712 Ga0207674_10004709
713 Ga0207675_100000149
714 Ga0207675_100020098
715 Ga0207683_10015260
716 Ga0207683_10028431
717 Ga0207428_10000482
718 Ga0207428_10017704
719 Ga0207428_10041732
720 Ga0207428_10067479
721 Ga0207428_10101914
722 Ga0207428_10128202
723 Ga0268266_10009614
724 Ga0268266_10013632
725 Ga0268266_10037203
726 Ga0268266_10120241
727 Ga0268265_10000160
728 Ga0268265_10033137
729 Ga0268265_10238619
730 Ga0268264_10009802
731 Ga0268264_10138004
732 Ga0268264_10383770
733 Ga0307405_10064639
734 Ga0307413_10017849
735 Ga0307413_10019682
736 Ga0307410_10001166
737 Ga0307410_10008648
738 Ga0307406_10005052
739 Ga0307407_10002138
740 Ga0307407_10022564
741 Ga0307412_10004341
742 Ga0307412_10056385
743 Ga0307409_100002213
744 Ga0307409_100002826
745 Ga0307409_100047959
746 Ga0307416_100003201
747 Ga0307416_100036776
748 Ga0307416_100136201
749 Ga0307414_10031676
750 Ga0307414_10069017
751 Ga0307414_10139598
752 Ga0307411_10005825
753 Ga0307411_10014794
754 Ga0307411_10037261
755 Ga0307415_100002523
756 Ga0373948_0001643
757 Ga0373958_0000318
758 Ga0373959_0000290
759 Ga0373959_0014175
760 Ga0373944_0017227
761 Ga0373949_0005555
762 Ga0373951_0001651
763 Ga0373932_0004164
764 Ga0373941_0014094
765 Ga0373957_0086757
766 Ga0373960_0000213
767 Ga0373943_0003818
768 Ga0373946_0019747
769 Ga0373942_0003944
770 Ga0373931_0006673
771 Ga0373927_0017106
772 Ga0373947_0052293
773 Ga0373937_0126968
774 Ga0373937_0235832
775 Ga0451577_0113349
776 Ga0451576_0006002
777 Ga0451576_0043767
778 Ga0451576_0153008
779 Ga0495592_0047331
780 Ga0495603_0046807
781 Ga0495629_0002703
782 Ga0495651_0093435
783 Ga0495580_0045647
784 Ga0495594_0029050
785 Ga0495628_0029704
786 Ga0495630_0091145
787 Ga0495630_0164762
788 Ga0495640_0148049
789 Ga0495587_0022433
790 Ga0495598_0010392
791 Ga0495621_0000941
792 Ga0495621_0002895
793 Ga0495621_0027568
794 Ga0495645_0004560
795 Ga0495645_0071478
796 Ga0495645_0113380
797 Ga0495667_0101132
798 Ga0495659_0005678
799 Ga0495659_0009866
800 Ga0495588_0014392
801 Ga0495658_0037863
802 Ga0495658_0041280
803 Ga0495658_0109419
804 Ga0495658_0114332
805 Ga0495669_0008199
806 Ga0495613_0000318
807 Ga0495604_0054485
808 Ga0495636_0004228
809 Ga0495674_0259043
810 Ga0495684_0000053
811 Ga0495684_0004547
812 Ga0496101_0000476
813 Ga0496102_0103884
814 Ga0496104_0009688
815 Ga0496104_0076016
816 Ga0496104_0169390
817 Ga0496105_0052055
818 Ga0496105_0058099
819 Ga0496105_0321477
820 Ga0496106_0054575
821 Ga0496109_0033847
822 Ga0496112_0001501
823 Ga0496112_0228424
824 Ga0496113_0080630
825 Ga0496114_0006827
826 Ga0496114_0206736
827 Ga0501033_0188195
828 Ga0501036_0094212
829 Ga0501040_0178331
830 Ga0501041_0008287
831 Ga0501041_0121788
832 Ga0501042_0055131
833 Ga0501042_0126502
834 Ga0501046_0040021
835 Ga0501048_0049970
836 Ga0501067_0070130
837 Ga0501071_0001346
838 Ga0501072_0000670
839 Ga0501072_0018967
840 Ga0501074_0122765
841 Ga0501075_0004581
842 Ga0501075_0140527
843 Ga0501076_0061243
844 Ga0501076_0075342
845 Ga0501081_0092161
846 Ga0501081_0100091
847 Ga0501081_0205008
848 Ga0501045_0006402
849 Ga0501045_0006867
850 Ga0501045_0202493
851 nmdc:mga05p37_106821_c1
852 nmdc:mga05p37_1291_c1
853 nmdc:mga05p37_14935_c1
854 nmdc:mga05p37_15762_c1
855 nmdc:mga05p37_174254_c1
856 nmdc:mga05p37_193417_c1
857 nmdc:mga05p37_2046_c1
858 nmdc:mga05p37_21247_c1
859 nmdc:mga05p37_270211_c1
860 nmdc:mga05p37_29004_c1
861 nmdc:mga05p37_298481_c1
862 nmdc:mga05p37_70944_c1
863 nmdc:mga05p37_77947_c1
864 nmdc:mga05p37_9617_c1
865 nmdc:mga09592_161935_c1
866 nmdc:mga09592_202950_c1
867 nmdc:mga09592_20926_c1
868 nmdc:mga09592_29230_c1
869 nmdc:mga09592_5812_c1
870 nmdc:mga0qj67_10603_c1
871 nmdc:mga06r32_241518_c1
872 nmdc:mga06r32_29910_c1
873 nmdc:mga08y16_10217_c1
874 nmdc:mga08y16_124593_c1
875 nmdc:mga08y16_14470_c1
876 nmdc:mga08y16_2850_c1
877 nmdc:mga08y16_38650_c1
878 nmdc:mga08y16_8620_c1
879 nmdc:mga0n895_102979_c1
880 nmdc:mga0n895_14130_c1
881 nmdc:mga0n895_20941_c1
882 nmdc:mga0n895_52436_c1
883 nmdc:mga0n895_780_c1
884 nmdc:mga0rr50_135931_c1
885 nmdc:mga0rr50_16_c1
886 nmdc:mga0rr50_189941_c1
887 nmdc:mga08x19_112782_c1
888 nmdc:mga08x19_137_c1
889 nmdc:mga08x19_9271_c1
890 nmdc:mga0a205_186358_c1
891 nmdc:mga0a205_36387_c1
892 nmdc:mga0a205_8237_c2
893 nmdc:mga0a205_89293_c1
894 Ga0495601_0040322
895 Ga0495601_0046182
896 Ga0495595_0019280
897 Ga0495595_0052245
898 Ga0495619_0003752
899 Ga0495619_0010615
900 Ga0501084_0027475
901 Ga0590071_000076
902 Ga0590074_000253
903 Ga0590075_000397
904 Ga0590077_000561
905 Ga0501082_0001197
906 Ga0530510_0001246

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10589

NADH_4Fe-4S

NADH-ubiquinone oxidoreductase-F iron-sulfur binding region

331

415

0.98

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

47

219

0.97

PF22461

SLBB_2

SLBB domain

240

321

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p61-assembly1.cif.gz_F complex i from e. coli, ddm-purified, with nadh, resting state 0.8471 6 411
6vw7-assembly1.cif.gz_B formate dehydrogenase fdsabg subcomplex fdsbg from c. necator - nadh bound 0.8384 2 408
6zjy-assembly1.cif.gz_1 respiratory complex i from thermus thermophilus, nad+ dataset, minor state 0.8383 1 423
6hli-assembly2.cif.gz_D wild-type nuoef from aquifex aeolicus - reduced form bound to nad+ 0.8351 4 410
8bew-assembly1.cif.gz_B cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the oxidised state 0.8347 4 420
ID Description Score Start End Superfamily
af_P9WIV7_336_431_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9693 323 417 1.20.1440.230
af_A1ZAW7_585_680_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9551 324 414 1.20.1440.230
af_P9WIV7_336_431_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9498 323 417 1.20.1440.230
af_A1Z9Z7_385_480_1.20.1440.230 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain 0.9238 325 413 1.20.1440.230
af_P31979_241_332_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.9214 235 319 3.10.20.600
ID Description Score Start End GO Terms
AF-A0A7C5K124-F1-model_v4 Hydrogenase 0.9744 321 411 GO:0008137
GO:0010181
GO:0046872
GO:0051539
AF-A0A7Z9Y2L4-F1-model_v4 NADH-quinone oxidoreductase subunit F (EC 1.6.5.11) 0.9715 316 411 GO:0003954
GO:0008137
GO:0010181
GO:0045333
GO:0046872
GO:0051539
AF-A0A0F9IB83-F1-model_v4 4Fe-4S ferredoxin-type domain-containing protein 0.9698 316 412 GO:0046872
GO:0051539
AF-W3YWD1-F1-model_v4 deleted 0.969 323 412
AF-A0A533S1Z0-F1-model_v4 MBL fold metallo-hydrolase 0.9656 316 416 GO:0008137
GO:0010181
GO:0016787
GO:0046872
GO:0051539

Map