F447115

General Info

Members Datasets Scaffolds Average Seq Length
453 241 906 377

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10058036|Ga0070658_100580362
Length 376
Sequence MNNLLSLPVQIDDPINAAILAVSEDRIQGFQPDPFSEIAVLSEIPVDTVIARVRAMLEAGVIRRVRQTLMATNLAQGSLVAWQIPEEKLNAAFDYMFQQDPFSGHIVIRSTDSATPGSSYRLWTTLKVPQGFSLAKHCEFLCRQTGAEKFLLMPAKRLFALGVGHVRRREMVPGSKSDELANVIGTEIVTLSDLDWQVLTALKREFKPEELVRDLWRARAEEAGVSLETFLEVGASLHARKVIGRFSTFLEHVKPVNEQRVTRYNALFHWAVPGGREIEAGREVGRFDIMTHAYWREGGPEFRNVNIMGVAHGMEKEMVLKHKAAIDAHLAEIGIPVGYTNVFWGGRSEIKPSEIAPQAYLDFCRANNLDSEAMKE

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
184 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
185 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
226 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
227 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
228 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
229 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.22
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.09
Rhizosphere 94.92
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10058036 3300005327 Bacteria 3149
2 rootH2_10013200 3300003320 Bacteria 3489
3 rootH2_10038134 3300003320 Bacteria 9005
4 Ga0065712_10091466 3300005290 Bacteria 2347
5 Ga0065715_10100039 3300005293 Bacteria 3343
6 Ga0070658_10000837 3300005327 Bacteria 26278
7 Ga0070658_10001610 3300005327 Bacteria 19101
8 Ga0070658_10010482 3300005327 Bacteria 7435
9 Ga0070676_10008459 3300005328 Bacteria 5548
10 Ga0070676_10025625 3300005328 Bacteria 3334
11 Ga0070683_100011030 3300005329 Bacteria 7789
12 Ga0070683_100021414 3300005329 Bacteria 5771
13 Ga0070683_100128714 3300005329 Bacteria 2395
14 Ga0070683_100143387 3300005329 Unclassified 2263
15 Ga0070683_100181151 3300005329 Bacteria 2000
16 Ga0070690_100017453 3300005330 Bacteria 4316
17 Ga0070690_100037003 3300005330 Bacteria 3072
18 Ga0070680_100001653 3300005336 Bacteria 16298
19 Ga0070680_100002678 3300005336 Bacteria 13197
20 Ga0070680_100007070 3300005336 Bacteria 8556
21 Ga0070680_100256326 3300005336 Bacteria 1479
22 Ga0068868_100037448 3300005338 Bacteria 3760
23 Ga0070660_100003854 3300005339 Bacteria 10357
24 Ga0070689_100001178 3300005340 Bacteria 16553
25 Ga0070689_100014462 3300005340 Bacteria 5733
26 Ga0070689_100017025 3300005340 Bacteria 5331
27 Ga0070689_100028386 3300005340 Bacteria 4229
28 Ga0070689_100253291 3300005340 Bacteria 1453
29 Ga0070687_100063522 3300005343 Bacteria 1958
30 Ga0070661_100023366 3300005344 Bacteria 4430
31 Ga0070661_100049184 3300005344 Bacteria 3087
32 Ga0070661_100268745 3300005344 Bacteria 1320
33 Ga0070692_10019504 3300005345 Bacteria 3272
34 Ga0070692_10062592 3300005345 Bacteria 1964
35 Ga0070668_100039239 3300005347 Bacteria 3622
36 Ga0070668_100048859 3300005347 Unclassified 3254
37 Ga0070668_100259788 3300005347 Bacteria 1444
38 Ga0070675_100000098 3300005354 Bacteria 50577
39 Ga0070675_100127375 3300005354 Bacteria 2167
40 Ga0070671_100014627 3300005355 Bacteria 6344
41 Ga0070671_100039840 3300005355 Bacteria 3900
42 Ga0070671_100153253 3300005355 Bacteria 1946
43 Ga0070674_100021699 3300005356 Bacteria 4129
44 Ga0070674_100136431 3300005356 Bacteria 1836
45 Ga0070673_100004381 3300005364 Bacteria 8918
46 Ga0070673_100050026 3300005364 Bacteria 3265
47 Ga0070688_100018037 3300005365 Bacteria 4064
48 Ga0070688_100018992 3300005365 Bacteria 3977
49 Ga0070667_100047692 3300005367 Bacteria 3604
50 Ga0070667_100065918 3300005367 Bacteria 3075
51 Ga0070709_10000995 3300005434 Bacteria 15629
52 Ga0070714_100089847 3300005435 Bacteria 2689
53 Ga0070713_100000627 3300005436 Bacteria 22531
54 Ga0070710_10041499 3300005437 Bacteria 2541
55 Ga0070710_10111453 3300005437 Bacteria 1644
56 Ga0070700_100061083 3300005441 Bacteria 2377
57 Ga0070694_100045189 3300005444 Bacteria 2951
58 Ga0070708_100000023 3300005445 Bacteria 110968
59 Ga0070708_100000089 3300005445 Bacteria 59378
60 Ga0070662_100049246 3300005457 Bacteria 3038
61 Ga0070681_10000886 3300005458 Bacteria 25274
62 Ga0070681_10023671 3300005458 Bacteria 6180
63 Ga0070681_10026043 3300005458 Bacteria 5880
64 Ga0070681_10030291 3300005458 Bacteria 5429
65 Ga0070681_10048655 3300005458 Bacteria 4236
66 Ga0068867_100010487 3300005459 Bacteria 6538
67 Ga0070685_10016579 3300005466 Bacteria 3928
68 Ga0070707_100002168 3300005468 Bacteria 18792
69 Ga0070707_100021715 3300005468 Bacteria 6067
70 Ga0070699_100254353 3300005518 Bacteria 1570
71 Ga0070679_100001742 3300005530 Bacteria 19603
72 Ga0070679_100002997 3300005530 Bacteria 15417
73 Ga0070679_100111786 3300005530 Bacteria 2718
74 Ga0070684_100003522 3300005535 Bacteria 11764
75 Ga0070684_100014020 3300005535 Bacteria 6481
76 Ga0070697_100188640 3300005536 Bacteria 1749
77 Ga0068853_100069337 3300005539 Bacteria 3067
78 Ga0068853_100283736 3300005539 Bacteria 1527
79 Ga0070672_100004978 3300005543 Bacteria 8753
80 Ga0070672_100062696 3300005543 Bacteria 2935
81 Ga0070686_100023782 3300005544 Bacteria 3667
82 Ga0070686_100056928 3300005544 Bacteria 2510
83 Ga0070695_100006773 3300005545 Bacteria 6782
84 Ga0070704_100208425 3300005549 Unclassified 1582
85 Ga0068855_100001704 3300005563 Bacteria 27502
86 Ga0068855_100007746 3300005563 Bacteria 12973
87 Ga0068855_100026214 3300005563 Bacteria 6974
88 Ga0070664_100003831 3300005564 Bacteria 12142
89 Ga0070664_100013609 3300005564 Bacteria 6629
90 Ga0070664_100044577 3300005564 Bacteria 3745
91 Ga0070664_100067687 3300005564 Bacteria 3052
92 Ga0070664_100093057 3300005564 Bacteria 2611
93 Ga0068857_100062392 3300005577 Bacteria 3313
94 Ga0068857_100076147 3300005577 Bacteria 2992
95 Ga0068856_100034467 3300005614 Unclassified 4958
96 Ga0068856_100101575 3300005614 Bacteria 2869
97 Ga0068852_100011092 3300005616 Bacteria 6767
98 Ga0068859_100456553 3300005617 Unclassified 1374
99 Ga0068864_100047495 3300005618 Bacteria 3688
100 Ga0068864_100092481 3300005618 Bacteria 2670
101 Ga0068864_100166346 3300005618 Unclassified 2008
102 Ga0068866_10018621 3300005718 Bacteria 3144
103 Ga0068866_10042076 3300005718 Bacteria 2271
104 Ga0068851_10010511 3300005834 Bacteria 4324
105 Ga0068851_10055815 3300005834 Bacteria 2013
106 Ga0068870_10077529 3300005840 Bacteria 1828
107 Ga0068862_100178012 3300005844 Bacteria 1907
108 Ga0081455_10017207 3300005937 Bacteria 6939
109 Ga0081539_10006270 3300005985 Bacteria 11504
110 Ga0097621_100270973 3300006237 Bacteria 1492
111 Ga0075431_100359265 3300006847 Unclassified 1463
112 Ga0075433_10013402 3300006852 Bacteria 6664
113 Ga0075429_100104487 3300006880 Bacteria 2474
114 Ga0068865_100020334 3300006881 Bacteria 4304
115 Ga0068865_100063847 3300006881 Bacteria 2590
116 Ga0068865_100063858 3300006881 Bacteria 2590
117 Ga0075436_100001793 3300006914 Bacteria 14714
118 Ga0097620_100456553 3300006931 Unclassified 1374
119 Ga0105244_10015289 3300009036 Bacteria 4405
120 Ga0105240_10158273 3300009093 Bacteria 2692
121 Ga0105240_10238766 3300009093 Bacteria 2108
122 Ga0111539_10208722 3300009094 Unclassified 2276
123 Ga0105245_10184634 3300009098 Bacteria 1994
124 Ga0105245_10263909 3300009098 Unclassified 1677
125 Ga0114129_10067730 3300009147 Bacteria 4978
126 Ga0105243_10315476 3300009148 Bacteria 1422
127 Ga0105242_10025234 3300009176 Bacteria 4701
128 Ga0105242_10331871 3300009176 Unclassified 1399
129 Ga0105248_10031186 3300009177 Bacteria 5958
130 Ga0105248_10149505 3300009177 Bacteria 2635
131 Ga0105248_10188389 3300009177 Bacteria 2324
132 Ga0105248_10333119 3300009177 Bacteria 1709
133 Ga0105237_10000024 3300009545 Bacteria 223776
134 Ga0105238_10006945 3300009551 Bacteria 11312
135 Ga0105238_10010469 3300009551 Bacteria 9308
136 Ga0105249_10000154 3300009553 Bacteria 85161
137 Ga0105239_10023293 3300010375 Bacteria 6821
138 Ga0105239_10130604 3300010375 Bacteria 2794
139 Ga0105239_10275358 3300010375 Bacteria 1894
140 Ga0157371_10029629 3300013102 Bacteria 3956
141 Ga0157370_10011435 3300013104 Bacteria 9280
142 Ga0157370_10042886 3300013104 Bacteria 4357
143 Ga0157369_10021224 3300013105 Bacteria 7262
144 Ga0157369_10134713 3300013105 Bacteria 2616
145 Ga0157369_10153206 3300013105 Bacteria 2436
146 Ga0157369_10354356 3300013105 Unclassified 1524
147 Ga0157378_10007117 3300013297 Bacteria 9768
148 Ga0157372_10001161 3300013307 Bacteria 28502
149 Ga0157372_10009123 3300013307 Bacteria 10537
150 Ga0157372_10009354 3300013307 Bacteria 10430
151 Ga0157372_10009764 3300013307 Bacteria 10206
152 Ga0157372_10011837 3300013307 Bacteria 9292
153 Ga0157372_10013103 3300013307 Bacteria 8846
154 Ga0157372_10059900 3300013307 Bacteria 4260
155 Ga0157372_10075923 3300013307 Bacteria 3793
156 Ga0157372_10152399 3300013307 Unclassified 2669
157 Ga0157372_10177085 3300013307 Bacteria 2469
158 Ga0157372_10200810 3300013307 Unclassified 2309
159 Ga0157372_10203196 3300013307 Bacteria 2295
160 Ga0157372_10297222 3300013307 Bacteria 1878
161 Ga0157375_10044480 3300013308 Bacteria 4315
162 Ga0157375_10089556 3300013308 Unclassified 3134
163 Ga0157375_10098535 3300013308 Unclassified 3000
164 Ga0157375_10137625 3300013308 Unclassified 2567
165 Ga0182008_10003781 3300014497 Bacteria 8998
166 Ga0157376_10029328 3300014969 Bacteria 4382
167 Ga0157376_10070432 3300014969 Bacteria 2968
168 Ga0206353_11213799 3300020082 Bacteria 1832
169 Ga0213872_10041401 3300021361 Unclassified 2103
170 Ga0213875_10000028 3300021388 Bacteria 187813
171 Ga0213875_10002452 3300021388 Bacteria 11074
172 Ga0207655_1027913 3300025728 Bacteria 2674
173 Ga0207692_10063714 3300025898 Bacteria 1917
174 Ga0207680_10064137 3300025903 Bacteria 2251
175 Ga0207699_10025623 3300025906 Bacteria 3239
176 Ga0207645_10014923 3300025907 Bacteria 5181
177 Ga0207645_10036793 3300025907 Unclassified 3143
178 Ga0207643_10014017 3300025908 Bacteria 4349
179 Ga0207705_10001150 3300025909 Bacteria 21556
180 Ga0207705_10001556 3300025909 Bacteria 18213
181 Ga0207705_10010568 3300025909 Bacteria 6709
182 Ga0207705_10034022 3300025909 Bacteria 3643
183 Ga0207705_10068013 3300025909 Bacteria 2578
184 Ga0207705_10147678 3300025909 Viruses 1760
185 Ga0207705_10289546 3300025909 Bacteria 1255
186 Ga0207707_10000957 3300025912 Bacteria 27832
187 Ga0207707_10003819 3300025912 Bacteria 13344
188 Ga0207707_10119735 3300025912 Unclassified 2301
189 Ga0207695_10010324 3300025913 Bacteria 11433
190 Ga0207695_10293607 3300025913 Bacteria 1517
191 Ga0207671_10000051 3300025914 Bacteria 189023
192 Ga0207693_10020821 3300025915 Bacteria 5215
193 Ga0207660_10019376 3300025917 Bacteria 4548
194 Ga0207660_10027959 3300025917 Bacteria 3854
195 Ga0207660_10129934 3300025917 Bacteria 1916
196 Ga0207660_10204601 3300025917 Bacteria 1543
197 Ga0207662_10065923 3300025918 Bacteria 2181
198 Ga0207657_10005898 3300025919 Bacteria 12757
199 Ga0207657_10041237 3300025919 Bacteria 4083
200 Ga0207657_10111167 3300025919 Bacteria 2263
201 Ga0207649_10080621 3300025920 Bacteria 2105
202 Ga0207652_10003948 3300025921 Bacteria 12128
203 Ga0207652_10020732 3300025921 Bacteria 5416
204 Ga0207652_10043502 3300025921 Bacteria 3824
205 Ga0207652_10059111 3300025921 Bacteria 3304
206 Ga0207652_10174741 3300025921 Bacteria 1929
207 Ga0207646_10019454 3300025922 Bacteria 6311
208 Ga0207646_10181970 3300025922 Bacteria 1898
209 Ga0207694_10018320 3300025924 Bacteria 5292
210 Ga0207694_10140890 3300025924 Unclassified 1939
211 Ga0207659_10000002 3300025926 Bacteria 619441
212 Ga0207687_10097424 3300025927 Bacteria 2157
213 Ga0207687_10192125 3300025927 Bacteria 1590
214 Ga0207664_10021034 3300025929 Bacteria 4843
215 Ga0207644_10016145 3300025931 Bacteria 5023
216 Ga0207644_10026125 3300025931 Unclassified 4022
217 Ga0207644_10056270 3300025931 Bacteria 2838
218 Ga0207706_10017024 3300025933 Bacteria 6558
219 Ga0207706_10069942 3300025933 Bacteria 3087
220 Ga0207706_10121438 3300025933 Bacteria 2297
221 Ga0207686_10078210 3300025934 Unclassified 2150
222 Ga0207670_10002971 3300025936 Bacteria 8952
223 Ga0207670_10010299 3300025936 Bacteria 5378
224 Ga0207669_10115061 3300025937 Bacteria 1812
225 Ga0207665_10002097 3300025939 Bacteria 13473
226 Ga0207691_10014209 3300025940 Bacteria 7595
227 Ga0207691_10018313 3300025940 Bacteria 6634
228 Ga0207691_10059931 3300025940 Bacteria 3460
229 Ga0207691_10130754 3300025940 Bacteria 2218
230 Ga0207691_10187513 3300025940 Bacteria 1805
231 Ga0207689_10018651 3300025942 Bacteria 5853
232 Ga0207689_10087637 3300025942 Bacteria 2557
233 Ga0207661_10005755 3300025944 Bacteria 8740
234 Ga0207661_10014349 3300025944 Bacteria 5805
235 Ga0207661_10021159 3300025944 Bacteria 4874
236 Ga0207661_10026317 3300025944 Bacteria 4430
237 Ga0207661_10116850 3300025944 Unclassified 2265
238 Ga0207661_10207039 3300025944 Bacteria 1727
239 Ga0207679_10007187 3300025945 Bacteria 7054
240 Ga0207679_10015583 3300025945 Bacteria 5028
241 Ga0207679_10075412 3300025945 Bacteria 2559
242 Ga0207679_10205595 3300025945 Unclassified 1648
243 Ga0207667_10000608 3300025949 Bacteria 46265
244 Ga0207667_10039129 3300025949 Bacteria 5056
245 Ga0207667_10203386 3300025949 Bacteria 2031
246 Ga0207651_10072159 3300025960 Bacteria 2450
247 Ga0207712_10000786 3300025961 Bacteria 23571
248 Ga0207668_10029227 3300025972 Bacteria 3611
249 Ga0207668_10146712 3300025972 Bacteria 1821
250 Ga0207640_10214628 3300025981 Unclassified 1469
251 Ga0207658_10037506 3300025986 Bacteria 3484
252 Ga0207658_10064827 3300025986 Bacteria 2742
253 Ga0207677_10009371 3300026023 Bacteria 5510
254 Ga0207703_10204216 3300026035 Unclassified 1757
255 Ga0207639_10025594 3300026041 Bacteria 4279
256 Ga0207639_10032136 3300026041 Bacteria 3862
257 Ga0207708_10005090 3300026075 Bacteria 9698
258 Ga0207702_10153961 3300026078 Unclassified 2094
259 Ga0207648_10016281 3300026089 Bacteria 6801
260 Ga0207648_10018268 3300026089 Bacteria 6352
261 Ga0207676_10103780 3300026095 Bacteria 2363
262 Ga0207676_10105860 3300026095 Bacteria 2343
263 Ga0207674_10031916 3300026116 Bacteria 5529
264 Ga0207674_10137661 3300026116 Bacteria 2402
265 Ga0207674_10277000 3300026116 Bacteria 1625
266 Ga0207675_100165618 3300026118 Unclassified 2111
267 Ga0207698_10003893 3300026142 Bacteria 9039
268 Ga0207698_10229911 3300026142 Bacteria 1683
269 Ga0209968_1001885 3300027526 Bacteria 3181
270 Ga0209966_1001442 3300027695 Bacteria 4125
271 Ga0209998_10000439 3300027717 Bacteria 11589
272 Ga0268266_10245310 3300028379 Bacteria 1655
273 Ga0265338_10008675 3300028800 Bacteria 12298
274 Ga0265339_10022589 3300031249 Bacteria 3644
275 Ga0307408_100179988 3300031548 Unclassified 1695
276 Ga0307405_10002933 3300031731 Bacteria 7697
277 Ga0307405_10019835 3300031731 Bacteria 3744
278 Ga0307413_10001710 3300031824 Bacteria 8568
279 Ga0307413_10004656 3300031824 Bacteria 6007
280 Ga0307413_10043124 3300031824 Bacteria 2656
281 Ga0307410_10005451 3300031852 Bacteria 6738
282 Ga0307410_10017051 3300031852 Bacteria 4349
283 Ga0307406_10002391 3300031901 Bacteria 10198
284 Ga0307406_10009613 3300031901 Bacteria 5434
285 Ga0307407_10004058 3300031903 Bacteria 6145
286 Ga0307412_10014955 3300031911 Bacteria 4589
287 Ga0307412_10182084 3300031911 Bacteria 1581
288 Ga0307412_10286570 3300031911 Bacteria 1295
289 Ga0307409_100018811 3300031995 Bacteria 4658
290 Ga0307409_100034395 3300031995 Bacteria 3700
291 Ga0307416_100012696 3300032002 Bacteria 5688
292 Ga0307416_100013753 3300032002 Bacteria 5513
293 Ga0307416_100023455 3300032002 Bacteria 4478
294 Ga0307416_100039595 3300032002 Bacteria 3651
295 Ga0307416_100145890 3300032002 Bacteria 2160
296 Ga0307416_100182901 3300032002 Bacteria 1967
297 Ga0307414_10039498 3300032004 Bacteria 3179
298 Ga0307414_10063714 3300032004 Bacteria 2621
299 Ga0307414_10222303 3300032004 Bacteria 1551
300 Ga0307411_10002091 3300032005 Bacteria 8610
301 Ga0307411_10025698 3300032005 Bacteria 3533
302 Ga0307415_100001104 3300032126 Bacteria 12578
303 Ga0307415_100032698 3300032126 Bacteria 3367
304 Ga0307415_100035338 3300032126 Bacteria 3263
305 Ga0373934_0000293 3300035086 Bacteria 17846
306 Ga0373940_0014858 3300035088 Bacteria 1906
307 Ga0373923_0000953 3300035111 Bacteria 7771
308 Ga0373953_0008744 3300035117 Bacteria 3451
309 Ga0373954_0050103 3300035118 Bacteria 1959
310 Ga0373956_0004282 3300035119 Bacteria 5738
311 Ga0373956_0016120 3300035119 Bacteria 3135
312 Ga0373956_0076410 3300035119 Bacteria 1532
313 Ga0373943_0021266 3300035170 Unclassified 2995
314 Ga0373955_0000221 3300035172 Bacteria 24036
315 Ga0373955_0002915 3300035172 Bacteria 7511
316 Ga0373942_0007227 3300035207 Bacteria 2573
317 Ga0373924_0010760 3300035410 Bacteria 3385
318 Ga0373931_0025756 3300035691 Bacteria 2987
319 Ga0373933_0000102 3300035724 Bacteria 53886
320 Ga0373933_0075247 3300035724 Bacteria 2061
321 Ga0373937_0024220 3300036401 Bacteria 5472
322 Ga0373937_0032696 3300036401 Bacteria 4719
323 Ga0373937_0079280 3300036401 Bacteria 3035
324 Ga0373937_0147929 3300036401 Bacteria 2199
325 Ga0373925_0051489 3300037068 Bacteria 3074
326 Ga0395900_0020766 3300037418 Bacteria 6713
327 Ga0395898_0019284 3300037466 Bacteria 6944
328 Ga0436364_0302973 3300037853 Bacteria 187060
329 Ga0436364_0723312 3300037853 Bacteria 4639
330 Ga0436364_1199243 3300037853 Bacteria 14680
331 Ga0436365_0980620 3300039437 Bacteria 3639
332 Ga0436361_1023092 3300039447 Bacteria 2425
333 Ga0466965_0014841 3300044683 Bacteria 3692
334 Ga0453684_0017443 3300044712 Bacteria 11120
335 Ga0453684_0295999 3300044712 Bacteria 1841
336 Ga0451576_0013837 3300045051 Bacteria 9014
337 Ga0466958_0194649 3300045836 Bacteria 1289
338 Ga0466967_0072597 3300045976 Bacteria 3085
339 Ga0466967_0275219 3300045976 Bacteria 1614
340 Ga0495592_0002514 3300046454 Bacteria 12943
341 Ga0495629_0011938 3300046459 Bacteria 6300
342 Ga0495629_0126325 3300046459 Bacteria 1781
343 Ga0495651_0000949 3300046462 Bacteria 22417
344 Ga0495651_0023642 3300046462 Bacteria 4778
345 Ga0495651_0108192 3300046462 Bacteria 2059
346 Ga0495653_0000136 3300046463 Bacteria 60956
347 Ga0495653_0006579 3300046463 Bacteria 9541
348 Ga0495580_0019794 3300046472 Bacteria 4995
349 Ga0495580_0028050 3300046472 Bacteria 4094
350 Ga0495582_0049659 3300046473 Bacteria 2310
351 Ga0495664_0002444 3300046477 Bacteria 9992
352 Ga0495594_0005739 3300046499 Bacteria 6376
353 Ga0495594_0009373 3300046499 Bacteria 5055
354 Ga0495594_0012761 3300046499 Bacteria 4384
355 Ga0495608_0002264 3300046511 Bacteria 13898
356 Ga0495608_0062635 3300046511 Bacteria 2443
357 Ga0495628_0000089 3300046516 Bacteria 72154
358 Ga0495628_0015376 3300046516 Bacteria 6391
359 Ga0495630_0012600 3300046517 Bacteria 6143
360 Ga0495630_0118806 3300046517 Bacteria 2005
361 Ga0495652_0006562 3300046529 Bacteria 10809
362 Ga0495652_0018362 3300046529 Bacteria 6237
363 Ga0495652_0029452 3300046529 Bacteria 4823
364 Ga0495587_0000615 3300046536 Bacteria 24191
365 Ga0495587_0005246 3300046536 Bacteria 8470
366 Ga0495587_0099471 3300046536 Bacteria 1676
367 Ga0495621_0031087 3300046539 Bacteria 1829
368 Ga0495645_0000280 3300046543 Bacteria 37539
369 Ga0495645_0002348 3300046543 Bacteria 12843
370 Ga0495645_0007638 3300046543 Bacteria 7523
371 Ga0495667_0000181 3300046559 Bacteria 42708
372 Ga0495667_0001849 3300046559 Bacteria 14046
373 Ga0495667_0013762 3300046559 Bacteria 5465
374 Ga0495634_0065205 3300046642 Unclassified 2414
375 Ga0495635_0000136 3300046663 Bacteria 44401
376 Ga0495588_0145597 3300046674 Bacteria 1252
377 Ga0495657_0004517 3300046675 Bacteria 11132
378 Ga0495657_0071110 3300046675 Bacteria 2272
379 Ga0495657_0071742 3300046675 Bacteria 2260
380 Ga0495599_0000601 3300046678 Bacteria 20506
381 Ga0495599_0002871 3300046678 Bacteria 10040
382 Ga0495599_0010665 3300046678 Bacteria 5625
383 Ga0495623_0000010 3300046679 Bacteria 121464
384 Ga0495623_0005960 3300046679 Bacteria 7941
385 Ga0495623_0007560 3300046679 Bacteria 7052
386 Ga0495623_0019159 3300046679 Bacteria 4422
387 Ga0495623_0054918 3300046679 Bacteria 2512
388 Ga0495646_0000567 3300046680 Bacteria 20079
389 Ga0495646_0037893 3300046680 Bacteria 2980
390 Ga0495658_0043137 3300046683 Bacteria 2521
391 Ga0495613_0005910 3300046689 Bacteria 9160
392 Ga0495600_0004388 3300046809 Bacteria 8439
393 Ga0495600_0063365 3300046809 Unclassified 2416
394 Ga0495581_0018760 3300047315 Bacteria 4016
395 Ga0495581_0060966 3300047315 Bacteria 2180
396 Ga0495604_0037388 3300047317 Bacteria 3824
397 Ga0495604_0098077 3300047317 Bacteria 2160
398 Ga0495674_0001825 3300047319 Bacteria 20995
399 Ga0495674_0018549 3300047319 Bacteria 6476
400 Ga0495674_0047416 3300047319 Bacteria 3811
401 Ga0495672_0009429 3300047320 Bacteria 7074
402 Ga0495680_0004549 3300047322 Bacteria 13250
403 Ga0495675_0002190 3300047444 Bacteria 11649
404 Ga0495675_0007627 3300047444 Bacteria 6672
405 Ga0495684_0001752 3300047471 Bacteria 17428
406 Ga0495684_0007379 3300047471 Bacteria 8519
407 Ga0495684_0011574 3300047471 Bacteria 6811
408 Ga0495684_0058855 3300047471 Bacteria 2926
409 Ga0495602_0000308 3300048088 Bacteria 45250
410 Ga0495602_0009083 3300048088 Bacteria 10348
411 Ga0495602_0078918 3300048088 Bacteria 2779
412 Ga0495602_0098236 3300048088 Bacteria 2410
413 Ga0496100_0162260 3300048903 Bacteria 1603
414 Ga0496104_0060753 3300048907 Bacteria 3581
415 Ga0496104_0193156 3300048907 Bacteria 1948
416 Ga0496106_0224266 3300048909 Bacteria 1499
417 Ga0496108_0063618 3300048911 Bacteria 3107
418 Ga0496108_0154665 3300048911 Bacteria 1980
419 Ga0496109_0123802 3300048912 Unclassified 2410
420 Ga0496109_0303099 3300048912 Bacteria 1507
421 Ga0496109_0374262 3300048912 Bacteria 1345
422 Ga0496112_0001391 3300048915 Bacteria 18471
423 Ga0496112_0014840 3300048915 Bacteria 7246
424 Ga0496112_0163924 3300048915 Bacteria 2189
425 Ga0496113_0012643 3300048916 Bacteria 5681
426 Ga0496115_0213378 3300048918 Unclassified 1594
427 Ga0501032_0013110 3300049569 Bacteria 5904
428 Ga0501034_0002872 3300049571 Bacteria 20038
429 Ga0501037_0199166 3300049573 Unclassified 1416
430 Ga0501038_0051481 3300049574 Bacteria 3553
431 Ga0501043_0027416 3300049579 Bacteria 4472
432 Ga0501047_0002061 3300049581 Bacteria 19214
433 Ga0501070_0013855 3300049586 Bacteria 6792
434 Ga0501070_0107817 3300049586 Unclassified 2302
435 Ga0501080_0081956 3300049742 Bacteria 2997
436 Ga0501263_000169 3300049760 Unclassified 3892
437 Ga0501265_003086 3300049762 Bacteria 1894
438 Ga0501269_002773 3300049766 Unclassified 2136
439 Ga0501270_000718 3300049767 Unclassified 2929
440 Ga0501274_001629 3300049771 Bacteria 1725
441 Ga0501035_0041901 3300049822 Bacteria 4132
442 Ga0501044_0042705 3300049823 Bacteria 4714
443 nmdc:mga09592_99214_c1 3300050508 Bacteria 2493
444 nmdc:mga06r32_346192_c1 3300050510 Unclassified 1471
445 nmdc:mga08y16_199353_c1 3300050511 Unclassified 2074
446 nmdc:mga0n895_13980_c1 3300050512 Bacteria 7270
447 nmdc:mga0a205_60926_c1 3300050515 Bacteria 3645
448 Ga0495601_0007217 3300053077 Bacteria 6519
449 Ga0495612_0000663 3300053078 Bacteria 13886
450 Ga0495619_0000482 3300053085 Bacteria 26726
451 Ga0495619_0072119 3300053085 Bacteria 2312
452 Ga0530510_0135792 3300061734 Bacteria 1811
453 2837184887 2837183177 Bacteria 4637169
454 Ga0070658_10058036
455 rootH2_10013200
456 rootH2_10038134
457 Ga0065712_10091466
458 Ga0065715_10100039
459 Ga0070658_10000837
460 Ga0070658_10001610
461 Ga0070658_10010482
462 Ga0070676_10008459
463 Ga0070676_10025625
464 Ga0070683_100011030
465 Ga0070683_100021414
466 Ga0070683_100128714
467 Ga0070683_100143387
468 Ga0070683_100181151
469 Ga0070690_100017453
470 Ga0070690_100037003
471 Ga0070680_100001653
472 Ga0070680_100002678
473 Ga0070680_100007070
474 Ga0070680_100256326
475 Ga0068868_100037448
476 Ga0070660_100003854
477 Ga0070689_100001178
478 Ga0070689_100014462
479 Ga0070689_100017025
480 Ga0070689_100028386
481 Ga0070689_100253291
482 Ga0070687_100063522
483 Ga0070661_100023366
484 Ga0070661_100049184
485 Ga0070661_100268745
486 Ga0070692_10019504
487 Ga0070692_10062592
488 Ga0070668_100039239
489 Ga0070668_100048859
490 Ga0070668_100259788
491 Ga0070675_100000098
492 Ga0070675_100127375
493 Ga0070671_100014627
494 Ga0070671_100039840
495 Ga0070671_100153253
496 Ga0070674_100021699
497 Ga0070674_100136431
498 Ga0070673_100004381
499 Ga0070673_100050026
500 Ga0070688_100018037
501 Ga0070688_100018992
502 Ga0070667_100047692
503 Ga0070667_100065918
504 Ga0070709_10000995
505 Ga0070714_100089847
506 Ga0070713_100000627
507 Ga0070710_10041499
508 Ga0070710_10111453
509 Ga0070700_100061083
510 Ga0070694_100045189
511 Ga0070708_100000023
512 Ga0070708_100000089
513 Ga0070662_100049246
514 Ga0070681_10000886
515 Ga0070681_10023671
516 Ga0070681_10026043
517 Ga0070681_10030291
518 Ga0070681_10048655
519 Ga0068867_100010487
520 Ga0070685_10016579
521 Ga0070707_100002168
522 Ga0070707_100021715
523 Ga0070699_100254353
524 Ga0070679_100001742
525 Ga0070679_100002997
526 Ga0070679_100111786
527 Ga0070684_100003522
528 Ga0070684_100014020
529 Ga0070697_100188640
530 Ga0068853_100069337
531 Ga0068853_100283736
532 Ga0070672_100004978
533 Ga0070672_100062696
534 Ga0070686_100023782
535 Ga0070686_100056928
536 Ga0070695_100006773
537 Ga0070704_100208425
538 Ga0068855_100001704
539 Ga0068855_100007746
540 Ga0068855_100026214
541 Ga0070664_100003831
542 Ga0070664_100013609
543 Ga0070664_100044577
544 Ga0070664_100067687
545 Ga0070664_100093057
546 Ga0068857_100062392
547 Ga0068857_100076147
548 Ga0068856_100034467
549 Ga0068856_100101575
550 Ga0068852_100011092
551 Ga0068859_100456553
552 Ga0068864_100047495
553 Ga0068864_100092481
554 Ga0068864_100166346
555 Ga0068866_10018621
556 Ga0068866_10042076
557 Ga0068851_10010511
558 Ga0068851_10055815
559 Ga0068870_10077529
560 Ga0068862_100178012
561 Ga0081455_10017207
562 Ga0081539_10006270
563 Ga0097621_100270973
564 Ga0075431_100359265
565 Ga0075433_10013402
566 Ga0075429_100104487
567 Ga0068865_100020334
568 Ga0068865_100063847
569 Ga0068865_100063858
570 Ga0075436_100001793
571 Ga0097620_100456553
572 Ga0105244_10015289
573 Ga0105240_10158273
574 Ga0105240_10238766
575 Ga0111539_10208722
576 Ga0105245_10184634
577 Ga0105245_10263909
578 Ga0114129_10067730
579 Ga0105243_10315476
580 Ga0105242_10025234
581 Ga0105242_10331871
582 Ga0105248_10031186
583 Ga0105248_10149505
584 Ga0105248_10188389
585 Ga0105248_10333119
586 Ga0105237_10000024
587 Ga0105238_10006945
588 Ga0105238_10010469
589 Ga0105249_10000154
590 Ga0105239_10023293
591 Ga0105239_10130604
592 Ga0105239_10275358
593 Ga0157371_10029629
594 Ga0157370_10011435
595 Ga0157370_10042886
596 Ga0157369_10021224
597 Ga0157369_10134713
598 Ga0157369_10153206
599 Ga0157369_10354356
600 Ga0157378_10007117
601 Ga0157372_10001161
602 Ga0157372_10009123
603 Ga0157372_10009354
604 Ga0157372_10009764
605 Ga0157372_10011837
606 Ga0157372_10013103
607 Ga0157372_10059900
608 Ga0157372_10075923
609 Ga0157372_10152399
610 Ga0157372_10177085
611 Ga0157372_10200810
612 Ga0157372_10203196
613 Ga0157372_10297222
614 Ga0157375_10044480
615 Ga0157375_10089556
616 Ga0157375_10098535
617 Ga0157375_10137625
618 Ga0182008_10003781
619 Ga0157376_10029328
620 Ga0157376_10070432
621 Ga0206353_11213799
622 Ga0213872_10041401
623 Ga0213875_10000028
624 Ga0213875_10002452
625 Ga0207655_1027913
626 Ga0207692_10063714
627 Ga0207680_10064137
628 Ga0207699_10025623
629 Ga0207645_10014923
630 Ga0207645_10036793
631 Ga0207643_10014017
632 Ga0207705_10001150
633 Ga0207705_10001556
634 Ga0207705_10010568
635 Ga0207705_10034022
636 Ga0207705_10068013
637 Ga0207705_10147678
638 Ga0207705_10289546
639 Ga0207707_10000957
640 Ga0207707_10003819
641 Ga0207707_10119735
642 Ga0207695_10010324
643 Ga0207695_10293607
644 Ga0207671_10000051
645 Ga0207693_10020821
646 Ga0207660_10019376
647 Ga0207660_10027959
648 Ga0207660_10129934
649 Ga0207660_10204601
650 Ga0207662_10065923
651 Ga0207657_10005898
652 Ga0207657_10041237
653 Ga0207657_10111167
654 Ga0207649_10080621
655 Ga0207652_10003948
656 Ga0207652_10020732
657 Ga0207652_10043502
658 Ga0207652_10059111
659 Ga0207652_10174741
660 Ga0207646_10019454
661 Ga0207646_10181970
662 Ga0207694_10018320
663 Ga0207694_10140890
664 Ga0207659_10000002
665 Ga0207687_10097424
666 Ga0207687_10192125
667 Ga0207664_10021034
668 Ga0207644_10016145
669 Ga0207644_10026125
670 Ga0207644_10056270
671 Ga0207706_10017024
672 Ga0207706_10069942
673 Ga0207706_10121438
674 Ga0207686_10078210
675 Ga0207670_10002971
676 Ga0207670_10010299
677 Ga0207669_10115061
678 Ga0207665_10002097
679 Ga0207691_10014209
680 Ga0207691_10018313
681 Ga0207691_10059931
682 Ga0207691_10130754
683 Ga0207691_10187513
684 Ga0207689_10018651
685 Ga0207689_10087637
686 Ga0207661_10005755
687 Ga0207661_10014349
688 Ga0207661_10021159
689 Ga0207661_10026317
690 Ga0207661_10116850
691 Ga0207661_10207039
692 Ga0207679_10007187
693 Ga0207679_10015583
694 Ga0207679_10075412
695 Ga0207679_10205595
696 Ga0207667_10000608
697 Ga0207667_10039129
698 Ga0207667_10203386
699 Ga0207651_10072159
700 Ga0207712_10000786
701 Ga0207668_10029227
702 Ga0207668_10146712
703 Ga0207640_10214628
704 Ga0207658_10037506
705 Ga0207658_10064827
706 Ga0207677_10009371
707 Ga0207703_10204216
708 Ga0207639_10025594
709 Ga0207639_10032136
710 Ga0207708_10005090
711 Ga0207702_10153961
712 Ga0207648_10016281
713 Ga0207648_10018268
714 Ga0207676_10103780
715 Ga0207676_10105860
716 Ga0207674_10031916
717 Ga0207674_10137661
718 Ga0207674_10277000
719 Ga0207675_100165618
720 Ga0207698_10003893
721 Ga0207698_10229911
722 Ga0209968_1001885
723 Ga0209966_1001442
724 Ga0209998_10000439
725 Ga0268266_10245310
726 Ga0265338_10008675
727 Ga0265339_10022589
728 Ga0307408_100179988
729 Ga0307405_10002933
730 Ga0307405_10019835
731 Ga0307413_10001710
732 Ga0307413_10004656
733 Ga0307413_10043124
734 Ga0307410_10005451
735 Ga0307410_10017051
736 Ga0307406_10002391
737 Ga0307406_10009613
738 Ga0307407_10004058
739 Ga0307412_10014955
740 Ga0307412_10182084
741 Ga0307412_10286570
742 Ga0307409_100018811
743 Ga0307409_100034395
744 Ga0307416_100012696
745 Ga0307416_100013753
746 Ga0307416_100023455
747 Ga0307416_100039595
748 Ga0307416_100145890
749 Ga0307416_100182901
750 Ga0307414_10039498
751 Ga0307414_10063714
752 Ga0307414_10222303
753 Ga0307411_10002091
754 Ga0307411_10025698
755 Ga0307415_100001104
756 Ga0307415_100032698
757 Ga0307415_100035338
758 Ga0373934_0000293
759 Ga0373940_0014858
760 Ga0373923_0000953
761 Ga0373953_0008744
762 Ga0373954_0050103
763 Ga0373956_0004282
764 Ga0373956_0016120
765 Ga0373956_0076410
766 Ga0373943_0021266
767 Ga0373955_0000221
768 Ga0373955_0002915
769 Ga0373942_0007227
770 Ga0373924_0010760
771 Ga0373931_0025756
772 Ga0373933_0000102
773 Ga0373933_0075247
774 Ga0373937_0024220
775 Ga0373937_0032696
776 Ga0373937_0079280
777 Ga0373937_0147929
778 Ga0373925_0051489
779 Ga0395900_0020766
780 Ga0395898_0019284
781 Ga0436364_0302973
782 Ga0436364_0723312
783 Ga0436364_1199243
784 Ga0436365_0980620
785 Ga0436361_1023092
786 Ga0466965_0014841
787 Ga0453684_0017443
788 Ga0453684_0295999
789 Ga0451576_0013837
790 Ga0466958_0194649
791 Ga0466967_0072597
792 Ga0466967_0275219
793 Ga0495592_0002514
794 Ga0495629_0011938
795 Ga0495629_0126325
796 Ga0495651_0000949
797 Ga0495651_0023642
798 Ga0495651_0108192
799 Ga0495653_0000136
800 Ga0495653_0006579
801 Ga0495580_0019794
802 Ga0495580_0028050
803 Ga0495582_0049659
804 Ga0495664_0002444
805 Ga0495594_0005739
806 Ga0495594_0009373
807 Ga0495594_0012761
808 Ga0495608_0002264
809 Ga0495608_0062635
810 Ga0495628_0000089
811 Ga0495628_0015376
812 Ga0495630_0012600
813 Ga0495630_0118806
814 Ga0495652_0006562
815 Ga0495652_0018362
816 Ga0495652_0029452
817 Ga0495587_0000615
818 Ga0495587_0005246
819 Ga0495587_0099471
820 Ga0495621_0031087
821 Ga0495645_0000280
822 Ga0495645_0002348
823 Ga0495645_0007638
824 Ga0495667_0000181
825 Ga0495667_0001849
826 Ga0495667_0013762
827 Ga0495634_0065205
828 Ga0495635_0000136
829 Ga0495588_0145597
830 Ga0495657_0004517
831 Ga0495657_0071110
832 Ga0495657_0071742
833 Ga0495599_0000601
834 Ga0495599_0002871
835 Ga0495599_0010665
836 Ga0495623_0000010
837 Ga0495623_0005960
838 Ga0495623_0007560
839 Ga0495623_0019159
840 Ga0495623_0054918
841 Ga0495646_0000567
842 Ga0495646_0037893
843 Ga0495658_0043137
844 Ga0495613_0005910
845 Ga0495600_0004388
846 Ga0495600_0063365
847 Ga0495581_0018760
848 Ga0495581_0060966
849 Ga0495604_0037388
850 Ga0495604_0098077
851 Ga0495674_0001825
852 Ga0495674_0018549
853 Ga0495674_0047416
854 Ga0495672_0009429
855 Ga0495680_0004549
856 Ga0495675_0002190
857 Ga0495675_0007627
858 Ga0495684_0001752
859 Ga0495684_0007379
860 Ga0495684_0011574
861 Ga0495684_0058855
862 Ga0495602_0000308
863 Ga0495602_0009083
864 Ga0495602_0078918
865 Ga0495602_0098236
866 Ga0496100_0162260
867 Ga0496104_0060753
868 Ga0496104_0193156
869 Ga0496106_0224266
870 Ga0496108_0063618
871 Ga0496108_0154665
872 Ga0496109_0123802
873 Ga0496109_0303099
874 Ga0496109_0374262
875 Ga0496112_0001391
876 Ga0496112_0014840
877 Ga0496112_0163924
878 Ga0496113_0012643
879 Ga0496115_0213378
880 Ga0501032_0013110
881 Ga0501034_0002872
882 Ga0501037_0199166
883 Ga0501038_0051481
884 Ga0501043_0027416
885 Ga0501047_0002061
886 Ga0501070_0013855
887 Ga0501070_0107817
888 Ga0501080_0081956
889 Ga0501263_000169
890 Ga0501265_003086
891 Ga0501269_002773
892 Ga0501270_000718
893 Ga0501274_001629
894 Ga0501035_0041901
895 Ga0501044_0042705
896 nmdc:mga09592_99214_c1
897 nmdc:mga06r32_346192_c1
898 nmdc:mga08y16_199353_c1
899 nmdc:mga0n895_13980_c1
900 nmdc:mga0a205_60926_c1
901 Ga0495601_0007217
902 Ga0495612_0000663
903 Ga0495619_0000482
904 Ga0495619_0072119
905 Ga0530510_0135792
906 2837184887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17805

AsnC_trans_reg2

AsnC-like ligand binding domain

74

160

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4czc-assembly1.cif.gz_A crystal structure of the siroheme decarboxylase nirdl in co-complex with iron-uroporphyrin iii analogue 0.7935 21 374
4czc-assembly1.cif.gz_A crystal structure of the siroheme decarboxylase nirdl in co-complex with iron-uroporphyrin iii analogue 0.7866 21 374
4ch7-assembly1.cif.gz_A crystal structure of the siroheme decarboxylase nirdl 0.7836 19 374
4ch7-assembly1.cif.gz_A crystal structure of the siroheme decarboxylase nirdl 0.7703 19 374
7wup-assembly1.cif.gz_B the crystal structure of apii 0.7003 21 70
ID Description Score Start End Superfamily
4czcA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.83 21 253 1.10.10.2890
3gwzA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8294 41 70 1.10.10.10
af_D3KU66_7_100_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8277 41 72 1.10.10.10
4czcA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.8038 21 253 1.10.10.2890
4czcA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7806 83 374 3.30.70.3460
ID Description Score Start End GO Terms
AF-A0A2E8SPV6-F1-model_v4 AsnC family transcriptional regulator 0.9758 112 383
AF-A0A2E8SPV6-F1-model_v4 AsnC family transcriptional regulator 0.9723 112 383
AF-A0A3D3NU95-F1-model_v4 AsnC family transcriptional regulator 0.9577 73 377
AF-A0A3D3NU95-F1-model_v4 AsnC family transcriptional regulator 0.9397 73 377
AF-A0A2V5T7E8-F1-model_v4 AsnC family transcriptional regulator 0.931 139 373

Map