F447195

General Info

Members Datasets Scaffolds Average Seq Length
453 316 906 341

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1002382|Ga0209758_10023825
Length 399
Sequence MWCGSPGVRGPVPGPTVARMGNAVELEVAGRTVRLSSPDKVFFPERGFTKLDLAQYYMAVGPGILRALRNRPTTLERYPDGVSGESFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEAAAVVWAAQYGTLTFHPWPVRRDDVDHPDELRIDLDPQPGTDFTDAVRAAHELRAVLDEFGGLRGWPKTSGGRGLHVFVPIEPRWTFTQVRRAAIAVGRELERRMPERVTIAWWKEERGERIFVDYNQTARDRTIASAYSVRPRPGAPVSAPLRWEEVDDVAPRDFDLETMPRRFAELGDVHADMDDHAYSLEALLELARRDEHDHGLGDLPYPPEYPKMPGEPKRVQPSRARREGKPASTEGQGGRPWKKPGKSDAPAGXXXTXXXGDEAPPEGSASP

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
61 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
66 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
67 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
72 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
73 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
77 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
80 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
91 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
92 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
95 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
96 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
97 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
98 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
99 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
100 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
101 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
102 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
103 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
124 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
128 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
129 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
135 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
151 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
211 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
212 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
213 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
214 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
215 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
216 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
219 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
220 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
221 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
225 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
226 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
227 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
228 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
229 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
230 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
231 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
232 2643221604 Nocardioides sp. Root190 Isolate Unclassified
233 2643221617 Nocardioides sp. Root79 Isolate Unclassified
234 2643221620 Nocardioides sp. Root240 Isolate Unclassified
235 2643221647 Streptomyces sp. Root369 Isolate Unclassified
236 2643221670 Streptomyces sp. Root431 Isolate Unclassified
237 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
238 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
239 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
240 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
241 2643221714 Streptomyces sp. Root264 Isolate Unclassified
242 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
243 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
244 2738541305 Nocardioides sp. CF167 Isolate Unclassified
245 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
246 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
247 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
248 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
249 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
250 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
251 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
252 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
253 2808606448 Streptomyces sp. 193411 Isolate Unclassified
254 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
255 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
256 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
257 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
258 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
259 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
260 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
261 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
262 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
263 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
264 2862574272 Streptomyces sp. AcE210 Isolate Nodule
265 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
266 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
267 2867428634 Streptomyces sp. RP5T Isolate Unclassified
268 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
269 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
270 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
271 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
272 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
273 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
274 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
275 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
276 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
277 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
278 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
279 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
280 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
281 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
282 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
283 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
284 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
285 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
286 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
287 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
288 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
289 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
290 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
291 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
292 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
293 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
294 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
295 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
296 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
297 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
298 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
299 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
300 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
301 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
302 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
303 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
304 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
305 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
306 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
307 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
308 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
309 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
310 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
311 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
312 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
313 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
314 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
315 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
316 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.47
Metatranscriptomes 0
Isolates 20.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.82
Nodule 0.88
Rhizoplane 1.99
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1002382 3300025297 Bacteria 19350
2 rootH2_10042994 3300003320 Bacteria 7589
3 rootH1_10028448 3300003323 Bacteria 2055
4 Ga0055540_1005049 3300003792 Bacteria 5718
5 Ga0055540_1007358 3300003792 Bacteria 4174
6 Ga0055540_1007777 3300003792 Bacteria 3978
7 Ga0070683_100169959 3300005329 Bacteria 2069
8 Ga0070660_100007504 3300005339 Bacteria 7604
9 Ga0070659_100169106 3300005366 Bacteria 1790
10 Ga0070709_10003236 3300005434 Bacteria 8742
11 Ga0070714_100015450 3300005435 Bacteria 6144
12 Ga0070714_100059765 3300005435 Bacteria 3269
13 Ga0070713_100002507 3300005436 Bacteria 12001
14 Ga0070713_100046466 3300005436 Bacteria 3562
15 Ga0070710_10001815 3300005437 Bacteria 10079
16 Ga0070711_100002113 3300005439 Bacteria 11238
17 Ga0070700_100212879 3300005441 Bacteria 1365
18 Ga0070706_100008714 3300005467 Bacteria 9453
19 Ga0070698_100000596 3300005471 Bacteria 38871
20 Ga0070696_100016719 3300005546 Bacteria 4947
21 Ga0070665_100119950 3300005548 Bacteria 2632
22 Ga0068855_100040159 3300005563 Bacteria 5555
23 Ga0068858_100034964 3300005842 Bacteria 4661
24 Ga0081455_10000061 3300005937 Bacteria 117154
25 Ga0081455_10095002 3300005937 Bacteria 2407
26 Ga0081455_10107714 3300005937 Bacteria 2221
27 Ga0070717_10003007 3300006028 Bacteria 12007
28 Ga0070717_10034019 3300006028 Bacteria 4116
29 Ga0075365_10002450 3300006038 Bacteria 9106
30 Ga0075365_10002577 3300006038 Bacteria 8955
31 Ga0075365_10019085 3300006038 Bacteria 4225
32 Ga0075365_10105622 3300006038 Bacteria 1932
33 Ga0075368_10001301 3300006042 Bacteria 7907
34 Ga0075368_10016855 3300006042 Bacteria 2727
35 Ga0075363_100002340 3300006048 Bacteria 7705
36 Ga0075363_100023376 3300006048 Bacteria 3132
37 Ga0075364_10001422 3300006051 Bacteria 12979
38 Ga0070716_100000387 3300006173 Bacteria 17995
39 Ga0075367_10016202 3300006178 Bacteria 4068
40 Ga0075370_10087714 3300006353 Bacteria 1793
41 Ga0068865_100224193 3300006881 Bacteria 1471
42 Ga0099826_10072901 3300006948 Bacteria 2172
43 Ga0105245_10044163 3300009098 Bacteria 3977
44 Ga0105249_10225244 3300009553 Bacteria 1847
45 Ga0105239_10003727 3300010375 Bacteria 18549
46 Ga0105239_10067832 3300010375 Bacteria 3919
47 Ga0163162_10428484 3300013306 Bacteria 1455
48 Ga0157372_10502787 3300013307 Bacteria 1413
49 Ga0157375_10124552 3300013308 Bacteria 2691
50 Ga0182008_10000702 3300014497 Bacteria 23970
51 Ga0182007_10000377 3300015262 Bacteria 28045
52 Ga0182005_1021454 3300015265 Bacteria 1772
53 Ga0183367_1001 3300015688 Bacteria 1225545
54 Ga0213876_10009990 3300021384 Bacteria 5099
55 Ga0213876_10048162 3300021384 Bacteria 2252
56 Ga0213875_10010444 3300021388 Bacteria 4645
57 Ga0207426_1000707 3300025302 Bacteria 39468
58 Ga0207426_1030624 3300025302 Bacteria 1763
59 Ga0209051_1000750 3300025303 Bacteria 34899
60 Ga0209051_1004754 3300025303 Bacteria 8207
61 Ga0209051_1006532 3300025303 Bacteria 6550
62 Ga0209051_1007498 3300025303 Bacteria 5954
63 Ga0207688_10105660 3300025901 Bacteria 1630
64 Ga0207647_10038754 3300025904 Bacteria 3012
65 Ga0207647_10042262 3300025904 Bacteria 2860
66 Ga0207699_10006752 3300025906 Bacteria 5573
67 Ga0207699_10209989 3300025906 Bacteria 1323
68 Ga0207684_10137941 3300025910 Bacteria 2095
69 Ga0207693_10015987 3300025915 Bacteria 6006
70 Ga0207663_10007184 3300025916 Bacteria 5761
71 Ga0207657_10065593 3300025919 Bacteria 3094
72 Ga0207687_10060304 3300025927 Bacteria 2676
73 Ga0207700_10000211 3300025928 Bacteria 34862
74 Ga0207700_10041972 3300025928 Bacteria 3351
75 Ga0207664_10000122 3300025929 Bacteria 68140
76 Ga0207690_10134557 3300025932 Bacteria 1813
77 Ga0207665_10000052 3300025939 Bacteria 74914
78 Ga0207676_10208225 3300026095 Bacteria 1733
79 Ga0209813_10004969 3300027866 Bacteria 3208
80 Ga0209813_10012981 3300027866 Bacteria 2214
81 Ga0268266_10093520 3300028379 Bacteria 2638
82 Ga0307517_10002797 3300028786 Bacteria 27710
83 Ga0307517_10006621 3300028786 Bacteria 17080
84 Ga0307515_10000163 3300028794 Bacteria 163159
85 Ga0265338_10002448 3300028800 Bacteria 27838
86 Ga0268256_1024203 3300030500 Bacteria 1562
87 Ga0307511_10062132 3300030521 Bacteria 2839
88 Ga0307511_10153258 3300030521 Bacteria 1316
89 Ga0307512_10017802 3300030522 Bacteria 6505
90 Ga0307512_10057152 3300030522 Bacteria 3054
91 Ga0307512_10114875 3300030522 Bacteria 1755
92 Ga0316182_1126919 3300030745 Bacteria 5292
93 Ga0265340_10000654 3300031247 Bacteria 19489
94 Ga0307513_10014126 3300031456 Bacteria 9772
95 Ga0307513_10249978 3300031456 Bacteria 1570
96 Ga0307509_10034688 3300031507 Bacteria 5542
97 Ga0307509_10164832 3300031507 Bacteria 2107
98 Ga0307508_10000474 3300031616 Bacteria 48456
99 Ga0307508_10030951 3300031616 Bacteria 4837
100 Ga0307508_10047607 3300031616 Bacteria 3822
101 Ga0307508_10051123 3300031616 Bacteria 3674
102 Ga0307508_10139087 3300031616 Bacteria 2031
103 Ga0307508_10196778 3300031616 Bacteria 1617
104 Ga0307514_10053730 3300031649 Bacteria 3106
105 Ga0307514_10071701 3300031649 Bacteria 2597
106 Ga0307514_10083496 3300031649 Bacteria 2354
107 Ga0307516_10001998 3300031730 Bacteria 27892
108 Ga0307516_10046827 3300031730 Bacteria 4265
109 Ga0307516_10178412 3300031730 Bacteria 1859
110 Ga0307413_10010614 3300031824 Bacteria 4481
111 Ga0307410_10159407 3300031852 Bacteria 1689
112 Ga0307409_100195121 3300031995 Bacteria 1806
113 Ga0307409_100392595 3300031995 Bacteria 1323
114 Ga0307416_100158725 3300032002 Bacteria 2087
115 Ga0307414_10313856 3300032004 Bacteria 1332
116 Ga0307415_100043704 3300032126 Bacteria 2991
117 Ga0307507_10009361 3300033179 Bacteria 13101
118 Ga0307507_10083046 3300033179 Bacteria 2803
119 Ga0307510_10006919 3300033180 Bacteria 13521
120 Ga0307510_10034590 3300033180 Bacteria 5656
121 Ga0307510_10063579 3300033180 Bacteria 3757
122 Ga0307510_10074950 3300033180 Bacteria 3338
123 Ga0395900_0066991 3300037418 Bacteria 3690
124 Ga0395898_0056730 3300037466 Bacteria 3817
125 Ga0395905_0298683 3300037471 Bacteria 1498
126 Ga0436364_0522851 3300037853 Bacteria 6744
127 Ga0436365_1741043 3300039437 Bacteria 6407
128 Ga0439436_0004737 3300041404 Bacteria 4171
129 Ga0439465_0034524 3300041413 Bacteria 1619
130 Ga0451793_0732384 3300041452 Bacteria 2976
131 Ga0451802_0087841 3300041460 Bacteria 1434
132 Ga0451837_1095234 3300041494 Bacteria 3157
133 Ga0451839_1599196 3300041496 Bacteria 2870
134 Ga0451853_0343452 3300041512 Bacteria 4909
135 Ga0439449_0002071 3300042007 Bacteria 7893
136 Ga0439449_0026541 3300042007 Bacteria 2161
137 Ga0439455_0000237 3300042012 Bacteria 6606
138 Ga0439457_000969 3300042014 Bacteria 8630
139 Ga0439457_002309 3300042014 Bacteria 5482
140 Ga0450894_000038 3300042131 Bacteria 19456
141 Ga0450895_002896 3300042132 Bacteria 1305
142 Ga0450898_000548 3300042134 Bacteria 4425
143 Ga0450903_000451 3300042138 Bacteria 8711
144 Ga0450906_002256 3300042145 Bacteria 4223
145 Ga0439458_0002488 3300042157 Bacteria 4479
146 Ga0450908_007083 3300042184 Bacteria 2119
147 Ga0466972_0002676 3300044658 Bacteria 8816
148 Ga0466972_0110299 3300044658 Bacteria 1300
149 Ga0466966_0001725 3300044684 Bacteria 14136
150 Ga0466961_0003148 3300044693 Bacteria 10278
151 Ga0466961_0045186 3300044693 Bacteria 2818
152 Ga0466961_0245009 3300044693 Bacteria 1101
153 Ga0466963_0001169 3300044694 Bacteria 13766
154 Ga0466971_0011103 3300044719 Bacteria 3943
155 Ga0466971_0068967 3300044719 Bacteria 1604
156 Ga0466970_0004932 3300044765 Bacteria 6591
157 Ga0466970_0076737 3300044765 Bacteria 1801
158 Ga0466957_0001956 3300044842 Bacteria 10950
159 Ga0466960_0002512 3300044901 Bacteria 6893
160 Ga0466959_0001360 3300045049 Bacteria 14928
161 Ga0466959_0104790 3300045049 Bacteria 2023
162 Ga0466958_0022244 3300045836 Bacteria 3712
163 Ga0466967_0013562 3300045976 Bacteria 6304
164 Ga0466967_0125086 3300045976 Bacteria 2381
165 Ga0495627_015851 3300046453 Bacteria 2594
166 Ga0495592_0018589 3300046454 Bacteria 5289
167 Ga0495603_0001394 3300046455 Bacteria 14051
168 Ga0495603_0003201 3300046455 Bacteria 9747
169 Ga0495603_0027159 3300046455 Bacteria 3455
170 Ga0495603_0027331 3300046455 Bacteria 3444
171 Ga0495603_0186647 3300046455 Bacteria 1199
172 Ga0495629_0000569 3300046459 Bacteria 29932
173 Ga0495629_0001642 3300046459 Bacteria 17563
174 Ga0495629_0002509 3300046459 Bacteria 14093
175 Ga0495629_0025456 3300046459 Bacteria 4204
176 Ga0495629_0049666 3300046459 Bacteria 2940
177 Ga0495629_0150828 3300046459 Bacteria 1615
178 Ga0495638_0014161 3300046460 Bacteria 5400
179 Ga0495638_0053504 3300046460 Bacteria 2512
180 Ga0495638_0133027 3300046460 Bacteria 1459
181 Ga0495651_0012818 3300046462 Bacteria 6473
182 Ga0495651_0012847 3300046462 Bacteria 6469
183 Ga0495580_0155381 3300046472 Bacteria 1584
184 Ga0495605_0004582 3300046474 Bacteria 8093
185 Ga0495639_0007371 3300046475 Bacteria 4723
186 Ga0495662_0000829 3300046476 Bacteria 15015
187 Ga0495662_0002108 3300046476 Bacteria 9973
188 Ga0495662_0004435 3300046476 Bacteria 7045
189 Ga0495664_0000193 3300046477 Bacteria 29822
190 Ga0495664_0057976 3300046477 Bacteria 2304
191 Ga0495585_0005242 3300046492 Bacteria 8211
192 Ga0495585_0035215 3300046492 Bacteria 2831
193 Ga0495585_0090424 3300046492 Bacteria 1649
194 Ga0495585_0092349 3300046492 Bacteria 1629
195 Ga0495594_0000308 3300046499 Bacteria 24034
196 Ga0495596_0023026 3300046500 Bacteria 2530
197 Ga0495583_0058378 3300046506 Bacteria 1732
198 Ga0495606_0176239 3300046507 Bacteria 1236
199 Ga0495620_0001845 3300046515 Bacteria 12477
200 Ga0495628_0007647 3300046516 Bacteria 9342
201 Ga0495628_0265371 3300046516 Bacteria 1278
202 Ga0495630_0185172 3300046517 Bacteria 1588
203 Ga0495630_0232762 3300046517 Bacteria 1408
204 Ga0495631_0009395 3300046518 Bacteria 4885
205 Ga0495643_0004222 3300046522 Bacteria 10170
206 Ga0495643_0008362 3300046522 Bacteria 6558
207 Ga0495648_0155832 3300046524 Bacteria 1186
208 Ga0495666_0072316 3300046526 Bacteria 1638
209 Ga0495652_0036170 3300046529 Bacteria 4295
210 Ga0495640_0015539 3300046533 Bacteria 5725
211 Ga0495640_0067890 3300046533 Bacteria 2401
212 Ga0495587_0002003 3300046536 Bacteria 13587
213 Ga0495645_0001357 3300046543 Bacteria 16555
214 Ga0495645_0111072 3300046543 Bacteria 1939
215 Ga0495622_0002125 3300046557 Bacteria 9657
216 Ga0495622_0044457 3300046557 Bacteria 2064
217 Ga0495667_0068459 3300046559 Bacteria 2318
218 Ga0495656_0001749 3300046615 Bacteria 7118
219 Ga0495634_0066353 3300046642 Bacteria 2389
220 Ga0495611_0028204 3300046648 Bacteria 2457
221 Ga0495625_0072057 3300046660 Bacteria 2423
222 Ga0495625_0095478 3300046660 Bacteria 2049
223 Ga0495635_0002126 3300046663 Bacteria 13437
224 Ga0495588_0030551 3300046674 Bacteria 2708
225 Ga0495657_0005988 3300046675 Bacteria 9545
226 Ga0495657_0020659 3300046675 Bacteria 4733
227 Ga0495657_0079446 3300046675 Bacteria 2124
228 Ga0495599_0211104 3300046678 Bacteria 1190
229 Ga0495623_0131042 3300046679 Bacteria 1501
230 Ga0495646_0004676 3300046680 Bacteria 8620
231 Ga0495658_0070647 3300046683 Bacteria 2026
232 Ga0495613_0003052 3300046689 Bacteria 12512
233 Ga0495613_0003772 3300046689 Bacteria 11356
234 Ga0495613_0013677 3300046689 Bacteria 6021
235 Ga0495613_0043574 3300046689 Bacteria 3319
236 Ga0495613_0133065 3300046689 Bacteria 1780
237 Ga0495624_0036521 3300046690 Bacteria 3166
238 Ga0495624_0041849 3300046690 Bacteria 2929
239 Ga0495670_0011762 3300046691 Bacteria 4308
240 Ga0495589_0010053 3300046794 Bacteria 4917
241 Ga0495600_0004914 3300046809 Bacteria 8026
242 Ga0495604_0000936 3300047317 Bacteria 24300
243 Ga0495604_0023903 3300047317 Bacteria 4877
244 Ga0495604_0057792 3300047317 Bacteria 2981
245 Ga0495604_0231995 3300047317 Bacteria 1265
246 Ga0495636_0112796 3300047318 Bacteria 1197
247 Ga0495676_0001124 3300047321 Bacteria 22693
248 Ga0495676_0013472 3300047321 Bacteria 7349
249 Ga0495676_0020680 3300047321 Bacteria 5767
250 Ga0495676_0061776 3300047321 Bacteria 2928
251 Ga0495676_0073409 3300047321 Bacteria 2623
252 Ga0495683_0100640 3300047323 Bacteria 1390
253 Ga0495687_003929 3300047443 Bacteria 10412
254 Ga0495687_066011 3300047443 Bacteria 1471
255 Ga0495675_0064904 3300047444 Bacteria 2309
256 Ga0495675_0077625 3300047444 Bacteria 2092
257 Ga0495677_0073536 3300047445 Bacteria 1275
258 Ga0495685_003324 3300047447 Bacteria 5117
259 Ga0495685_011197 3300047447 Bacteria 3022
260 Ga0495685_063244 3300047447 Bacteria 1245
261 Ga0495685_072749 3300047447 Bacteria 1150
262 Ga0495673_0084602 3300047469 Bacteria 1307
263 Ga0495681_0019414 3300047470 Bacteria 3712
264 Ga0495686_0008854 3300047472 Bacteria 7327
265 Ga0495593_0000622 3300047673 Bacteria 20247
266 Ga0495602_0037560 3300048088 Bacteria 4492
267 Ga0495614_0001665 3300048089 Bacteria 9688
268 Ga0496106_0292223 3300048909 Bacteria 1306
269 Ga0496108_0150653 3300048911 Bacteria 2007
270 Ga0496108_0185050 3300048911 Bacteria 1804
271 Ga0496109_0007532 3300048912 Bacteria 9225
272 Ga0496110_0152902 3300048913 Bacteria 2090
273 Ga0496110_0226658 3300048913 Bacteria 1699
274 Ga0496121_0000025 3300048924 Bacteria 453467
275 Ga0496121_0082225 3300048924 Bacteria 2547
276 Ga0496123_0031380 3300048926 Bacteria 3868
277 Ga0496124_0075090 3300048927 Bacteria 2793
278 Ga0501031_0004986 3300049568 Bacteria 8633
279 Ga0501031_0019502 3300049568 Bacteria 4418
280 Ga0501031_0054594 3300049568 Bacteria 2603
281 Ga0501032_0004766 3300049569 Bacteria 10167
282 Ga0501032_0021800 3300049569 Bacteria 4449
283 Ga0501032_0141353 3300049569 Bacteria 1585
284 Ga0501032_0188778 3300049569 Bacteria 1347
285 Ga0501033_0023472 3300049570 Bacteria 4651
286 Ga0501033_0024747 3300049570 Bacteria 4527
287 Ga0501033_0036020 3300049570 Bacteria 3709
288 Ga0501034_0002524 3300049571 Bacteria 21942
289 Ga0501034_0011325 3300049571 Bacteria 9252
290 Ga0501034_0249468 3300049571 Bacteria 1720
291 Ga0501036_0009818 3300049572 Bacteria 7881
292 Ga0501036_0290235 3300049572 Bacteria 1369
293 Ga0501037_0023028 3300049573 Bacteria 4606
294 Ga0501038_0014347 3300049574 Bacteria 7220
295 Ga0501038_0163760 3300049574 Bacteria 1805
296 Ga0501039_0002741 3300049575 Bacteria 13131
297 Ga0501041_0188242 3300049577 Bacteria 1293
298 Ga0501042_0214967 3300049578 Bacteria 1387
299 Ga0501043_0000335 3300049579 Bacteria 42702
300 Ga0501043_0002686 3300049579 Bacteria 14905
301 Ga0501043_0040496 3300049579 Bacteria 3662
302 Ga0501046_0038537 3300049580 Bacteria 3834
303 Ga0501046_0073709 3300049580 Bacteria 2649
304 Ga0501046_0085076 3300049580 Bacteria 2438
305 Ga0501046_0119229 3300049580 Bacteria 2009
306 Ga0501047_0001991 3300049581 Bacteria 19603
307 Ga0501047_0016359 3300049581 Bacteria 7079
308 Ga0501047_0215687 3300049581 Bacteria 1776
309 Ga0501047_0415983 3300049581 Bacteria 1176
310 Ga0501048_0009711 3300049582 Bacteria 7219
311 Ga0501068_0232328 3300049584 Bacteria 1173
312 Ga0501070_0005270 3300049586 Bacteria 11027
313 Ga0501070_0112585 3300049586 Bacteria 2249
314 Ga0501070_0120009 3300049586 Bacteria 2173
315 Ga0501070_0253074 3300049586 Bacteria 1440
316 Ga0501070_0306588 3300049586 Bacteria 1293
317 Ga0501072_0083318 3300049588 Bacteria 2535
318 Ga0501035_0010440 3300049822 Bacteria 8608
319 Ga0501035_0013378 3300049822 Bacteria 7575
320 Ga0501035_0055321 3300049822 Bacteria 3543
321 Ga0501044_0005880 3300049823 Bacteria 13591
322 Ga0501044_0008291 3300049823 Bacteria 11392
323 Ga0501044_0019105 3300049823 Bacteria 7336
324 Ga0501044_0027231 3300049823 Bacteria 6043
325 Ga0501044_0108466 3300049823 Bacteria 2786
326 Ga0501044_0142179 3300049823 Bacteria 2388
327 Ga0501044_0175116 3300049823 Bacteria 2115
328 Ga0501045_0151790 3300049824 Bacteria 1724
329 nmdc:mga00v17_1601_c1 3300050491 Bacteria 11824
330 nmdc:mga06z11_3180_c1 3300050494 Bacteria 6339
331 nmdc:mga04h51_1943_c1 3300050495 Bacteria 4816
332 nmdc:mga04h51_9327_c1 3300050495 Bacteria 2213
333 nmdc:mga07m45_29496_c1 3300050496 Bacteria 3034
334 nmdc:mga07m45_48087_c1 3300050496 Bacteria 2398
335 nmdc:mga0qj67_136915_c1 3300050509 Bacteria 1984
336 nmdc:mga08y16_177400_c1 3300050511 Bacteria 2212
337 Ga0495655_0016800 3300053083 Bacteria 1583
338 Ga0500578_0023508 3300053086 Bacteria 3957
339 Ga0500566_0166187 3300053094 Bacteria 1145
340 Ga0500641_0005550 3300053096 Bacteria 4467
341 Ga0500560_000923 3300053107 Bacteria 4636
342 Ga0500560_005343 3300053107 Bacteria 2835
343 Ga0500560_065436 3300053107 Bacteria 1191
344 Ga0500569_006192 3300053109 Bacteria 2615
345 Ga0500652_013714 3300053131 Bacteria 2878
346 Ga0500561_0002451 3300053137 Bacteria 3127
347 Ga0500573_0010921 3300053140 Bacteria 5075
348 Ga0500573_0021168 3300053140 Bacteria 3725
349 Ga0500573_0058058 3300053140 Bacteria 2219
350 Ga0500579_048200 3300053143 Bacteria 2624
351 Ga0500600_0015383 3300053149 Bacteria 4642
352 Ga0500616_0000217 3300053153 Bacteria 90189
353 Ga0500616_0009786 3300053153 Bacteria 5784
354 Ga0500633_0008632 3300053160 Bacteria 2638
355 Ga0500634_0083835 3300053161 Bacteria 1635
356 Ga0500656_000184 3300053732 Bacteria 4084
357 Ga0500587_002956 3300053739 Bacteria 2406
358 Ga0501082_0254207 3300060353 Bacteria 1529
359 Ga0466962_0004268 3300061719 Bacteria 6847
360 Ga0466962_0024611 3300061719 Bacteria 2891
361 2547412122 2547132111 Bacteria 8013147
362 2554260801 2554235005 Bacteria 6457341
363 2585302376 2582581312 Bacteria 7308206
364 2585312003 2582581314 Bacteria 11452267
365 2616699026 2616644814 Bacteria 11555299
366 2616901315 2616644941 Bacteria 8510691
367 2643946157 2643221587 Bacteria 7586415
368 2644016950 2643221601 Bacteria 7493239
369 2644033460 2643221604 Bacteria 5014917
370 2644101533 2643221617 Bacteria 5139111
371 2644118782 2643221620 Bacteria 5134593
372 2644263778 2643221647 Bacteria 10741251
373 2644387928 2643221670 Bacteria 6497041
374 2644432946 2643221677 Bacteria 7584031
375 2644438112 2643221678 Bacteria 9540101
376 2644457267 2643221681 Bacteria 3707866
377 2644488472 2643221687 Bacteria 6500351
378 2644631888 2643221714 Bacteria 9015452
379 2645719524 2643221961 Bacteria 3919167
380 2645726430 2643221962 Bacteria 3874254
381 2738869362 2738541305 Bacteria 4910150
382 2739239967 2738543011 Bacteria 5731169
383 2784591878 2784132148 Bacteria 8627943
384 2785373093 2784746768 Bacteria 10036182
385 2786674944 2786546132 Bacteria 10419719
386 2791911524 2791354901 Bacteria 8322202
387 2793977988 2791355406 Bacteria 11364898
388 2808845243 2808606359 Bacteria 9866990
389 2808914949 2808606375 Bacteria 9466072
390 2809235490 2808606448 Bacteria 8656184
391 2811843353 2808606982 Bacteria 7791042
392 2812334243 2811994874 Bacteria 5367947
393 2812477436 2811994917 Bacteria 7761064
394 2819744071 2818991472 Bacteria 10089953
395 2842892303 2842888712 Bacteria 4279094
396 2852636085 2852635781 Bacteria 8251373
397 2862184257 2862178590 Bacteria 8583590
398 2862283142 2862281513 Bacteria 9621493
399 2862293972 2862290372 Bacteria 7471434
400 2862385582 2862382967 Bacteria 10317375
401 2862576278 2862574272 Bacteria 10567477
402 2863410181 2863404153 Bacteria 9672205
403 2867348311 2867346516 Bacteria 7608576
404 2867434628 2867428634 Bacteria 9590268
405 2868094678 2868088558 Bacteria 7609351
406 2873152708 2873151551 Bacteria 8625867
407 2877677803 2877676314 Bacteria 9512378
408 2889304779 2889300758 Bacteria 5690814
409 2902795377 2902792274 Bacteria 7270173
410 2902842797 2902837492 Bacteria 6697721
411 2912716084 2912715099 Bacteria 9460473
412 2912729034 2912723979 Bacteria 8557534
413 2918507614 2918501144 Bacteria 8668083
414 2919470963 2919468124 Bacteria 9133025
415 2935392900 2935390628 Bacteria 7043367
416 2946071237 2946064051 Bacteria 8957905
417 2946079080 2946072368 Bacteria 8999607
418 2947225506 2947224130 Bacteria 9938529
419 2954009710 2954002825 Bacteria 9173742
420 2954382592 2954380949 Bacteria 10050426
421 2954680458 2954673503 Bacteria 9685905
422 2954683694 2954682443 Bacteria 9862841
423 2954693384 2954691527 Bacteria 10720516
424 2954708479 2954701450 Bacteria 10834262
425 2954713088 2954711539 Bacteria 10867210
426 2954723048 2954721474 Bacteria 10456478
427 2954738781 2954731030 Bacteria 10243860
428 2954741955 2954740390 Bacteria 10229294
429 2954757639 2954749733 Bacteria 10366972
430 2954760932 2954759201 Bacteria 9358192
431 2990046776 2990044586 Bacteria 6603797
432 2990065537 2990059506 Bacteria 9321252
433 2990093761 2990088156 Bacteria 6657676
434 2997453491 2997451912 Bacteria 8492419
435 3006327715 3006321560 Bacteria 8247479
436 3006396631 3006393351 Bacteria 6615579
437 3006493121 3006486233 Bacteria 8157040
438 3006501760 3006493962 Bacteria 8825450
439 8008564177 8008558824 Bacteria 10610750
440 8008575939 8008574985 Bacteria 7815457
441 8023624135 8023623736 Bacteria 8593882
442 8025485777 8025478263 Bacteria 8209203
443 8025533358 8025530807 Bacteria 8495698
444 8033687182 8033684223 Bacteria 6906479
445 8047894418 8047893842 Bacteria 11723082
446 8048364634 8048356638 Bacteria 11044339
447 8048371435 8048369669 Bacteria 11666822
448 8048380236 8048379754 Bacteria 11877923
449 8048409696 8048406513 Bacteria 8936924
450 8054165405 8054160619 Bacteria 7783213
451 8056450010 8056447290 Bacteria 7680491
452 8056669731 8056667051 Bacteria 6953971
453 8056836033 8056829672 Bacteria 9045328
454 Ga0209758_1002382
455 rootH2_10042994
456 rootH1_10028448
457 Ga0055540_1005049
458 Ga0055540_1007358
459 Ga0055540_1007777
460 Ga0070683_100169959
461 Ga0070660_100007504
462 Ga0070659_100169106
463 Ga0070709_10003236
464 Ga0070714_100015450
465 Ga0070714_100059765
466 Ga0070713_100002507
467 Ga0070713_100046466
468 Ga0070710_10001815
469 Ga0070711_100002113
470 Ga0070700_100212879
471 Ga0070706_100008714
472 Ga0070698_100000596
473 Ga0070696_100016719
474 Ga0070665_100119950
475 Ga0068855_100040159
476 Ga0068858_100034964
477 Ga0081455_10000061
478 Ga0081455_10095002
479 Ga0081455_10107714
480 Ga0070717_10003007
481 Ga0070717_10034019
482 Ga0075365_10002450
483 Ga0075365_10002577
484 Ga0075365_10019085
485 Ga0075365_10105622
486 Ga0075368_10001301
487 Ga0075368_10016855
488 Ga0075363_100002340
489 Ga0075363_100023376
490 Ga0075364_10001422
491 Ga0070716_100000387
492 Ga0075367_10016202
493 Ga0075370_10087714
494 Ga0068865_100224193
495 Ga0099826_10072901
496 Ga0105245_10044163
497 Ga0105249_10225244
498 Ga0105239_10003727
499 Ga0105239_10067832
500 Ga0163162_10428484
501 Ga0157372_10502787
502 Ga0157375_10124552
503 Ga0182008_10000702
504 Ga0182007_10000377
505 Ga0182005_1021454
506 Ga0183367_1001
507 Ga0213876_10009990
508 Ga0213876_10048162
509 Ga0213875_10010444
510 Ga0207426_1000707
511 Ga0207426_1030624
512 Ga0209051_1000750
513 Ga0209051_1004754
514 Ga0209051_1006532
515 Ga0209051_1007498
516 Ga0207688_10105660
517 Ga0207647_10038754
518 Ga0207647_10042262
519 Ga0207699_10006752
520 Ga0207699_10209989
521 Ga0207684_10137941
522 Ga0207693_10015987
523 Ga0207663_10007184
524 Ga0207657_10065593
525 Ga0207687_10060304
526 Ga0207700_10000211
527 Ga0207700_10041972
528 Ga0207664_10000122
529 Ga0207690_10134557
530 Ga0207665_10000052
531 Ga0207676_10208225
532 Ga0209813_10004969
533 Ga0209813_10012981
534 Ga0268266_10093520
535 Ga0307517_10002797
536 Ga0307517_10006621
537 Ga0307515_10000163
538 Ga0265338_10002448
539 Ga0268256_1024203
540 Ga0307511_10062132
541 Ga0307511_10153258
542 Ga0307512_10017802
543 Ga0307512_10057152
544 Ga0307512_10114875
545 Ga0316182_1126919
546 Ga0265340_10000654
547 Ga0307513_10014126
548 Ga0307513_10249978
549 Ga0307509_10034688
550 Ga0307509_10164832
551 Ga0307508_10000474
552 Ga0307508_10030951
553 Ga0307508_10047607
554 Ga0307508_10051123
555 Ga0307508_10139087
556 Ga0307508_10196778
557 Ga0307514_10053730
558 Ga0307514_10071701
559 Ga0307514_10083496
560 Ga0307516_10001998
561 Ga0307516_10046827
562 Ga0307516_10178412
563 Ga0307413_10010614
564 Ga0307410_10159407
565 Ga0307409_100195121
566 Ga0307409_100392595
567 Ga0307416_100158725
568 Ga0307414_10313856
569 Ga0307415_100043704
570 Ga0307507_10009361
571 Ga0307507_10083046
572 Ga0307510_10006919
573 Ga0307510_10034590
574 Ga0307510_10063579
575 Ga0307510_10074950
576 Ga0395900_0066991
577 Ga0395898_0056730
578 Ga0395905_0298683
579 Ga0436364_0522851
580 Ga0436365_1741043
581 Ga0439436_0004737
582 Ga0439465_0034524
583 Ga0451793_0732384
584 Ga0451802_0087841
585 Ga0451837_1095234
586 Ga0451839_1599196
587 Ga0451853_0343452
588 Ga0439449_0002071
589 Ga0439449_0026541
590 Ga0439455_0000237
591 Ga0439457_000969
592 Ga0439457_002309
593 Ga0450894_000038
594 Ga0450895_002896
595 Ga0450898_000548
596 Ga0450903_000451
597 Ga0450906_002256
598 Ga0439458_0002488
599 Ga0450908_007083
600 Ga0466972_0002676
601 Ga0466972_0110299
602 Ga0466966_0001725
603 Ga0466961_0003148
604 Ga0466961_0045186
605 Ga0466961_0245009
606 Ga0466963_0001169
607 Ga0466971_0011103
608 Ga0466971_0068967
609 Ga0466970_0004932
610 Ga0466970_0076737
611 Ga0466957_0001956
612 Ga0466960_0002512
613 Ga0466959_0001360
614 Ga0466959_0104790
615 Ga0466958_0022244
616 Ga0466967_0013562
617 Ga0466967_0125086
618 Ga0495627_015851
619 Ga0495592_0018589
620 Ga0495603_0001394
621 Ga0495603_0003201
622 Ga0495603_0027159
623 Ga0495603_0027331
624 Ga0495603_0186647
625 Ga0495629_0000569
626 Ga0495629_0001642
627 Ga0495629_0002509
628 Ga0495629_0025456
629 Ga0495629_0049666
630 Ga0495629_0150828
631 Ga0495638_0014161
632 Ga0495638_0053504
633 Ga0495638_0133027
634 Ga0495651_0012818
635 Ga0495651_0012847
636 Ga0495580_0155381
637 Ga0495605_0004582
638 Ga0495639_0007371
639 Ga0495662_0000829
640 Ga0495662_0002108
641 Ga0495662_0004435
642 Ga0495664_0000193
643 Ga0495664_0057976
644 Ga0495585_0005242
645 Ga0495585_0035215
646 Ga0495585_0090424
647 Ga0495585_0092349
648 Ga0495594_0000308
649 Ga0495596_0023026
650 Ga0495583_0058378
651 Ga0495606_0176239
652 Ga0495620_0001845
653 Ga0495628_0007647
654 Ga0495628_0265371
655 Ga0495630_0185172
656 Ga0495630_0232762
657 Ga0495631_0009395
658 Ga0495643_0004222
659 Ga0495643_0008362
660 Ga0495648_0155832
661 Ga0495666_0072316
662 Ga0495652_0036170
663 Ga0495640_0015539
664 Ga0495640_0067890
665 Ga0495587_0002003
666 Ga0495645_0001357
667 Ga0495645_0111072
668 Ga0495622_0002125
669 Ga0495622_0044457
670 Ga0495667_0068459
671 Ga0495656_0001749
672 Ga0495634_0066353
673 Ga0495611_0028204
674 Ga0495625_0072057
675 Ga0495625_0095478
676 Ga0495635_0002126
677 Ga0495588_0030551
678 Ga0495657_0005988
679 Ga0495657_0020659
680 Ga0495657_0079446
681 Ga0495599_0211104
682 Ga0495623_0131042
683 Ga0495646_0004676
684 Ga0495658_0070647
685 Ga0495613_0003052
686 Ga0495613_0003772
687 Ga0495613_0013677
688 Ga0495613_0043574
689 Ga0495613_0133065
690 Ga0495624_0036521
691 Ga0495624_0041849
692 Ga0495670_0011762
693 Ga0495589_0010053
694 Ga0495600_0004914
695 Ga0495604_0000936
696 Ga0495604_0023903
697 Ga0495604_0057792
698 Ga0495604_0231995
699 Ga0495636_0112796
700 Ga0495676_0001124
701 Ga0495676_0013472
702 Ga0495676_0020680
703 Ga0495676_0061776
704 Ga0495676_0073409
705 Ga0495683_0100640
706 Ga0495687_003929
707 Ga0495687_066011
708 Ga0495675_0064904
709 Ga0495675_0077625
710 Ga0495677_0073536
711 Ga0495685_003324
712 Ga0495685_011197
713 Ga0495685_063244
714 Ga0495685_072749
715 Ga0495673_0084602
716 Ga0495681_0019414
717 Ga0495686_0008854
718 Ga0495593_0000622
719 Ga0495602_0037560
720 Ga0495614_0001665
721 Ga0496106_0292223
722 Ga0496108_0150653
723 Ga0496108_0185050
724 Ga0496109_0007532
725 Ga0496110_0152902
726 Ga0496110_0226658
727 Ga0496121_0000025
728 Ga0496121_0082225
729 Ga0496123_0031380
730 Ga0496124_0075090
731 Ga0501031_0004986
732 Ga0501031_0019502
733 Ga0501031_0054594
734 Ga0501032_0004766
735 Ga0501032_0021800
736 Ga0501032_0141353
737 Ga0501032_0188778
738 Ga0501033_0023472
739 Ga0501033_0024747
740 Ga0501033_0036020
741 Ga0501034_0002524
742 Ga0501034_0011325
743 Ga0501034_0249468
744 Ga0501036_0009818
745 Ga0501036_0290235
746 Ga0501037_0023028
747 Ga0501038_0014347
748 Ga0501038_0163760
749 Ga0501039_0002741
750 Ga0501041_0188242
751 Ga0501042_0214967
752 Ga0501043_0000335
753 Ga0501043_0002686
754 Ga0501043_0040496
755 Ga0501046_0038537
756 Ga0501046_0073709
757 Ga0501046_0085076
758 Ga0501046_0119229
759 Ga0501047_0001991
760 Ga0501047_0016359
761 Ga0501047_0215687
762 Ga0501047_0415983
763 Ga0501048_0009711
764 Ga0501068_0232328
765 Ga0501070_0005270
766 Ga0501070_0112585
767 Ga0501070_0120009
768 Ga0501070_0253074
769 Ga0501070_0306588
770 Ga0501072_0083318
771 Ga0501035_0010440
772 Ga0501035_0013378
773 Ga0501035_0055321
774 Ga0501044_0005880
775 Ga0501044_0008291
776 Ga0501044_0019105
777 Ga0501044_0027231
778 Ga0501044_0108466
779 Ga0501044_0142179
780 Ga0501044_0175116
781 Ga0501045_0151790
782 nmdc:mga00v17_1601_c1
783 nmdc:mga06z11_3180_c1
784 nmdc:mga04h51_1943_c1
785 nmdc:mga04h51_9327_c1
786 nmdc:mga07m45_29496_c1
787 nmdc:mga07m45_48087_c1
788 nmdc:mga0qj67_136915_c1
789 nmdc:mga08y16_177400_c1
790 Ga0495655_0016800
791 Ga0500578_0023508
792 Ga0500566_0166187
793 Ga0500641_0005550
794 Ga0500560_000923
795 Ga0500560_005343
796 Ga0500560_065436
797 Ga0500569_006192
798 Ga0500652_013714
799 Ga0500561_0002451
800 Ga0500573_0010921
801 Ga0500573_0021168
802 Ga0500573_0058058
803 Ga0500579_048200
804 Ga0500600_0015383
805 Ga0500616_0000217
806 Ga0500616_0009786
807 Ga0500633_0008632
808 Ga0500634_0083835
809 Ga0500656_000184
810 Ga0500587_002956
811 Ga0501082_0254207
812 Ga0466962_0004268
813 Ga0466962_0024611
814 2547412122
815 2554260801
816 2585302376
817 2585312003
818 2616699026
819 2616901315
820 2643946157
821 2644016950
822 2644033460
823 2644101533
824 2644118782
825 2644263778
826 2644387928
827 2644432946
828 2644438112
829 2644457267
830 2644488472
831 2644631888
832 2645719524
833 2645726430
834 2738869362
835 2739239967
836 2784591878
837 2785373093
838 2786674944
839 2791911524
840 2793977988
841 2808845243
842 2808914949
843 2809235490
844 2811843353
845 2812334243
846 2812477436
847 2819744071
848 2842892303
849 2852636085
850 2862184257
851 2862283142
852 2862293972
853 2862385582
854 2862576278
855 2863410181
856 2867348311
857 2867434628
858 2868094678
859 2873152708
860 2877677803
861 2889304779
862 2902795377
863 2902842797
864 2912716084
865 2912729034
866 2918507614
867 2919470963
868 2935392900
869 2946071237
870 2946079080
871 2947225506
872 2954009710
873 2954382592
874 2954680458
875 2954683694
876 2954693384
877 2954708479
878 2954713088
879 2954723048
880 2954738781
881 2954741955
882 2954757639
883 2954760932
884 2990046776
885 2990065537
886 2990093761
887 2997453491
888 3006327715
889 3006396631
890 3006493121
891 3006501760
892 8008564177
893 8008575939
894 8023624135
895 8025485777
896 8025533358
897 8033687182
898 8047894418
899 8048364634
900 8048371435
901 8048380236
902 8048409696
903 8054165405
904 8056450010
905 8056669731
906 8056836033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01896

DNA_primase_S

DNA primase small subunit

153

275

0.97

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

49

302

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9605 3 327
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.949 3 327
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9446 4 292
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.9281 16 283
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.8994 4 292
ID Description Score Start End Superfamily
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9799 22 299 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9702 22 299 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9594 22 299 3.90.920.10
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9533 22 299 3.90.920.10
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9444 130 261 3.30.70.3300
ID Description Score Start End GO Terms
AF-A0A6G2URU7-F1-model_v4 ATP-dependent DNA ligase 0.9952 5 253 GO:0016874
AF-A0A4D4LBK4-F1-model_v4 DNA ligase D polymerase domain-containing protein 0.9941 1 246
AF-A0A6B3CL36-F1-model_v4 ATP-dependent DNA ligase 0.9921 23 120 GO:0016874
AF-A0A6G2URU7-F1-model_v4 ATP-dependent DNA ligase 0.9912 5 253 GO:0016874
AF-A0A3D3KRH1-F1-model_v4 ATP-dependent DNA ligase 0.987 164 290 GO:0016874

Map