F447142

General Info

Members Datasets Scaffolds Average Seq Length
453 244 906 176

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100152320|Ga0070663_1001523201
Length 191
Sequence MIGPQGPPAYDGRMTDPSDFLSLLTAQVRNEFSASQQYIALAAWFDSHDLPQLAGHFYRQSVEERNHAMMIVRWMLDRDLAVVIPGIDPVRNDFSSVAEPIALALEQEKTVTEQIKTLFATARAEGDFLGEQFMLWFLKEQVEEVASMTTLLTIAERAGDDWFEIETYLAREVVGDAGADVSAPAAAGGAL

Samples

Sample ID Description Type Environment
1 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
67 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
68 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
71 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
72 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
73 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
74 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
75 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
76 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
80 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
81 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
90 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
91 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
92 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
95 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
96 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
99 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
100 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
101 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
102 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
103 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
104 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
105 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
106 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
107 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
108 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
109 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
110 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
111 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
112 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
113 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
114 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
115 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
143 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
191 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
192 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
193 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
210 2547132424 Nocardia nova SH22a Isolate Unclassified
211 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
212 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
213 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
214 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
215 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
216 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
217 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
218 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
219 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
220 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
221 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
222 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
223 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
224 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
225 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
226 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
227 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
228 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
229 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
230 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
231 2920879853 Kocuria salina CV6 Isolate Unclassified
232 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
233 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
234 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
235 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
236 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
237 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
238 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
239 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
240 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
241 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
242 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
243 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
244 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 1.99
Isolates 7.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 8.17
Rhizosphere 82.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070663_100152320 3300005455 Bacteria 1774
2 JGI25152J39213_1004884 3300002773 Bacteria 4084
3 JGI25151J46595_10058989 3300003187 Bacteria 1238
4 Ga0065714_10150820 3300005288 Bacteria 1107
5 Ga0065714_10212931 3300005288 Bacteria 861
6 Ga0070677_10390874 3300005333 Bacteria 731
7 Ga0070682_100027737 3300005337 Bacteria 3400
8 Ga0070682_100095867 3300005337 Bacteria 1949
9 Ga0070682_100328981 3300005337 Bacteria 1132
10 Ga0070682_100618756 3300005337 Bacteria 858
11 Ga0070682_100799892 3300005337 Bacteria 766
12 Ga0070660_100361046 3300005339 Bacteria 1197
13 Ga0070668_100595270 3300005347 Bacteria 967
14 Ga0070674_100385658 3300005356 Bacteria 1141
15 Ga0070674_100753189 3300005356 Bacteria 837
16 Ga0070678_100173402 3300005456 Bacteria 1759
17 Ga0070678_100206438 3300005456 Bacteria 1625
18 Ga0070678_100227721 3300005456 Bacteria 1552
19 Ga0070685_10162669 3300005466 Bacteria 1424
20 Ga0070685_10204686 3300005466 Bacteria 1285
21 Ga0068856_100920201 3300005614 Bacteria 893
22 Ga0070702_100001446 3300005615 Bacteria 9725
23 Ga0068852_100220830 3300005616 Bacteria 1802
24 Ga0068864_100520349 3300005618 Bacteria 1147
25 Ga0068861_101210978 3300005719 Bacteria 731
26 Ga0068870_10168807 3300005840 Bacteria 1304
27 Ga0081539_10058785 3300005985 Bacteria 2120
28 Ga0081539_10162177 3300005985 Bacteria 1064
29 Ga0070717_10334708 3300006028 Bacteria 1351
30 Ga0075432_10012358 3300006058 Bacteria 2901
31 Ga0097621_100304729 3300006237 Bacteria 1408
32 Ga0075370_10333140 3300006353 Bacteria 905
33 Ga0068871_100271356 3300006358 Bacteria 1482
34 Ga0105244_10019905 3300009036 Bacteria 3733
35 Ga0105244_10024037 3300009036 Bacteria 3330
36 Ga0105244_10166069 3300009036 Bacteria 1052
37 Ga0111539_11065032 3300009094 Bacteria 940
38 Ga0105245_10263764 3300009098 Bacteria 1677
39 Ga0105245_10475538 3300009098 Bacteria 1262
40 Ga0114129_10685705 3300009147 Bacteria 1318
41 Ga0105243_10058220 3300009148 Bacteria 3079
42 Ga0105243_10166574 3300009148 Bacteria 1905
43 Ga0105243_10169575 3300009148 Bacteria 1889
44 Ga0105243_10218039 3300009148 Bacteria 1684
45 Ga0105243_10747836 3300009148 Bacteria 958
46 Ga0105243_11357300 3300009148 Bacteria 730
47 Ga0105241_11579956 3300009174 Bacteria 634
48 Ga0105242_10244508 3300009176 Bacteria 1614
49 Ga0105249_10412205 3300009553 Bacteria 1383
50 Ga0105249_11179648 3300009553 Bacteria 836
51 Ga0105239_11130397 3300010375 Bacteria 902
52 Ga0105246_10003914 3300011119 Bacteria 9017
53 Ga0105246_10016490 3300011119 Bacteria 4679
54 Ga0105246_10047968 3300011119 Bacteria 2919
55 Ga0105246_10172722 3300011119 Bacteria 1657
56 Ga0105246_11399845 3300011119 Bacteria 652
57 Ga0157371_10002292 3300013102 Bacteria 18439
58 Ga0157369_11278059 3300013105 Bacteria 748
59 Ga0157378_10425036 3300013297 Bacteria 1314
60 Ga0157378_10502858 3300013297 Bacteria 1211
61 Ga0157372_10357027 3300013307 Bacteria 1703
62 Ga0157372_10569668 3300013307 Bacteria 1320
63 Ga0157375_10152748 3300013308 Bacteria 2445
64 Ga0157375_10853562 3300013308 Bacteria 1057
65 Ga0157375_10899244 3300013308 Bacteria 1029
66 Ga0163163_10109931 3300014325 Bacteria 2784
67 Ga0157380_10037195 3300014326 Bacteria 3770
68 Ga0157379_10456908 3300014968 Bacteria 1180
69 Ga0157376_10127084 3300014969 Bacteria 2269
70 Ga0157376_10559963 3300014969 Bacteria 1132
71 Ga0157376_10579092 3300014969 Bacteria 1114
72 Ga0163161_10081674 3300017792 Bacteria 2380
73 Ga0209129_1000047 3300025258 Bacteria 270566
74 Ga0209025_1000920 3300025294 Bacteria 45267
75 Ga0209051_1019082 3300025303 Bacteria 3007
76 Ga0209051_1021331 3300025303 Bacteria 2762
77 Ga0207697_10003066 3300025315 Bacteria 8379
78 Ga0207697_10291695 3300025315 Bacteria 723
79 Ga0207697_10343589 3300025315 Bacteria 663
80 Ga0207655_1011089 3300025728 Bacteria 5402
81 Ga0207655_1059541 3300025728 Bacteria 1486
82 Ga0207682_10052456 3300025893 Bacteria 1690
83 Ga0207642_10099712 3300025899 Bacteria 1455
84 Ga0207688_10390923 3300025901 Bacteria 861
85 Ga0207688_10513694 3300025901 Bacteria 751
86 Ga0207657_10372409 3300025919 Bacteria 1125
87 Ga0207652_10103740 3300025921 Bacteria 2514
88 Ga0207659_10308070 3300025926 Bacteria 1303
89 Ga0207687_10286293 3300025927 Bacteria 1323
90 Ga0207686_10030477 3300025934 Bacteria 3193
91 Ga0207709_10162019 3300025935 Bacteria 1561
92 Ga0207709_10232305 3300025935 Bacteria 1337
93 Ga0207669_10739304 3300025937 Bacteria 811
94 Ga0207669_10963456 3300025937 Bacteria 715
95 Ga0207689_10036485 3300025942 Bacteria 4081
96 Ga0207661_10386917 3300025944 Bacteria 1267
97 Ga0207668_11028170 3300025972 Bacteria 737
98 Ga0207678_10235678 3300026067 Bacteria 1567
99 Ga0207683_10030573 3300026121 Bacteria 4667
100 Ga0207683_10528930 3300026121 Bacteria 1090
101 Ga0207698_10520400 3300026142 Bacteria 1161
102 Ga0207428_10187592 3300027907 Bacteria 1560
103 Ga0307512_10226548 3300030522 Bacteria 968
104 Ga0316181_1009494 3300030744 Bacteria 736
105 Ga0307513_10003563 3300031456 Bacteria 21062
106 Ga0307408_100010806 3300031548 Bacteria 6023
107 Ga0307408_100029167 3300031548 Bacteria 3819
108 Ga0307408_100030242 3300031548 Bacteria 3759
109 Ga0307408_100090199 3300031548 Bacteria 2312
110 Ga0307408_100104907 3300031548 Bacteria 2160
111 Ga0307408_100110852 3300031548 Bacteria 2108
112 Ga0307408_100112402 3300031548 Bacteria 2094
113 Ga0307408_100202640 3300031548 Bacteria 1607
114 Ga0307408_100206098 3300031548 Bacteria 1595
115 Ga0307408_100275287 3300031548 Bacteria 1399
116 Ga0307408_100430126 3300031548 Bacteria 1140
117 Ga0307408_100442492 3300031548 Bacteria 1125
118 Ga0307408_100592884 3300031548 Bacteria 983
119 Ga0307408_101091273 3300031548 Bacteria 740
120 Ga0307516_10396570 3300031730 Bacteria 1040
121 Ga0307405_10032603 3300031731 Bacteria 3081
122 Ga0307405_10063240 3300031731 Bacteria 2346
123 Ga0307405_10088772 3300031731 Bacteria 2040
124 Ga0307405_10088943 3300031731 Bacteria 2039
125 Ga0307405_10103424 3300031731 Bacteria 1915
126 Ga0307405_10391606 3300031731 Bacteria 1085
127 Ga0307405_10402458 3300031731 Bacteria 1072
128 Ga0307405_10403646 3300031731 Bacteria 1070
129 Ga0307405_10437868 3300031731 Bacteria 1033
130 Ga0307405_10585068 3300031731 Bacteria 908
131 Ga0307405_10660809 3300031731 Bacteria 861
132 Ga0307405_10695275 3300031731 Bacteria 841
133 Ga0307405_10797686 3300031731 Bacteria 791
134 Ga0307413_10019981 3300031824 Bacteria 3552
135 Ga0307413_10094135 3300031824 Bacteria 1960
136 Ga0307413_10095817 3300031824 Bacteria 1946
137 Ga0307413_10177295 3300031824 Bacteria 1515
138 Ga0307413_10228329 3300031824 Bacteria 1365
139 Ga0307413_10277810 3300031824 Bacteria 1258
140 Ga0307413_10497075 3300031824 Bacteria 978
141 Ga0307413_10755466 3300031824 Bacteria 813
142 Ga0307410_10012356 3300031852 Bacteria 4935
143 Ga0307410_10030807 3300031852 Bacteria 3432
144 Ga0307410_10053167 3300031852 Bacteria 2739
145 Ga0307410_10053337 3300031852 Bacteria 2736
146 Ga0307410_10064628 3300031852 Bacteria 2515
147 Ga0307410_10119373 3300031852 Bacteria 1920
148 Ga0307410_10232469 3300031852 Bacteria 1424
149 Ga0307410_10233921 3300031852 Bacteria 1420
150 Ga0307410_10335213 3300031852 Bacteria 1204
151 Ga0307410_10400080 3300031852 Bacteria 1109
152 Ga0307410_10434805 3300031852 Bacteria 1067
153 Ga0307410_10514824 3300031852 Bacteria 986
154 Ga0307410_10538251 3300031852 Bacteria 966
155 Ga0307410_11079643 3300031852 Bacteria 695
156 Ga0307406_10031611 3300031901 Bacteria 3225
157 Ga0307406_10034379 3300031901 Bacteria 3109
158 Ga0307406_10072887 3300031901 Bacteria 2256
159 Ga0307406_10131727 3300031901 Bacteria 1756
160 Ga0307406_10781065 3300031901 Bacteria 804
161 Ga0307406_11078716 3300031901 Bacteria 692
162 Ga0307406_11195103 3300031901 Bacteria 660
163 Ga0307407_10027030 3300031903 Bacteria 3047
164 Ga0307407_10047958 3300031903 Bacteria 2428
165 Ga0307407_10065498 3300031903 Bacteria 2139
166 Ga0307407_10102812 3300031903 Bacteria 1777
167 Ga0307407_10145745 3300031903 Bacteria 1533
168 Ga0307407_10156637 3300031903 Bacteria 1486
169 Ga0307407_10181584 3300031903 Bacteria 1395
170 Ga0307407_10250449 3300031903 Bacteria 1213
171 Ga0307407_10316381 3300031903 Bacteria 1094
172 Ga0307407_10563157 3300031903 Bacteria 844
173 Ga0307407_10584390 3300031903 Bacteria 830
174 Ga0307407_11288468 3300031903 Bacteria 573
175 Ga0307412_10010994 3300031911 Bacteria 5228
176 Ga0307412_10021052 3300031911 Bacteria 3978
177 Ga0307412_10023829 3300031911 Bacteria 3771
178 Ga0307412_10033976 3300031911 Bacteria 3246
179 Ga0307412_10160721 3300031911 Bacteria 1668
180 Ga0307412_10224335 3300031911 Bacteria 1442
181 Ga0307412_10312603 3300031911 Bacteria 1246
182 Ga0307412_10467044 3300031911 Bacteria 1043
183 Ga0307412_10565221 3300031911 Bacteria 957
184 Ga0307412_10578937 3300031911 Bacteria 947
185 Ga0307412_11254957 3300031911 Bacteria 665
186 Ga0307409_100032377 3300031995 Bacteria 3790
187 Ga0307409_100034033 3300031995 Bacteria 3716
188 Ga0307409_100051851 3300031995 Bacteria 3142
189 Ga0307409_100083718 3300031995 Bacteria 2587
190 Ga0307409_100090135 3300031995 Bacteria 2509
191 Ga0307409_100126841 3300031995 Bacteria 2172
192 Ga0307409_100147990 3300031995 Bacteria 2034
193 Ga0307409_100197707 3300031995 Bacteria 1796
194 Ga0307409_100256290 3300031995 Bacteria 1602
195 Ga0307409_100496383 3300031995 Bacteria 1187
196 Ga0307409_100503946 3300031995 Bacteria 1179
197 Ga0307409_100506742 3300031995 Bacteria 1176
198 Ga0307416_100026949 3300032002 Bacteria 4245
199 Ga0307416_100078179 3300032002 Bacteria 2782
200 Ga0307416_100089788 3300032002 Bacteria 2632
201 Ga0307416_100113512 3300032002 Bacteria 2394
202 Ga0307416_100264286 3300032002 Bacteria 1684
203 Ga0307416_100292447 3300032002 Bacteria 1613
204 Ga0307416_100545969 3300032002 Bacteria 1231
205 Ga0307416_100585682 3300032002 Bacteria 1193
206 Ga0307416_100776279 3300032002 Bacteria 1052
207 Ga0307416_100904876 3300032002 Bacteria 982
208 Ga0307416_101645022 3300032002 Bacteria 747
209 Ga0307414_10037871 3300032004 Bacteria 3233
210 Ga0307414_10362524 3300032004 Bacteria 1248
211 Ga0307414_10465287 3300032004 Bacteria 1112
212 Ga0307414_10652274 3300032004 Bacteria 949
213 Ga0307411_10077665 3300032005 Bacteria 2273
214 Ga0307411_10079830 3300032005 Bacteria 2248
215 Ga0307411_10295367 3300032005 Bacteria 1297
216 Ga0307411_10929501 3300032005 Bacteria 774
217 Ga0307415_100114846 3300032126 Bacteria 2005
218 Ga0307415_100175633 3300032126 Bacteria 1675
219 Ga0307415_100191338 3300032126 Bacteria 1615
220 Ga0307415_100227897 3300032126 Bacteria 1498
221 Ga0307415_100277254 3300032126 Bacteria 1377
222 Ga0307415_100338904 3300032126 Bacteria 1261
223 Ga0307510_10062154 3300033180 Bacteria 3818
224 Ga0395899_0012530 3300037312 Bacteria 6499
225 Ga0395900_0313149 3300037418 Bacteria 1552
226 Ga0395898_0294414 3300037466 Bacteria 1548
227 Ga0395901_0289708 3300038443 Bacteria 1699
228 Ga0439436_0042475 3300041404 Bacteria 1299
229 Ga0439438_008768 3300041405 Bacteria 3323
230 Ga0439438_025512 3300041405 Bacteria 1610
231 Ga0439466_0017479 3300041411 Bacteria 2584
232 Ga0451787_595782 3300041441 Bacteria 888
233 Ga0451789_1219731 3300041443 Bacteria 1419
234 Ga0451791_0632372 3300041451 Bacteria 1891
235 Ga0451793_0406302 3300041452 Bacteria 12911
236 Ga0451797_0263790 3300041453 Bacteria 2026
237 Ga0451795_0928975 3300041456 Bacteria 758
238 Ga0451800_0116399 3300041459 Bacteria 1702
239 Ga0451837_0632316 3300041494 Bacteria 1025
240 Ga0451837_0979011 3300041494 Bacteria 3550
241 Ga0451841_0003065 3300041498 Bacteria 1359
242 Ga0451851_1144122 3300041507 Bacteria 1936
243 Ga0451843_0031276 3300041509 Bacteria 962
244 Ga0451843_0105243 3300041509 Bacteria 4142
245 Ga0451843_0754130 3300041509 Bacteria 2067
246 Ga0451843_1094086 3300041509 Bacteria 979
247 Ga0451855_1861502 3300041511 Bacteria 688
248 Ga0451853_0798652 3300041512 Bacteria 5531
249 Ga0439433_0002518 3300041999 Bacteria 3890
250 Ga0439433_0015597 3300041999 Bacteria 1678
251 Ga0439433_0033977 3300041999 Bacteria 1173
252 Ga0439442_000215 3300042002 Bacteria 14384
253 Ga0439442_000558 3300042002 Bacteria 8137
254 Ga0439442_001217 3300042002 Bacteria 5124
255 Ga0439442_005664 3300042002 Bacteria 2500
256 Ga0439432_101737 3300042006 Bacteria 859
257 Ga0439449_0000362 3300042007 Bacteria 16628
258 Ga0439449_0001937 3300042007 Bacteria 8136
259 Ga0439449_0002813 3300042007 Bacteria 6762
260 Ga0439449_0062835 3300042007 Bacteria 1370
261 Ga0439457_017475 3300042014 Bacteria 1593
262 Ga0439462_0014188 3300042015 Bacteria 2046
263 Ga0450920_011832 3300042122 Bacteria 1630
264 Ga0450923_037663 3300042125 Bacteria 1007
265 Ga0450907_026455 3300042146 Bacteria 982
266 Ga0450910_031905 3300042147 Bacteria 830
267 Ga0439434_0202562 3300042435 Bacteria 669
268 Ga0450918_000176 3300042531 Bacteria 14255
269 Ga0466969_0006717 3300044656 Bacteria 6117
270 Ga0466966_0224195 3300044684 Bacteria 1134
271 Ga0466961_0110179 3300044693 Bacteria 1732
272 Ga0466970_0080860 3300044765 Bacteria 1756
273 Ga0466960_0439532 3300044901 Bacteria 757
274 Ga0466959_0004703 3300045049 Bacteria 9193
275 Ga0495638_0234792 3300046460 Bacteria 1018
276 Ga0495641_0198065 3300046461 Bacteria 900
277 Ga0495653_0564836 3300046463 Bacteria 703
278 Ga0495582_0112630 3300046473 Bacteria 1529
279 Ga0495582_0280585 3300046473 Bacteria 957
280 Ga0495662_0286846 3300046476 Bacteria 810
281 Ga0495596_0061573 3300046500 Bacteria 1461
282 Ga0495630_0541403 3300046517 Bacteria 893
283 Ga0495586_0410348 3300046535 Bacteria 780
284 Ga0495667_0175424 3300046559 Bacteria 1377
285 Ga0495667_0263039 3300046559 Bacteria 1097
286 Ga0495656_0000366 3300046615 Bacteria 15108
287 Ga0495668_0117594 3300046616 Bacteria 1454
288 Ga0495661_0056156 3300046665 Bacteria 2357
289 Ga0495624_0349123 3300046690 Bacteria 890
290 Ga0495670_0001979 3300046691 Bacteria 10054
291 Ga0495671_0181474 3300046692 Bacteria 1022
292 Ga0495589_0105683 3300046794 Bacteria 1360
293 Ga0495581_0498399 3300047315 Bacteria 708
294 Ga0495636_0012839 3300047318 Bacteria 3319
295 Ga0495636_0102441 3300047318 Bacteria 1253
296 Ga0495674_1029933 3300047319 Bacteria 630
297 Ga0495676_0534299 3300047321 Bacteria 767
298 Ga0495681_0034215 3300047470 Bacteria 2534
299 Ga0495593_0217992 3300047673 Bacteria 958
300 Ga0495626_0199410 3300048091 Bacteria 821
301 Ga0496100_0045549 3300048903 Bacteria 2816
302 Ga0496100_0622613 3300048903 Bacteria 839
303 Ga0496101_0122031 3300048904 Bacteria 1970
304 Ga0496101_0339330 3300048904 Bacteria 1180
305 Ga0496102_0096338 3300048905 Bacteria 2743
306 Ga0496102_0265962 3300048905 Bacteria 1617
307 Ga0496103_0130345 3300048906 Bacteria 1606
308 Ga0496104_0033234 3300048907 Bacteria 4804
309 Ga0496104_0124586 3300048907 Bacteria 2474
310 Ga0496104_0656071 3300048907 Bacteria 958
311 Ga0496105_0566186 3300048908 Bacteria 885
312 Ga0496108_0001425 3300048911 Bacteria 18862
313 Ga0496108_0307542 3300048911 Bacteria 1381
314 Ga0496109_0123669 3300048912 Bacteria 2411
315 Ga0496110_0026962 3300048913 Bacteria 4921
316 Ga0496111_0001420 3300048914 Bacteria 13636
317 Ga0496111_0926325 3300048914 Bacteria 627
318 Ga0496113_0146099 3300048916 Bacteria 1863
319 Ga0496114_0003059 3300048917 Bacteria 12811
320 Ga0496114_0023798 3300048917 Bacteria 4998
321 Ga0496114_0040492 3300048917 Bacteria 3858
322 Ga0496114_0125792 3300048917 Bacteria 2210
323 Ga0496114_0140246 3300048917 Bacteria 2092
324 Ga0496114_0210662 3300048917 Bacteria 1704
325 Ga0496114_0318095 3300048917 Bacteria 1375
326 Ga0496114_0367497 3300048917 Bacteria 1273
327 Ga0496114_0405076 3300048917 Bacteria 1208
328 Ga0496114_0458412 3300048917 Bacteria 1129
329 Ga0496114_0692936 3300048917 Bacteria 894
330 Ga0496115_0055587 3300048918 Bacteria 3180
331 Ga0496126_0149908 3300048929 Bacteria 2000
332 Ga0501308_012702 3300049128 Bacteria 965
333 Ga0501305_016269 3300049161 Bacteria 1059
334 Ga0501311_030283 3300049527 Bacteria 780
335 Ga0501313_038078 3300049529 Bacteria 640
336 Ga0501316_008794 3300049532 Bacteria 1122
337 Ga0501318_020016 3300049534 Bacteria 840
338 Ga0501325_006873 3300049541 Bacteria 949
339 Ga0501325_024931 3300049541 Bacteria 654
340 Ga0501031_0005265 3300049568 Bacteria 8432
341 Ga0501031_0029718 3300049568 Bacteria 3565
342 Ga0501032_0051450 3300049569 Bacteria 2777
343 Ga0501032_0247279 3300049569 Bacteria 1158
344 Ga0501032_0536356 3300049569 Bacteria 746
345 Ga0501033_0054522 3300049570 Bacteria 2957
346 Ga0501033_0085966 3300049570 Bacteria 2303
347 Ga0501034_0000079 3300049571 Bacteria 171105
348 Ga0501034_0133714 3300049571 Bacteria 2462
349 Ga0501036_0027093 3300049572 Bacteria 4842
350 Ga0501036_0074000 3300049572 Bacteria 2880
351 Ga0501036_1000288 3300049572 Bacteria 684
352 Ga0501037_0019007 3300049573 Bacteria 5064
353 Ga0501037_0116194 3300049573 Bacteria 1925
354 Ga0501037_0116680 3300049573 Bacteria 1921
355 Ga0501038_0017746 3300049574 Bacteria 6432
356 Ga0501038_0031076 3300049574 Bacteria 4721
357 Ga0501038_0160621 3300049574 Bacteria 1826
358 Ga0501039_0011785 3300049575 Bacteria 6659
359 Ga0501039_0290234 3300049575 Bacteria 1286
360 Ga0501039_0407008 3300049575 Bacteria 1068
361 Ga0501040_0009336 3300049576 Bacteria 6390
362 Ga0501040_0041880 3300049576 Bacteria 3119
363 Ga0501041_0005879 3300049577 Bacteria 7170
364 Ga0501041_0053410 3300049577 Bacteria 2464
365 Ga0501042_0013018 3300049578 Bacteria 5652
366 Ga0501042_0073131 3300049578 Bacteria 2452
367 Ga0501043_0009909 3300049579 Bacteria 7471
368 Ga0501043_0017873 3300049579 Bacteria 5560
369 Ga0501046_0002178 3300049580 Bacteria 18497
370 Ga0501046_0113198 3300049580 Bacteria 2071
371 Ga0501047_0207585 3300049581 Bacteria 1818
372 Ga0501048_0010553 3300049582 Bacteria 6893
373 Ga0501068_0006094 3300049584 Bacteria 6630
374 Ga0501069_0003226 3300049585 Bacteria 8363
375 Ga0501069_0517862 3300049585 Bacteria 712
376 Ga0501070_0002450 3300049586 Bacteria 16255
377 Ga0501070_0121133 3300049586 Bacteria 2162
378 Ga0501071_0007458 3300049587 Bacteria 7185
379 Ga0501071_0129558 3300049587 Bacteria 1873
380 Ga0501072_0006627 3300049588 Bacteria 8812
381 Ga0501072_0061262 3300049588 Bacteria 2967
382 Ga0501073_0043203 3300049589 Bacteria 3178
383 Ga0501074_0001334 3300049590 Bacteria 16397
384 Ga0501074_0096909 3300049590 Bacteria 2111
385 Ga0501075_0010751 3300049591 Bacteria 6445
386 Ga0501075_0067370 3300049591 Bacteria 2703
387 Ga0501076_0026422 3300049592 Bacteria 4497
388 Ga0501077_0002717 3300049593 Bacteria 10608
389 Ga0501077_0015570 3300049593 Bacteria 4788
390 Ga0501216_083865 3300049660 Bacteria 678
391 Ga0501227_118092 3300049665 Bacteria 715
392 Ga0501221_064016 3300049704 Bacteria 856
393 Ga0501245_052911 3300049708 Bacteria 724
394 Ga0501079_0023627 3300049741 Bacteria 4718
395 Ga0501079_0116878 3300049741 Bacteria 2073
396 Ga0501080_0031089 3300049742 Bacteria 4975
397 Ga0501081_0016557 3300049743 Bacteria 4874
398 Ga0501081_0213002 3300049743 Bacteria 1403
399 Ga0501083_0061202 3300049744 Bacteria 2514
400 Ga0501279_011612 3300049775 Bacteria 1193
401 Ga0501035_0004561 3300049822 Bacteria 13144
402 Ga0501044_0019368 3300049823 Bacteria 7283
403 Ga0501044_0140894 3300049823 Bacteria 2400
404 Ga0501045_0002845 3300049824 Bacteria 11818
405 Ga0501045_0032605 3300049824 Bacteria 3775
406 Ga0501045_0393900 3300049824 Bacteria 1031
407 Ga0500604_0076419 3300053151 Bacteria 1076
408 Ga0500616_0002708 3300053153 Bacteria 14392
409 Ga0500616_0012616 3300053153 Bacteria 4942
410 Ga0500620_026577 3300053155 Bacteria 1794
411 Ga0501084_0012602 3300054114 Bacteria 7003
412 Ga0501084_0075927 3300054114 Bacteria 2815
413 Ga0587090_029369 3300059510 Bacteria 910
414 Ga0501082_0017284 3300060353 Bacteria 6213
415 Ga0501082_0057972 3300060353 Bacteria 3336
416 Ga0501082_0375902 3300060353 Bacteria 1240
417 Ga0530510_0048341 3300061734 Bacteria 3074
418 2523387692 2523231044 Bacteria 6434991
419 2548692354 2547132424 Bacteria 8348532
420 2643850976 2643221567 Bacteria 4163945
421 2644134716 2643221624 Bacteria 4384879
422 2644506063 2643221690 Bacteria 4654705
423 2644527663 2643221694 Bacteria 4392972
424 2644670716 2643221722 Bacteria 4247614
425 2691515611 2690315906 Bacteria 4517044
426 2731908572 2731639228 Bacteria 4187555
427 2739206911 2738543005 Bacteria 5278128
428 2795780758 2795385470 Bacteria 8317180
429 2808892997 2808606370 Bacteria 4942454
430 2839987747 2839986021 Bacteria 3685650
431 2844849681 2844849076 Bacteria 4091819
432 2857741191 2857740372 Bacteria 4782044
433 2904500428 2904497146 Bacteria 4731781
434 2904776772 2904776348 Bacteria 4658726
435 2910811565 2910809715 Bacteria 4982797
436 2919036323 2919034639 Bacteria 4763403
437 2919059666 2919059106 Bacteria 4991624
438 2919395111 2919391150 Bacteria 4884741
439 2919540770 2919538618 Bacteria 4677069
440 2920880543 2920879853 Bacteria 4216831
441 2928147438 2928142448 Bacteria 5288925
442 2932400696 2932398195 Bacteria 3847976
443 2932426908 2932426870 Bacteria 4547726
444 2933422628 2933418574 Bacteria 4476724
445 2939650065 2939647034 Bacteria 4681660
446 2939677513 2939674588 Bacteria 4844420
447 2945922476 2945920336 Bacteria 4501603
448 2945941322 2945941187 Bacteria 4682474
449 2945960930 2945956166 Bacteria 5110334
450 2946037242 2946037020 Bacteria 4900426
451 2953998489 2953998280 Bacteria 4812144
452 2974305264 2974302888 Bacteria 4369871
453 8054109230 8054107350 Bacteria 5022511
454 Ga0070663_100152320
455 JGI25152J39213_1004884
456 JGI25151J46595_10058989
457 Ga0065714_10150820
458 Ga0065714_10212931
459 Ga0070677_10390874
460 Ga0070682_100027737
461 Ga0070682_100095867
462 Ga0070682_100328981
463 Ga0070682_100618756
464 Ga0070682_100799892
465 Ga0070660_100361046
466 Ga0070668_100595270
467 Ga0070674_100385658
468 Ga0070674_100753189
469 Ga0070678_100173402
470 Ga0070678_100206438
471 Ga0070678_100227721
472 Ga0070685_10162669
473 Ga0070685_10204686
474 Ga0068856_100920201
475 Ga0070702_100001446
476 Ga0068852_100220830
477 Ga0068864_100520349
478 Ga0068861_101210978
479 Ga0068870_10168807
480 Ga0081539_10058785
481 Ga0081539_10162177
482 Ga0070717_10334708
483 Ga0075432_10012358
484 Ga0097621_100304729
485 Ga0075370_10333140
486 Ga0068871_100271356
487 Ga0105244_10019905
488 Ga0105244_10024037
489 Ga0105244_10166069
490 Ga0111539_11065032
491 Ga0105245_10263764
492 Ga0105245_10475538
493 Ga0114129_10685705
494 Ga0105243_10058220
495 Ga0105243_10166574
496 Ga0105243_10169575
497 Ga0105243_10218039
498 Ga0105243_10747836
499 Ga0105243_11357300
500 Ga0105241_11579956
501 Ga0105242_10244508
502 Ga0105249_10412205
503 Ga0105249_11179648
504 Ga0105239_11130397
505 Ga0105246_10003914
506 Ga0105246_10016490
507 Ga0105246_10047968
508 Ga0105246_10172722
509 Ga0105246_11399845
510 Ga0157371_10002292
511 Ga0157369_11278059
512 Ga0157378_10425036
513 Ga0157378_10502858
514 Ga0157372_10357027
515 Ga0157372_10569668
516 Ga0157375_10152748
517 Ga0157375_10853562
518 Ga0157375_10899244
519 Ga0163163_10109931
520 Ga0157380_10037195
521 Ga0157379_10456908
522 Ga0157376_10127084
523 Ga0157376_10559963
524 Ga0157376_10579092
525 Ga0163161_10081674
526 Ga0209129_1000047
527 Ga0209025_1000920
528 Ga0209051_1019082
529 Ga0209051_1021331
530 Ga0207697_10003066
531 Ga0207697_10291695
532 Ga0207697_10343589
533 Ga0207655_1011089
534 Ga0207655_1059541
535 Ga0207682_10052456
536 Ga0207642_10099712
537 Ga0207688_10390923
538 Ga0207688_10513694
539 Ga0207657_10372409
540 Ga0207652_10103740
541 Ga0207659_10308070
542 Ga0207687_10286293
543 Ga0207686_10030477
544 Ga0207709_10162019
545 Ga0207709_10232305
546 Ga0207669_10739304
547 Ga0207669_10963456
548 Ga0207689_10036485
549 Ga0207661_10386917
550 Ga0207668_11028170
551 Ga0207678_10235678
552 Ga0207683_10030573
553 Ga0207683_10528930
554 Ga0207698_10520400
555 Ga0207428_10187592
556 Ga0307512_10226548
557 Ga0316181_1009494
558 Ga0307513_10003563
559 Ga0307408_100010806
560 Ga0307408_100029167
561 Ga0307408_100030242
562 Ga0307408_100090199
563 Ga0307408_100104907
564 Ga0307408_100110852
565 Ga0307408_100112402
566 Ga0307408_100202640
567 Ga0307408_100206098
568 Ga0307408_100275287
569 Ga0307408_100430126
570 Ga0307408_100442492
571 Ga0307408_100592884
572 Ga0307408_101091273
573 Ga0307516_10396570
574 Ga0307405_10032603
575 Ga0307405_10063240
576 Ga0307405_10088772
577 Ga0307405_10088943
578 Ga0307405_10103424
579 Ga0307405_10391606
580 Ga0307405_10402458
581 Ga0307405_10403646
582 Ga0307405_10437868
583 Ga0307405_10585068
584 Ga0307405_10660809
585 Ga0307405_10695275
586 Ga0307405_10797686
587 Ga0307413_10019981
588 Ga0307413_10094135
589 Ga0307413_10095817
590 Ga0307413_10177295
591 Ga0307413_10228329
592 Ga0307413_10277810
593 Ga0307413_10497075
594 Ga0307413_10755466
595 Ga0307410_10012356
596 Ga0307410_10030807
597 Ga0307410_10053167
598 Ga0307410_10053337
599 Ga0307410_10064628
600 Ga0307410_10119373
601 Ga0307410_10232469
602 Ga0307410_10233921
603 Ga0307410_10335213
604 Ga0307410_10400080
605 Ga0307410_10434805
606 Ga0307410_10514824
607 Ga0307410_10538251
608 Ga0307410_11079643
609 Ga0307406_10031611
610 Ga0307406_10034379
611 Ga0307406_10072887
612 Ga0307406_10131727
613 Ga0307406_10781065
614 Ga0307406_11078716
615 Ga0307406_11195103
616 Ga0307407_10027030
617 Ga0307407_10047958
618 Ga0307407_10065498
619 Ga0307407_10102812
620 Ga0307407_10145745
621 Ga0307407_10156637
622 Ga0307407_10181584
623 Ga0307407_10250449
624 Ga0307407_10316381
625 Ga0307407_10563157
626 Ga0307407_10584390
627 Ga0307407_11288468
628 Ga0307412_10010994
629 Ga0307412_10021052
630 Ga0307412_10023829
631 Ga0307412_10033976
632 Ga0307412_10160721
633 Ga0307412_10224335
634 Ga0307412_10312603
635 Ga0307412_10467044
636 Ga0307412_10565221
637 Ga0307412_10578937
638 Ga0307412_11254957
639 Ga0307409_100032377
640 Ga0307409_100034033
641 Ga0307409_100051851
642 Ga0307409_100083718
643 Ga0307409_100090135
644 Ga0307409_100126841
645 Ga0307409_100147990
646 Ga0307409_100197707
647 Ga0307409_100256290
648 Ga0307409_100496383
649 Ga0307409_100503946
650 Ga0307409_100506742
651 Ga0307416_100026949
652 Ga0307416_100078179
653 Ga0307416_100089788
654 Ga0307416_100113512
655 Ga0307416_100264286
656 Ga0307416_100292447
657 Ga0307416_100545969
658 Ga0307416_100585682
659 Ga0307416_100776279
660 Ga0307416_100904876
661 Ga0307416_101645022
662 Ga0307414_10037871
663 Ga0307414_10362524
664 Ga0307414_10465287
665 Ga0307414_10652274
666 Ga0307411_10077665
667 Ga0307411_10079830
668 Ga0307411_10295367
669 Ga0307411_10929501
670 Ga0307415_100114846
671 Ga0307415_100175633
672 Ga0307415_100191338
673 Ga0307415_100227897
674 Ga0307415_100277254
675 Ga0307415_100338904
676 Ga0307510_10062154
677 Ga0395899_0012530
678 Ga0395900_0313149
679 Ga0395898_0294414
680 Ga0395901_0289708
681 Ga0439436_0042475
682 Ga0439438_008768
683 Ga0439438_025512
684 Ga0439466_0017479
685 Ga0451787_595782
686 Ga0451789_1219731
687 Ga0451791_0632372
688 Ga0451793_0406302
689 Ga0451797_0263790
690 Ga0451795_0928975
691 Ga0451800_0116399
692 Ga0451837_0632316
693 Ga0451837_0979011
694 Ga0451841_0003065
695 Ga0451851_1144122
696 Ga0451843_0031276
697 Ga0451843_0105243
698 Ga0451843_0754130
699 Ga0451843_1094086
700 Ga0451855_1861502
701 Ga0451853_0798652
702 Ga0439433_0002518
703 Ga0439433_0015597
704 Ga0439433_0033977
705 Ga0439442_000215
706 Ga0439442_000558
707 Ga0439442_001217
708 Ga0439442_005664
709 Ga0439432_101737
710 Ga0439449_0000362
711 Ga0439449_0001937
712 Ga0439449_0002813
713 Ga0439449_0062835
714 Ga0439457_017475
715 Ga0439462_0014188
716 Ga0450920_011832
717 Ga0450923_037663
718 Ga0450907_026455
719 Ga0450910_031905
720 Ga0439434_0202562
721 Ga0450918_000176
722 Ga0466969_0006717
723 Ga0466966_0224195
724 Ga0466961_0110179
725 Ga0466970_0080860
726 Ga0466960_0439532
727 Ga0466959_0004703
728 Ga0495638_0234792
729 Ga0495641_0198065
730 Ga0495653_0564836
731 Ga0495582_0112630
732 Ga0495582_0280585
733 Ga0495662_0286846
734 Ga0495596_0061573
735 Ga0495630_0541403
736 Ga0495586_0410348
737 Ga0495667_0175424
738 Ga0495667_0263039
739 Ga0495656_0000366
740 Ga0495668_0117594
741 Ga0495661_0056156
742 Ga0495624_0349123
743 Ga0495670_0001979
744 Ga0495671_0181474
745 Ga0495589_0105683
746 Ga0495581_0498399
747 Ga0495636_0012839
748 Ga0495636_0102441
749 Ga0495674_1029933
750 Ga0495676_0534299
751 Ga0495681_0034215
752 Ga0495593_0217992
753 Ga0495626_0199410
754 Ga0496100_0045549
755 Ga0496100_0622613
756 Ga0496101_0122031
757 Ga0496101_0339330
758 Ga0496102_0096338
759 Ga0496102_0265962
760 Ga0496103_0130345
761 Ga0496104_0033234
762 Ga0496104_0124586
763 Ga0496104_0656071
764 Ga0496105_0566186
765 Ga0496108_0001425
766 Ga0496108_0307542
767 Ga0496109_0123669
768 Ga0496110_0026962
769 Ga0496111_0001420
770 Ga0496111_0926325
771 Ga0496113_0146099
772 Ga0496114_0003059
773 Ga0496114_0023798
774 Ga0496114_0040492
775 Ga0496114_0125792
776 Ga0496114_0140246
777 Ga0496114_0210662
778 Ga0496114_0318095
779 Ga0496114_0367497
780 Ga0496114_0405076
781 Ga0496114_0458412
782 Ga0496114_0692936
783 Ga0496115_0055587
784 Ga0496126_0149908
785 Ga0501308_012702
786 Ga0501305_016269
787 Ga0501311_030283
788 Ga0501313_038078
789 Ga0501316_008794
790 Ga0501318_020016
791 Ga0501325_006873
792 Ga0501325_024931
793 Ga0501031_0005265
794 Ga0501031_0029718
795 Ga0501032_0051450
796 Ga0501032_0247279
797 Ga0501032_0536356
798 Ga0501033_0054522
799 Ga0501033_0085966
800 Ga0501034_0000079
801 Ga0501034_0133714
802 Ga0501036_0027093
803 Ga0501036_0074000
804 Ga0501036_1000288
805 Ga0501037_0019007
806 Ga0501037_0116194
807 Ga0501037_0116680
808 Ga0501038_0017746
809 Ga0501038_0031076
810 Ga0501038_0160621
811 Ga0501039_0011785
812 Ga0501039_0290234
813 Ga0501039_0407008
814 Ga0501040_0009336
815 Ga0501040_0041880
816 Ga0501041_0005879
817 Ga0501041_0053410
818 Ga0501042_0013018
819 Ga0501042_0073131
820 Ga0501043_0009909
821 Ga0501043_0017873
822 Ga0501046_0002178
823 Ga0501046_0113198
824 Ga0501047_0207585
825 Ga0501048_0010553
826 Ga0501068_0006094
827 Ga0501069_0003226
828 Ga0501069_0517862
829 Ga0501070_0002450
830 Ga0501070_0121133
831 Ga0501071_0007458
832 Ga0501071_0129558
833 Ga0501072_0006627
834 Ga0501072_0061262
835 Ga0501073_0043203
836 Ga0501074_0001334
837 Ga0501074_0096909
838 Ga0501075_0010751
839 Ga0501075_0067370
840 Ga0501076_0026422
841 Ga0501077_0002717
842 Ga0501077_0015570
843 Ga0501216_083865
844 Ga0501227_118092
845 Ga0501221_064016
846 Ga0501245_052911
847 Ga0501079_0023627
848 Ga0501079_0116878
849 Ga0501080_0031089
850 Ga0501081_0016557
851 Ga0501081_0213002
852 Ga0501083_0061202
853 Ga0501279_011612
854 Ga0501035_0004561
855 Ga0501044_0019368
856 Ga0501044_0140894
857 Ga0501045_0002845
858 Ga0501045_0032605
859 Ga0501045_0393900
860 Ga0500604_0076419
861 Ga0500616_0002708
862 Ga0500616_0012616
863 Ga0500620_026577
864 Ga0501084_0012602
865 Ga0501084_0075927
866 Ga0587090_029369
867 Ga0501082_0017284
868 Ga0501082_0057972
869 Ga0501082_0375902
870 Ga0530510_0048341
871 2523387692
872 2548692354
873 2643850976
874 2644134716
875 2644506063
876 2644527663
877 2644670716
878 2691515611
879 2731908572
880 2739206911
881 2795780758
882 2808892997
883 2839987747
884 2844849681
885 2857741191
886 2904500428
887 2904776772
888 2910811565
889 2919036323
890 2919059666
891 2919395111
892 2919540770
893 2920880543
894 2928147438
895 2932400696
896 2932426908
897 2933422628
898 2939650065
899 2939677513
900 2945922476
901 2945941322
902 2945960930
903 2946037242
904 2953998489
905 2974305264
906 8054109230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

21

158

0.97

PF02915

Rubrerythrin

Rubrerythrin

22

144

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oj5-assembly1.cif.gz_A mycobacterium tuberculosis ferritin homolog, bfrb 0.9772 3 156
3qd8-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis bfrb 0.9698 4 175
3uno-assembly1.cif.gz_X mycobacterium tuberculosis ferritin homolog, bfrb 0.9655 3 175
5gou-assembly1.cif.gz_G structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.9652 5 119
5gou-assembly1.cif.gz_K structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.9643 5 119
ID Description Score Start End Superfamily
3oj5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9772 3 156 1.20.1260.10
3qd8H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9732 4 175 1.20.1260.10
5gouO00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9675 5 119 1.20.1260.10
3qd8H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9673 4 175 1.20.1260.10
5gouG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9652 5 119 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A7V9F0D0-F1-model_v4 Ferritin 1.001 5 108 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A1G6RPA9-F1-model_v4 Ferritin 0.9904 5 172 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A424HAV6-F1-model_v4 Ferritin (EC 1.16.3.2) 0.9884 7 102 GO:0005737
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-A0A7I9XZU4-F1-model_v4 Ferritin 0.9872 8 157 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199
AF-I0UWL4-F1-model_v4 Ferritin 0.9863 1 172 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008198
GO:0008199

Map