F447168

General Info

Members Datasets Scaffolds Average Seq Length
453 250 906 177

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100000269|Ga0075428_10000026927
Length 201
Sequence MMFSREERAPASPAATSRRFAAMIDPTAGPANRARATVLAARRPDLTGTRVGLLANVKRNAEQFLDEVGALLRREHGVAGVVRRKKLSITDPVPPDILADLVASCDVVVVGVGDCGSCSASAVADGLALEGAGIPAVVVCSDAFSVTADAMAALQGSPGYHYVQIPHPVAPLDAQDLRQRAAAALPEIVATLTAGDARAAA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
100 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
103 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
108 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
136 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
139 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
225 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
226 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
227 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
228 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
229 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
240 2643221575 Microbacterium sp. Root61 Isolate Unclassified
241 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
242 2808606372 Agromyces sp. 23-23 Isolate Unclassified
243 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
244 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
245 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
246 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
247 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
248 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
249 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
250 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 1.32
Isolates 3.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.65
Nodule 0
Rhizoplane 2.21
Rhizosphere 84.99
Stem 0
Stem Tuber 0.44
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100000269 3300006844 Bacteria 51519
2 JGI25406J46586_10022275 3300003203 Bacteria 2528
3 Ga0070658_10001361 3300005327 Bacteria 20902
4 Ga0070658_10187214 3300005327 Bacteria 1744
5 Ga0070683_100521556 3300005329 Bacteria 1135
6 Ga0070690_100937752 3300005330 Bacteria 679
7 Ga0070682_100028214 3300005337 Bacteria 3375
8 Ga0070660_100144572 3300005339 Bacteria 1909
9 Ga0070661_100531933 3300005344 Bacteria 944
10 Ga0070709_10085111 3300005434 Bacteria 2073
11 Ga0070709_10352731 3300005434 Bacteria 1087
12 Ga0070709_10511733 3300005434 Bacteria 913
13 Ga0070714_100001343 3300005435 Bacteria 17782
14 Ga0070714_100058074 3300005435 Bacteria 3313
15 Ga0070714_100141734 3300005435 Bacteria 2159
16 Ga0070714_100426111 3300005435 Bacteria 1257
17 Ga0070714_100762962 3300005435 Bacteria 935
18 Ga0070714_101535444 3300005435 Bacteria 650
19 Ga0070713_100038929 3300005436 Bacteria 3856
20 Ga0070713_100105423 3300005436 Bacteria 2449
21 Ga0070713_100106520 3300005436 Bacteria 2437
22 Ga0070713_100527405 3300005436 Bacteria 1116
23 Ga0070713_101218301 3300005436 Bacteria 729
24 Ga0070710_10002592 3300005437 Bacteria 8589
25 Ga0070710_10006252 3300005437 Bacteria 5706
26 Ga0070711_100233400 3300005439 Bacteria 1435
27 Ga0070711_100301524 3300005439 Bacteria 1274
28 Ga0070711_100423666 3300005439 Bacteria 1085
29 Ga0070705_100433796 3300005440 Unclassified 981
30 Ga0070708_100086430 3300005445 Bacteria 2848
31 Ga0070708_100133200 3300005445 Bacteria 2301
32 Ga0070708_100448233 3300005445 Bacteria 1217
33 Ga0070681_10166715 3300005458 Bacteria 2125
34 Ga0070681_10757395 3300005458 Bacteria 888
35 Ga0070681_10837506 3300005458 Bacteria 837
36 Ga0070706_100001779 3300005467 Bacteria 22320
37 Ga0070706_100008251 3300005467 Bacteria 9715
38 Ga0070706_100437128 3300005467 Bacteria 1218
39 Ga0070707_100228767 3300005468 Bacteria 1810
40 Ga0070707_100318136 3300005468 Bacteria 1512
41 Ga0070698_100022529 3300005471 Bacteria 6588
42 Ga0070698_100040465 3300005471 Bacteria 4790
43 Ga0070698_100877563 3300005471 Bacteria 842
44 Ga0070699_100067019 3300005518 Bacteria 3117
45 Ga0070699_100079566 3300005518 Bacteria 2855
46 Ga0070699_100191643 3300005518 Bacteria 1816
47 Ga0070684_100027834 3300005535 Bacteria 4774
48 Ga0070684_100450242 3300005535 Unclassified 1190
49 Ga0070697_100009174 3300005536 Bacteria 7729
50 Ga0068853_100176384 3300005539 Bacteria 1936
51 Ga0068855_100175514 3300005563 Bacteria 2425
52 Ga0070664_100286417 3300005564 Bacteria 1486
53 Ga0070664_100304891 3300005564 Bacteria 1440
54 Ga0068857_100055080 3300005577 Bacteria 3530
55 Ga0068857_100778181 3300005577 Unclassified 913
56 Ga0068856_100094890 3300005614 Bacteria 2970
57 Ga0068859_100763335 3300005617 Bacteria 1056
58 Ga0068859_100836547 3300005617 Unclassified 1007
59 Ga0068864_100086842 3300005618 Bacteria 2753
60 Ga0068864_100370365 3300005618 Bacteria 1355
61 Ga0068863_100021501 3300005841 Bacteria 6157
62 Ga0068863_100391227 3300005841 Bacteria 1358
63 Ga0068858_100343549 3300005842 Bacteria 1429
64 Ga0081539_10000032 3300005985 Bacteria 311452
65 Ga0070717_10005047 3300006028 Bacteria 9616
66 Ga0070717_10022419 3300006028 Bacteria 4989
67 Ga0070717_10177000 3300006028 Bacteria 1858
68 Ga0070717_10394330 3300006028 Bacteria 1243
69 Ga0070717_10415731 3300006028 Bacteria 1209
70 Ga0070717_10420994 3300006028 Bacteria 1201
71 Ga0070717_10873775 3300006028 Bacteria 818
72 Ga0070717_10881709 3300006028 Bacteria 814
73 Ga0075365_10011462 3300006038 Bacteria 5214
74 Ga0075365_10021026 3300006038 Bacteria 4061
75 Ga0075364_10003115 3300006051 Bacteria 9388
76 Ga0070716_100070685 3300006173 Bacteria 2050
77 Ga0070716_100091917 3300006173 Bacteria 1839
78 Ga0070716_100328394 3300006173 Bacteria 1074
79 Ga0070716_100414287 3300006173 Bacteria 972
80 Ga0070712_100162231 3300006175 Bacteria 1727
81 Ga0070712_100460428 3300006175 Bacteria 1060
82 Ga0070712_100605899 3300006175 Bacteria 927
83 Ga0075369_10001741 3300006186 Bacteria 7537
84 Ga0097621_100225664 3300006237 Bacteria 1634
85 Ga0075428_100106377 3300006844 Bacteria 3058
86 Ga0075430_100517155 3300006846 Bacteria 985
87 Ga0075431_100562799 3300006847 Bacteria 1126
88 Ga0097620_100763374 3300006931 Bacteria 1056
89 Ga0097620_100836615 3300006931 Unclassified 1007
90 Ga0111539_11159099 3300009094 Bacteria 898
91 Ga0105247_10147403 3300009101 Bacteria 1548
92 Ga0105241_10229980 3300009174 Bacteria 1563
93 Ga0105248_10281609 3300009177 Bacteria 1872
94 Ga0105237_10940306 3300009545 Bacteria 871
95 Ga0105238_10347044 3300009551 Bacteria 1473
96 Ga0105033_111253 3300009986 Bacteria 791
97 Ga0099796_10013607 3300010159 Bacteria 2328
98 Ga0157373_10804064 3300013100 Bacteria 693
99 Ga0157369_10041220 3300013105 Bacteria 5040
100 Ga0157378_11081570 3300013297 Bacteria 838
101 Ga0157372_10340401 3300013307 Bacteria 1747
102 Ga0157372_11520211 3300013307 Bacteria 771
103 Ga0157372_12350034 3300013307 Bacteria 612
104 Ga0163163_10000842 3300014325 Bacteria 26076
105 Ga0163163_10372568 3300014325 Bacteria 1485
106 Ga0163163_10538166 3300014325 Bacteria 1230
107 Ga0157377_10525627 3300014745 Bacteria 831
108 Ga0157379_10283027 3300014968 Bacteria 1509
109 Ga0206356_11737611 3300020070 Bacteria 959
110 Ga0206352_11090560 3300020078 Bacteria 854
111 Ga0206350_11250895 3300020080 Bacteria 1626
112 Ga0206354_11582996 3300020081 Bacteria 890
113 Ga0206353_10731422 3300020082 Bacteria 8918
114 Ga0213875_10001432 3300021388 Bacteria 15495
115 Ga0213875_10122252 3300021388 Bacteria 1216
116 Ga0224712_10094517 3300022467 Bacteria 1258
117 Ga0207692_10127896 3300025898 Bacteria 1431
118 Ga0207699_10050436 3300025906 Bacteria 2454
119 Ga0207705_10015846 3300025909 Bacteria 5414
120 Ga0207684_10002958 3300025910 Bacteria 16848
121 Ga0207684_10007560 3300025910 Bacteria 9771
122 Ga0207684_10011701 3300025910 Bacteria 7655
123 Ga0207684_10051266 3300025910 Bacteria 3501
124 Ga0207707_10077042 3300025912 Bacteria 2910
125 Ga0207693_10093077 3300025915 Bacteria 2362
126 Ga0207693_10094038 3300025915 Bacteria 2350
127 Ga0207693_10270302 3300025915 Bacteria 1332
128 Ga0207693_10354299 3300025915 Bacteria 1148
129 Ga0207663_10274554 3300025916 Bacteria 1250
130 Ga0207663_10589862 3300025916 Bacteria 872
131 Ga0207660_10079145 3300025917 Bacteria 2411
132 Ga0207657_10142681 3300025919 Bacteria 1956
133 Ga0207652_10098183 3300025921 Bacteria 2583
134 Ga0207652_10579005 3300025921 Bacteria 1008
135 Ga0207646_10004981 3300025922 Bacteria 14187
136 Ga0207646_10144291 3300025922 Bacteria 2145
137 Ga0207681_10179238 3300025923 Bacteria 1613
138 Ga0207694_10451202 3300025924 Bacteria 1073
139 Ga0207687_10148439 3300025927 Bacteria 1786
140 Ga0207700_10006627 3300025928 Bacteria 7018
141 Ga0207700_10034504 3300025928 Bacteria 3633
142 Ga0207700_10379294 3300025928 Bacteria 1236
143 Ga0207700_10610379 3300025928 Bacteria 971
144 Ga0207700_10659132 3300025928 Bacteria 933
145 Ga0207664_10001102 3300025929 Bacteria 17983
146 Ga0207664_10086369 3300025929 Bacteria 2563
147 Ga0207664_10090279 3300025929 Bacteria 2510
148 Ga0207664_10102677 3300025929 Bacteria 2365
149 Ga0207664_10274840 3300025929 Bacteria 1477
150 Ga0207690_10080812 3300025932 Bacteria 2269
151 Ga0207665_10016734 3300025939 Bacteria 4816
152 Ga0207665_10026945 3300025939 Bacteria 3797
153 Ga0207665_10580613 3300025939 Bacteria 874
154 Ga0207661_10009197 3300025944 Bacteria 7079
155 Ga0207679_10071981 3300025945 Bacteria 2610
156 Ga0207703_10391667 3300026035 Bacteria 1287
157 Ga0207639_10506686 3300026041 Bacteria 1103
158 Ga0207641_10310446 3300026088 Bacteria 1492
159 Ga0207676_10012551 3300026095 Bacteria 6075
160 Ga0207674_10045192 3300026116 Bacteria 4532
161 Ga0207674_10150896 3300026116 Bacteria 2281
162 Ga0207674_10465385 3300026116 Bacteria 1222
163 Ga0307405_10447574 3300031731 Bacteria 1023
164 Ga0307413_10144848 3300031824 Bacteria 1647
165 Ga0307413_11189899 3300031824 Bacteria 662
166 Ga0307410_10081494 3300031852 Bacteria 2273
167 Ga0307406_10054523 3300031901 Bacteria 2552
168 Ga0307406_10094761 3300031901 Bacteria 2019
169 Ga0307412_10060163 3300031911 Bacteria 2549
170 Ga0307412_10415845 3300031911 Bacteria 1099
171 Ga0307409_100298955 3300031995 Bacteria 1496
172 Ga0307409_100334673 3300031995 Bacteria 1422
173 Ga0307409_100426934 3300031995 Bacteria 1273
174 Ga0307416_100077574 3300032002 Bacteria 2791
175 Ga0307416_100114422 3300032002 Bacteria 2387
176 Ga0307416_100423924 3300032002 Bacteria 1376
177 Ga0307411_10020907 3300032005 Bacteria 3818
178 Ga0307415_100096413 3300032126 Bacteria 2156
179 Ga0307415_100712363 3300032126 Bacteria 907
180 Ga0373938_0055844 3300034957 Bacteria 913
181 Ga0373926_0011355 3300035083 Bacteria 2996
182 Ga0373926_0015025 3300035083 Bacteria 2636
183 Ga0373934_0013830 3300035086 Bacteria 3053
184 Ga0373944_0000357 3300035089 Bacteria 10344
185 Ga0373944_0001597 3300035089 Bacteria 5732
186 Ga0373944_0248098 3300035089 Bacteria 656
187 Ga0373923_0007168 3300035111 Bacteria 3906
188 Ga0373923_0054507 3300035111 Bacteria 1683
189 Ga0373936_0000104 3300035113 Bacteria 30738
190 Ga0373936_0000487 3300035113 Bacteria 13437
191 Ga0373936_0013277 3300035113 Bacteria 3143
192 Ga0373945_0000386 3300035116 Bacteria 12622
193 Ga0373945_0017194 3300035116 Bacteria 2447
194 Ga0373953_0001771 3300035117 Bacteria 6374
195 Ga0373953_0173525 3300035117 Bacteria 928
196 Ga0373954_0252323 3300035118 Bacteria 868
197 Ga0373956_0019774 3300035119 Bacteria 2859
198 Ga0373956_0038789 3300035119 Bacteria 2108
199 Ga0373957_0042198 3300035120 Bacteria 1720
200 Ga0373960_0074150 3300035121 Bacteria 1059
201 Ga0373943_0000563 3300035170 Bacteria 16070
202 Ga0373943_0003090 3300035170 Bacteria 7558
203 Ga0373946_0000074 3300035171 Bacteria 26775
204 Ga0373946_0002776 3300035171 Bacteria 6197
205 Ga0373955_0037061 3300035172 Bacteria 2591
206 Ga0373955_0227727 3300035172 Bacteria 1114
207 Ga0373924_0030350 3300035410 Bacteria 2166
208 Ga0373931_0218841 3300035691 Bacteria 1146
209 Ga0373935_0014551 3300035692 Bacteria 4747
210 Ga0373935_0303484 3300035692 Bacteria 1129
211 Ga0373927_0002720 3300035695 Bacteria 12901
212 Ga0373927_0009537 3300035695 Bacteria 6509
213 Ga0373927_0237562 3300035695 Bacteria 1197
214 Ga0373933_0050574 3300035724 Bacteria 2481
215 Ga0373933_0084296 3300035724 Bacteria 1953
216 Ga0373933_0147551 3300035724 Bacteria 1488
217 Ga0373947_0010592 3300035725 Bacteria 5289
218 Ga0373937_0024437 3300036401 Bacteria 5450
219 Ga0373937_0025955 3300036401 Bacteria 5291
220 Ga0373937_0133901 3300036401 Bacteria 2316
221 Ga0373925_0394875 3300037068 Bacteria 1127
222 Ga0395900_0391283 3300037418 Bacteria 1356
223 Ga0395898_0011351 3300037466 Bacteria 9256
224 Ga0436364_0330965 3300037853 Bacteria 247749
225 Ga0436364_0366872 3300037853 Bacteria 8789
226 Ga0395901_0001579 3300038443 Bacteria 23599
227 Ga0395901_0046002 3300038443 Bacteria 4531
228 Ga0436365_1410128 3300039437 Bacteria 1002
229 Ga0436362_0175762 3300039453 Bacteria 632
230 Ga0451789_1142117 3300041443 Bacteria 627
231 Ga0466965_0029591 3300044683 Bacteria 2666
232 Ga0466965_0341481 3300044683 Bacteria 819
233 Ga0466963_0062382 3300044694 Bacteria 2493
234 Ga0466963_0129084 3300044694 Bacteria 1745
235 Ga0466964_0099110 3300044706 Bacteria 1282
236 Ga0466960_0043816 3300044901 Bacteria 2131
237 Ga0466960_0064853 3300044901 Bacteria 1802
238 Ga0466958_0483359 3300045836 Bacteria 803
239 Ga0466958_0679853 3300045836 Bacteria 670
240 Ga0466967_0002186 3300045976 Bacteria 12028
241 Ga0466967_0023112 3300045976 Bacteria 5090
242 Ga0466967_0583264 3300045976 Bacteria 1102
243 Ga0466967_0584037 3300045976 Bacteria 1102
244 Ga0466967_0644747 3300045976 Bacteria 1047
245 Ga0466967_0808015 3300045976 Bacteria 931
246 Ga0495592_0410212 3300046454 Unclassified 856
247 Ga0495603_0006865 3300046455 Bacteria 6828
248 Ga0495629_0004955 3300046459 Bacteria 9987
249 Ga0495629_0282601 3300046459 Bacteria 1138
250 Ga0495641_0004232 3300046461 Bacteria 10273
251 Ga0495641_0008701 3300046461 Bacteria 6140
252 Ga0495651_0020174 3300046462 Bacteria 5173
253 Ga0495651_0195560 3300046462 Bacteria 1419
254 Ga0495651_0312935 3300046462 Bacteria 1049
255 Ga0495651_0454994 3300046462 Bacteria 826
256 Ga0495653_0010931 3300046463 Bacteria 7433
257 Ga0495653_0019413 3300046463 Bacteria 5513
258 Ga0495653_0039316 3300046463 Bacteria 3706
259 Ga0495580_0008076 3300046472 Bacteria 8397
260 Ga0495582_0020431 3300046473 Bacteria 3625
261 Ga0495639_0001815 3300046475 Bacteria 9467
262 Ga0495662_0192960 3300046476 Bacteria 1004
263 Ga0495664_0012096 3300046477 Bacteria 4881
264 Ga0495664_0674725 3300046477 Bacteria 612
265 Ga0495594_0004853 3300046499 Bacteria 6924
266 Ga0495608_0006102 3300046511 Bacteria 8550
267 Ga0495608_0043935 3300046511 Bacteria 2984
268 Ga0495608_0214465 3300046511 Bacteria 1209
269 Ga0495618_0020471 3300046514 Bacteria 4071
270 Ga0495618_0036773 3300046514 Bacteria 3073
271 Ga0495630_0117951 3300046517 Bacteria 2012
272 Ga0495630_0158773 3300046517 Bacteria 1721
273 Ga0495630_0397096 3300046517 Bacteria 1056
274 Ga0495666_0003965 3300046526 Bacteria 7485
275 Ga0495652_0040780 3300046529 Bacteria 4012
276 Ga0495652_0099406 3300046529 Bacteria 2362
277 Ga0495652_0454375 3300046529 Bacteria 896
278 Ga0495652_0475463 3300046529 Bacteria 871
279 Ga0495665_0011297 3300046531 Bacteria 4833
280 Ga0495665_0021279 3300046531 Bacteria 3484
281 Ga0495640_0095600 3300046533 Bacteria 1955
282 Ga0495640_0219530 3300046533 Bacteria 1199
283 Ga0495586_0033383 3300046535 Bacteria 2761
284 Ga0495587_0034926 3300046536 Bacteria 3030
285 Ga0495587_0096606 3300046536 Bacteria 1704
286 Ga0495587_0117151 3300046536 Bacteria 1527
287 Ga0495645_0085161 3300046543 Bacteria 2262
288 Ga0495645_0314232 3300046543 Bacteria 1019
289 Ga0495622_0114138 3300046557 Bacteria 1236
290 Ga0495667_0005448 3300046559 Bacteria 8596
291 Ga0495667_0039372 3300046559 Bacteria 3143
292 Ga0495667_0053432 3300046559 Bacteria 2660
293 Ga0495667_0078308 3300046559 Bacteria 2149
294 Ga0495634_0003317 3300046642 Bacteria 12959
295 Ga0495635_0014503 3300046663 Bacteria 5514
296 Ga0495635_0036592 3300046663 Bacteria 3402
297 Ga0495635_0276453 3300046663 Bacteria 1128
298 Ga0495588_0017932 3300046674 Bacteria 3446
299 Ga0495657_0012417 3300046675 Bacteria 6330
300 Ga0495657_0048101 3300046675 Bacteria 2878
301 Ga0495657_0383765 3300046675 Bacteria 828
302 Ga0495599_0129794 3300046678 Bacteria 1565
303 Ga0495599_0254713 3300046678 Bacteria 1067
304 Ga0495623_0026976 3300046679 Bacteria 3695
305 Ga0495646_0070166 3300046680 Bacteria 2064
306 Ga0495658_0105429 3300046683 Bacteria 1688
307 Ga0495624_0002177 3300046690 Bacteria 14959
308 Ga0495624_0009265 3300046690 Bacteria 6822
309 Ga0495600_0007736 3300046809 Bacteria 6580
310 Ga0495581_0000760 3300047315 Bacteria 17124
311 Ga0495581_0397619 3300047315 Bacteria 804
312 Ga0495604_0041728 3300047317 Bacteria 3597
313 Ga0495604_0090303 3300047317 Bacteria 2275
314 Ga0495674_0000553 3300047319 Bacteria 34738
315 Ga0495674_0017447 3300047319 Bacteria 6678
316 Ga0495674_0260752 3300047319 Bacteria 1424
317 Ga0495676_0012367 3300047321 Bacteria 7690
318 Ga0495676_0020958 3300047321 Bacteria 5721
319 Ga0495680_0004446 3300047322 Bacteria 13398
320 Ga0495680_0011179 3300047322 Bacteria 7970
321 Ga0495680_0014025 3300047322 Bacteria 6964
322 Ga0495680_0230023 3300047322 Bacteria 1320
323 Ga0495675_0016870 3300047444 Bacteria 4620
324 Ga0495684_0002486 3300047471 Bacteria 14688
325 Ga0495684_0034692 3300047471 Bacteria 3870
326 Ga0495684_0065677 3300047471 Bacteria 2758
327 Ga0495684_0082581 3300047471 Bacteria 2437
328 Ga0495684_0100684 3300047471 Bacteria 2185
329 Ga0495593_0004800 3300047673 Bacteria 8020
330 Ga0495593_0095050 3300047673 Bacteria 1533
331 Ga0495593_0341514 3300047673 Bacteria 748
332 Ga0495602_0024172 3300048088 Bacteria 5898
333 Ga0495602_0127704 3300048088 Bacteria 2033
334 Ga0495602_0188033 3300048088 Bacteria 1586
335 Ga0495614_0003081 3300048089 Bacteria 7425
336 Ga0496102_1454939 3300048905 Bacteria 604
337 Ga0496104_0004528 3300048907 Bacteria 12112
338 Ga0496105_0741841 3300048908 Bacteria 751
339 Ga0496109_0022172 3300048912 Bacteria 5622
340 Ga0496109_0941324 3300048912 Bacteria 802
341 Ga0496110_0002422 3300048913 Bacteria 13966
342 Ga0496111_0467145 3300048914 Bacteria 930
343 Ga0496113_0239807 3300048916 Bacteria 1446
344 Ga0496113_0275333 3300048916 Bacteria 1346
345 Ga0496116_0029454 3300048919 Bacteria 3957
346 Ga0496117_0003112 3300048920 Bacteria 19810
347 Ga0496117_0058117 3300048920 Bacteria 2680
348 Ga0496118_0005997 3300048921 Bacteria 13556
349 Ga0496118_0041174 3300048921 Bacteria 3661
350 Ga0496118_0055550 3300048921 Bacteria 2986
351 Ga0496119_0008183 3300048922 Bacteria 9254
352 Ga0496119_0013544 3300048922 Bacteria 6484
353 Ga0496119_0049027 3300048922 Bacteria 2614
354 Ga0496120_0002813 3300048923 Bacteria 16803
355 Ga0496120_0064491 3300048923 Bacteria 2033
356 Ga0496121_0612930 3300048924 Bacteria 669
357 Ga0496122_0000208 3300048925 Bacteria 131175
358 Ga0496122_0002682 3300048925 Bacteria 24783
359 Ga0496122_0007357 3300048925 Bacteria 12270
360 Ga0496123_0000003 3300048926 Bacteria 866556
361 Ga0496123_0000051 3300048926 Bacteria 237095
362 Ga0496123_0062309 3300048926 Bacteria 2391
363 Ga0496124_0002029 3300048927 Bacteria 27535
364 Ga0496124_0018153 3300048927 Bacteria 6601
365 Ga0496124_0027326 3300048927 Bacteria 5123
366 Ga0496125_0012663 3300048928 Bacteria 8348
367 Ga0496125_0030634 3300048928 Bacteria 4809
368 Ga0496125_0730256 3300048928 Bacteria 521
369 Ga0496126_0024174 3300048929 Bacteria 5869
370 Ga0496126_0048118 3300048929 Bacteria 3900
371 Ga0496126_0059122 3300048929 Bacteria 3453
372 Ga0496126_0064192 3300048929 Bacteria 3290
373 Ga0496126_0073137 3300048929 Bacteria 3048
374 Ga0496126_0447651 3300048929 Bacteria 1040
375 Ga0501031_0077469 3300049568 Bacteria 2165
376 Ga0501031_0200702 3300049568 Bacteria 1301
377 Ga0501032_0011132 3300049569 Bacteria 6467
378 Ga0501032_0424335 3300049569 Bacteria 853
379 Ga0501033_0552889 3300049570 Bacteria 793
380 Ga0501036_0057643 3300049572 Bacteria 3290
381 Ga0501036_0260312 3300049572 Bacteria 1453
382 Ga0501037_0001503 3300049573 Bacteria 17054
383 Ga0501038_0020839 3300049574 Bacteria 5891
384 Ga0501038_0103015 3300049574 Bacteria 2374
385 Ga0501039_0014703 3300049575 Bacteria 5987
386 Ga0501040_0007052 3300049576 Bacteria 7282
387 Ga0501042_0017204 3300049578 Bacteria 4982
388 Ga0501042_0231940 3300049578 Bacteria 1331
389 Ga0501043_0010178 3300049579 Bacteria 7372
390 Ga0501046_0041722 3300049580 Bacteria 3660
391 Ga0501046_0108313 3300049580 Bacteria 2125
392 Ga0501046_0217511 3300049580 Bacteria 1416
393 Ga0501048_0010728 3300049582 Bacteria 6832
394 Ga0501048_0051621 3300049582 Bacteria 2927
395 Ga0501068_0009335 3300049584 Bacteria 5483
396 Ga0501069_0141849 3300049585 Bacteria 1378
397 Ga0501071_0123227 3300049587 Bacteria 1922
398 Ga0501072_0328515 3300049588 Bacteria 1215
399 Ga0501073_0068853 3300049589 Bacteria 2466
400 Ga0501074_0003457 3300049590 Bacteria 11205
401 Ga0501074_0027195 3300049590 Bacteria 4147
402 Ga0501075_0036926 3300049591 Bacteria 3647
403 Ga0501076_0102633 3300049592 Bacteria 2306
404 Ga0501079_0140983 3300049741 Bacteria 1878
405 Ga0501080_0035631 3300049742 Bacteria 4644
406 Ga0501081_0103012 3300049743 Bacteria 2019
407 Ga0501081_0204209 3300049743 Bacteria 1434
408 Ga0501083_0017231 3300049744 Bacteria 5036
409 Ga0501083_0109272 3300049744 Bacteria 1818
410 Ga0501035_0106211 3300049822 Bacteria 2462
411 Ga0501035_0136018 3300049822 Bacteria 2139
412 Ga0501044_0325156 3300049823 Bacteria 1461
413 Ga0501045_0009173 3300049824 Bacteria 6913
414 nmdc:mga00v17_759557_c1 3300050491 Bacteria 619
415 nmdc:mga00v17_77166_c1 3300050491 Bacteria 2074
416 nmdc:mga0yw44_253781_c1 3300050492 Bacteria 1171
417 nmdc:mga0yw44_42577_c1 3300050492 Bacteria 2708
418 nmdc:mga05p37_1284_c1 3300050507 Bacteria 29136
419 nmdc:mga05p37_425470_c1 3300050507 Bacteria 1544
420 nmdc:mga09592_31_c1 3300050508 Bacteria 79922
421 nmdc:mga0qj67_43_c1 3300050509 Bacteria 88150
422 nmdc:mga0sz30_58687_c1 3300050516 Bacteria 1641
423 Ga0495601_0038876 3300053077 Bacteria 2976
424 Ga0495601_0393562 3300053077 Bacteria 899
425 Ga0495612_0021317 3300053078 Bacteria 2599
426 Ga0495612_0225413 3300053078 Bacteria 830
427 Ga0495595_0076348 3300053084 Bacteria 1590
428 Ga0495619_0028836 3300053085 Bacteria 3581
429 Ga0495619_0261950 3300053085 Bacteria 1198
430 Ga0495619_0262265 3300053085 Bacteria 1197
431 Ga0500593_000565 3300053117 Bacteria 14324
432 Ga0500559_0123221 3300053136 Bacteria 1206
433 Ga0500616_0064158 3300053153 Bacteria 1892
434 Ga0501084_0019206 3300054114 Bacteria 5692
435 Ga0501084_0210513 3300054114 Bacteria 1640
436 Ga0501082_0005793 3300060353 Bacteria 10725
437 Ga0501082_0024039 3300060353 Bacteria 5255
438 2623500304 2622736605 Bacteria 4992138
439 2623500316 2622736605 Bacteria 4992138
440 2643886919 2643221575 Bacteria 4022601
441 2644181345 2643221632 Bacteria 3406696
442 2808899633 2808606372 Bacteria 4649509
443 2808901912 2808606372 Bacteria 4649509
444 2809228635 2808606447 Bacteria 3572005
445 2852633993 2852632344 Bacteria 3463163
446 2868093194 2868088558 Bacteria 7609351
447 2868095563 2868088558 Bacteria 7609351
448 2870631236 2870628048 Bacteria 3696012
449 2897562839 2897561785 Bacteria 3256946
450 2899372137 2899370129 Bacteria 6781179
451 2899376015 2899370129 Bacteria 6781179
452 2906802725 2906799679 Bacteria 4031749
453 2945970458 2945968032 Bacteria 4111363
454 Ga0075428_100000269
455 JGI25406J46586_10022275
456 Ga0070658_10001361
457 Ga0070658_10187214
458 Ga0070683_100521556
459 Ga0070690_100937752
460 Ga0070682_100028214
461 Ga0070660_100144572
462 Ga0070661_100531933
463 Ga0070709_10085111
464 Ga0070709_10352731
465 Ga0070709_10511733
466 Ga0070714_100001343
467 Ga0070714_100058074
468 Ga0070714_100141734
469 Ga0070714_100426111
470 Ga0070714_100762962
471 Ga0070714_101535444
472 Ga0070713_100038929
473 Ga0070713_100105423
474 Ga0070713_100106520
475 Ga0070713_100527405
476 Ga0070713_101218301
477 Ga0070710_10002592
478 Ga0070710_10006252
479 Ga0070711_100233400
480 Ga0070711_100301524
481 Ga0070711_100423666
482 Ga0070705_100433796
483 Ga0070708_100086430
484 Ga0070708_100133200
485 Ga0070708_100448233
486 Ga0070681_10166715
487 Ga0070681_10757395
488 Ga0070681_10837506
489 Ga0070706_100001779
490 Ga0070706_100008251
491 Ga0070706_100437128
492 Ga0070707_100228767
493 Ga0070707_100318136
494 Ga0070698_100022529
495 Ga0070698_100040465
496 Ga0070698_100877563
497 Ga0070699_100067019
498 Ga0070699_100079566
499 Ga0070699_100191643
500 Ga0070684_100027834
501 Ga0070684_100450242
502 Ga0070697_100009174
503 Ga0068853_100176384
504 Ga0068855_100175514
505 Ga0070664_100286417
506 Ga0070664_100304891
507 Ga0068857_100055080
508 Ga0068857_100778181
509 Ga0068856_100094890
510 Ga0068859_100763335
511 Ga0068859_100836547
512 Ga0068864_100086842
513 Ga0068864_100370365
514 Ga0068863_100021501
515 Ga0068863_100391227
516 Ga0068858_100343549
517 Ga0081539_10000032
518 Ga0070717_10005047
519 Ga0070717_10022419
520 Ga0070717_10177000
521 Ga0070717_10394330
522 Ga0070717_10415731
523 Ga0070717_10420994
524 Ga0070717_10873775
525 Ga0070717_10881709
526 Ga0075365_10011462
527 Ga0075365_10021026
528 Ga0075364_10003115
529 Ga0070716_100070685
530 Ga0070716_100091917
531 Ga0070716_100328394
532 Ga0070716_100414287
533 Ga0070712_100162231
534 Ga0070712_100460428
535 Ga0070712_100605899
536 Ga0075369_10001741
537 Ga0097621_100225664
538 Ga0075428_100106377
539 Ga0075430_100517155
540 Ga0075431_100562799
541 Ga0097620_100763374
542 Ga0097620_100836615
543 Ga0111539_11159099
544 Ga0105247_10147403
545 Ga0105241_10229980
546 Ga0105248_10281609
547 Ga0105237_10940306
548 Ga0105238_10347044
549 Ga0105033_111253
550 Ga0099796_10013607
551 Ga0157373_10804064
552 Ga0157369_10041220
553 Ga0157378_11081570
554 Ga0157372_10340401
555 Ga0157372_11520211
556 Ga0157372_12350034
557 Ga0163163_10000842
558 Ga0163163_10372568
559 Ga0163163_10538166
560 Ga0157377_10525627
561 Ga0157379_10283027
562 Ga0206356_11737611
563 Ga0206352_11090560
564 Ga0206350_11250895
565 Ga0206354_11582996
566 Ga0206353_10731422
567 Ga0213875_10001432
568 Ga0213875_10122252
569 Ga0224712_10094517
570 Ga0207692_10127896
571 Ga0207699_10050436
572 Ga0207705_10015846
573 Ga0207684_10002958
574 Ga0207684_10007560
575 Ga0207684_10011701
576 Ga0207684_10051266
577 Ga0207707_10077042
578 Ga0207693_10093077
579 Ga0207693_10094038
580 Ga0207693_10270302
581 Ga0207693_10354299
582 Ga0207663_10274554
583 Ga0207663_10589862
584 Ga0207660_10079145
585 Ga0207657_10142681
586 Ga0207652_10098183
587 Ga0207652_10579005
588 Ga0207646_10004981
589 Ga0207646_10144291
590 Ga0207681_10179238
591 Ga0207694_10451202
592 Ga0207687_10148439
593 Ga0207700_10006627
594 Ga0207700_10034504
595 Ga0207700_10379294
596 Ga0207700_10610379
597 Ga0207700_10659132
598 Ga0207664_10001102
599 Ga0207664_10086369
600 Ga0207664_10090279
601 Ga0207664_10102677
602 Ga0207664_10274840
603 Ga0207690_10080812
604 Ga0207665_10016734
605 Ga0207665_10026945
606 Ga0207665_10580613
607 Ga0207661_10009197
608 Ga0207679_10071981
609 Ga0207703_10391667
610 Ga0207639_10506686
611 Ga0207641_10310446
612 Ga0207676_10012551
613 Ga0207674_10045192
614 Ga0207674_10150896
615 Ga0207674_10465385
616 Ga0307405_10447574
617 Ga0307413_10144848
618 Ga0307413_11189899
619 Ga0307410_10081494
620 Ga0307406_10054523
621 Ga0307406_10094761
622 Ga0307412_10060163
623 Ga0307412_10415845
624 Ga0307409_100298955
625 Ga0307409_100334673
626 Ga0307409_100426934
627 Ga0307416_100077574
628 Ga0307416_100114422
629 Ga0307416_100423924
630 Ga0307411_10020907
631 Ga0307415_100096413
632 Ga0307415_100712363
633 Ga0373938_0055844
634 Ga0373926_0011355
635 Ga0373926_0015025
636 Ga0373934_0013830
637 Ga0373944_0000357
638 Ga0373944_0001597
639 Ga0373944_0248098
640 Ga0373923_0007168
641 Ga0373923_0054507
642 Ga0373936_0000104
643 Ga0373936_0000487
644 Ga0373936_0013277
645 Ga0373945_0000386
646 Ga0373945_0017194
647 Ga0373953_0001771
648 Ga0373953_0173525
649 Ga0373954_0252323
650 Ga0373956_0019774
651 Ga0373956_0038789
652 Ga0373957_0042198
653 Ga0373960_0074150
654 Ga0373943_0000563
655 Ga0373943_0003090
656 Ga0373946_0000074
657 Ga0373946_0002776
658 Ga0373955_0037061
659 Ga0373955_0227727
660 Ga0373924_0030350
661 Ga0373931_0218841
662 Ga0373935_0014551
663 Ga0373935_0303484
664 Ga0373927_0002720
665 Ga0373927_0009537
666 Ga0373927_0237562
667 Ga0373933_0050574
668 Ga0373933_0084296
669 Ga0373933_0147551
670 Ga0373947_0010592
671 Ga0373937_0024437
672 Ga0373937_0025955
673 Ga0373937_0133901
674 Ga0373925_0394875
675 Ga0395900_0391283
676 Ga0395898_0011351
677 Ga0436364_0330965
678 Ga0436364_0366872
679 Ga0395901_0001579
680 Ga0395901_0046002
681 Ga0436365_1410128
682 Ga0436362_0175762
683 Ga0451789_1142117
684 Ga0466965_0029591
685 Ga0466965_0341481
686 Ga0466963_0062382
687 Ga0466963_0129084
688 Ga0466964_0099110
689 Ga0466960_0043816
690 Ga0466960_0064853
691 Ga0466958_0483359
692 Ga0466958_0679853
693 Ga0466967_0002186
694 Ga0466967_0023112
695 Ga0466967_0583264
696 Ga0466967_0584037
697 Ga0466967_0644747
698 Ga0466967_0808015
699 Ga0495592_0410212
700 Ga0495603_0006865
701 Ga0495629_0004955
702 Ga0495629_0282601
703 Ga0495641_0004232
704 Ga0495641_0008701
705 Ga0495651_0020174
706 Ga0495651_0195560
707 Ga0495651_0312935
708 Ga0495651_0454994
709 Ga0495653_0010931
710 Ga0495653_0019413
711 Ga0495653_0039316
712 Ga0495580_0008076
713 Ga0495582_0020431
714 Ga0495639_0001815
715 Ga0495662_0192960
716 Ga0495664_0012096
717 Ga0495664_0674725
718 Ga0495594_0004853
719 Ga0495608_0006102
720 Ga0495608_0043935
721 Ga0495608_0214465
722 Ga0495618_0020471
723 Ga0495618_0036773
724 Ga0495630_0117951
725 Ga0495630_0158773
726 Ga0495630_0397096
727 Ga0495666_0003965
728 Ga0495652_0040780
729 Ga0495652_0099406
730 Ga0495652_0454375
731 Ga0495652_0475463
732 Ga0495665_0011297
733 Ga0495665_0021279
734 Ga0495640_0095600
735 Ga0495640_0219530
736 Ga0495586_0033383
737 Ga0495587_0034926
738 Ga0495587_0096606
739 Ga0495587_0117151
740 Ga0495645_0085161
741 Ga0495645_0314232
742 Ga0495622_0114138
743 Ga0495667_0005448
744 Ga0495667_0039372
745 Ga0495667_0053432
746 Ga0495667_0078308
747 Ga0495634_0003317
748 Ga0495635_0014503
749 Ga0495635_0036592
750 Ga0495635_0276453
751 Ga0495588_0017932
752 Ga0495657_0012417
753 Ga0495657_0048101
754 Ga0495657_0383765
755 Ga0495599_0129794
756 Ga0495599_0254713
757 Ga0495623_0026976
758 Ga0495646_0070166
759 Ga0495658_0105429
760 Ga0495624_0002177
761 Ga0495624_0009265
762 Ga0495600_0007736
763 Ga0495581_0000760
764 Ga0495581_0397619
765 Ga0495604_0041728
766 Ga0495604_0090303
767 Ga0495674_0000553
768 Ga0495674_0017447
769 Ga0495674_0260752
770 Ga0495676_0012367
771 Ga0495676_0020958
772 Ga0495680_0004446
773 Ga0495680_0011179
774 Ga0495680_0014025
775 Ga0495680_0230023
776 Ga0495675_0016870
777 Ga0495684_0002486
778 Ga0495684_0034692
779 Ga0495684_0065677
780 Ga0495684_0082581
781 Ga0495684_0100684
782 Ga0495593_0004800
783 Ga0495593_0095050
784 Ga0495593_0341514
785 Ga0495602_0024172
786 Ga0495602_0127704
787 Ga0495602_0188033
788 Ga0495614_0003081
789 Ga0496102_1454939
790 Ga0496104_0004528
791 Ga0496105_0741841
792 Ga0496109_0022172
793 Ga0496109_0941324
794 Ga0496110_0002422
795 Ga0496111_0467145
796 Ga0496113_0239807
797 Ga0496113_0275333
798 Ga0496116_0029454
799 Ga0496117_0003112
800 Ga0496117_0058117
801 Ga0496118_0005997
802 Ga0496118_0041174
803 Ga0496118_0055550
804 Ga0496119_0008183
805 Ga0496119_0013544
806 Ga0496119_0049027
807 Ga0496120_0002813
808 Ga0496120_0064491
809 Ga0496121_0612930
810 Ga0496122_0000208
811 Ga0496122_0002682
812 Ga0496122_0007357
813 Ga0496123_0000003
814 Ga0496123_0000051
815 Ga0496123_0062309
816 Ga0496124_0002029
817 Ga0496124_0018153
818 Ga0496124_0027326
819 Ga0496125_0012663
820 Ga0496125_0030634
821 Ga0496125_0730256
822 Ga0496126_0024174
823 Ga0496126_0048118
824 Ga0496126_0059122
825 Ga0496126_0064192
826 Ga0496126_0073137
827 Ga0496126_0447651
828 Ga0501031_0077469
829 Ga0501031_0200702
830 Ga0501032_0011132
831 Ga0501032_0424335
832 Ga0501033_0552889
833 Ga0501036_0057643
834 Ga0501036_0260312
835 Ga0501037_0001503
836 Ga0501038_0020839
837 Ga0501038_0103015
838 Ga0501039_0014703
839 Ga0501040_0007052
840 Ga0501042_0017204
841 Ga0501042_0231940
842 Ga0501043_0010178
843 Ga0501046_0041722
844 Ga0501046_0108313
845 Ga0501046_0217511
846 Ga0501048_0010728
847 Ga0501048_0051621
848 Ga0501068_0009335
849 Ga0501069_0141849
850 Ga0501071_0123227
851 Ga0501072_0328515
852 Ga0501073_0068853
853 Ga0501074_0003457
854 Ga0501074_0027195
855 Ga0501075_0036926
856 Ga0501076_0102633
857 Ga0501079_0140983
858 Ga0501080_0035631
859 Ga0501081_0103012
860 Ga0501081_0204209
861 Ga0501083_0017231
862 Ga0501083_0109272
863 Ga0501035_0106211
864 Ga0501035_0136018
865 Ga0501044_0325156
866 Ga0501045_0009173
867 nmdc:mga00v17_759557_c1
868 nmdc:mga00v17_77166_c1
869 nmdc:mga0yw44_253781_c1
870 nmdc:mga0yw44_42577_c1
871 nmdc:mga05p37_1284_c1
872 nmdc:mga05p37_425470_c1
873 nmdc:mga09592_31_c1
874 nmdc:mga0qj67_43_c1
875 nmdc:mga0sz30_58687_c1
876 Ga0495601_0038876
877 Ga0495601_0393562
878 Ga0495612_0021317
879 Ga0495612_0225413
880 Ga0495595_0076348
881 Ga0495619_0028836
882 Ga0495619_0261950
883 Ga0495619_0262265
884 Ga0500593_000565
885 Ga0500559_0123221
886 Ga0500616_0064158
887 Ga0501084_0019206
888 Ga0501084_0210513
889 Ga0501082_0005793
890 Ga0501082_0024039
891 2623500304
892 2623500316
893 2643886919
894 2644181345
895 2808899633
896 2808901912
897 2809228635
898 2852633993
899 2868093194
900 2868095563
901 2870631236
902 2897562839
903 2899372137
904 2899376015
905 2906802725
906 2945970458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24696

22

194

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n03-assembly1.cif.gz_A fatty acid abc transporter substrate-binding protein from thermomonospora curvata 0.6942 29 123
5z5e-assembly1.cif.gz_B crystal structure of the glycyl-trna synthetase (glyrs) in nanoarchaeum equitans 0.6826 32 92
8slh-assembly1.cif.gz_A-2 crystal structure of glycine trna ligase from mycobacterium thermoresistibile (amp bound, hexagonal form) 0.6656 32 92
7x0h-assembly2.cif.gz_B crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum 0.6608 32 123
5gre-assembly1.cif.gz_A crystal structure of the alpha gamma heterodimer of human idh3 in complex with mg(2+), citrate and adp 0.6583 32 93
ID Description Score Start End Superfamily
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6966 32 147 3.40.50.2300
1usiA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6395 32 147 3.40.50.2300
3ox4C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.6287 30 129 3.40.50.1970
4at1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.6234 28 122 3.40.50.1370
af_Q96RR1_244_346_3.40.1360.10 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.6223 32 120 3.40.1360.10
ID Description Score Start End GO Terms
AF-A0A1D2UL23-F1-model_v4 LD-carboxypeptidase N-terminal domain-containing protein 0.9733 16 177
AF-A0A383BI30-F1-model_v4 UspA domain-containing protein 0.9645 22 94
AF-A0A520F2U4-F1-model_v4 Uncharacterized protein 0.9605 19 176
AF-A0A2N0LQ35-F1-model_v4 Uncharacterized protein 0.9592 22 96
AF-A0A2N0MCP6-F1-model_v4 Uncharacterized protein 0.9507 22 83

Map