F447058

General Info

Members Datasets Scaffolds Average Seq Length
452 278 904 205

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0038333|Ga0496102_0038333_747_1427
Length 226
Sequence MNLYGDEFRWDAPSKSGPAPIERIPAMRRLTVNTFLTLDGVMQAPGGPDEDDAGGFTLGGWSFNYWDEQMGQVMGAAMSVPFDLVLGRKTYDIFAAYWPNATDTTAAKPLNDATKFVASRSHPTLEWGPSVLLEGDVAEEIARLKKSDGPELQVHGSGNLLQTLIQHNLIDQYRLWVFPLVIGSGKRLFADGTVPSGLTLVDSVVSSTGVFIGTYEPAAAIQTGAF

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
178 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
203 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
213 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
219 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
268 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
269 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
276 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
277 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
278 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.67
Metatranscriptomes 0.66
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 7.96
Rhizosphere 89.38
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0038333 3300048905 Bacteria 4325
2 JGI24752J21851_1025269 3300001976 Bacteria 779
3 JGI24747J21853_1007177 3300001978 Bacteria 1067
4 JGI24747J21853_1007324 3300001978 Bacteria 1060
5 JGI24751J29686_10000508 3300002459 Bacteria 11256
6 JGI24751J29686_10007492 3300002459 Bacteria 2230
7 JGI25407J50210_10004794 3300003373 Bacteria 3303
8 JGI25407J50210_10020401 3300003373 Bacteria 1723
9 Ga0055535_1020850 3300003761 Bacteria 806
10 Ga0070676_10050580 3300005328 Bacteria 2437
11 Ga0070683_100154359 3300005329 Bacteria 2177
12 Ga0070690_100222288 3300005330 Bacteria 1324
13 Ga0070670_100066751 3300005331 Bacteria 3087
14 Ga0070670_100151021 3300005331 Bacteria 2010
15 Ga0068869_100000712 3300005334 Bacteria 18892
16 Ga0070682_100009889 3300005337 Bacteria 5401
17 Ga0070682_100218624 3300005337 Bacteria 1354
18 Ga0070660_100270689 3300005339 Bacteria 1388
19 Ga0070689_100068102 3300005340 Bacteria 2776
20 Ga0070691_10007937 3300005341 Bacteria 4853
21 Ga0070661_100018148 3300005344 Bacteria 5000
22 Ga0070692_10008091 3300005345 Bacteria 4671
23 Ga0070671_100187209 3300005355 Bacteria 1754
24 Ga0070673_100254657 3300005364 Bacteria 1531
25 Ga0070659_100018597 3300005366 Bacteria 5245
26 Ga0070667_100138437 3300005367 Bacteria 2130
27 Ga0070667_100223634 3300005367 Bacteria 1676
28 Ga0070709_10093600 3300005434 Bacteria 1986
29 Ga0070714_100194422 3300005435 Bacteria 1853
30 Ga0070713_100006618 3300005436 Bacteria 8056
31 Ga0070710_10125031 3300005437 Bacteria 1562
32 Ga0070701_10108372 3300005438 Bacteria 1548
33 Ga0070711_100104145 3300005439 Bacteria 2069
34 Ga0070711_100425381 3300005439 Unclassified 1083
35 Ga0070705_100057987 3300005440 Bacteria 2287
36 Ga0070700_100010644 3300005441 Bacteria 5081
37 Ga0070700_100353083 3300005441 Bacteria 1091
38 Ga0070663_100024018 3300005455 Bacteria 4095
39 Ga0070678_100006770 3300005456 Bacteria 6754
40 Ga0070678_100055738 3300005456 Bacteria 2887
41 Ga0070681_10015989 3300005458 Bacteria 7482
42 Ga0070706_100495502 3300005467 Unclassified 1137
43 Ga0070686_100133420 3300005544 Bacteria 1720
44 Ga0070693_100002149 3300005547 Bacteria 9040
45 Ga0070665_100165597 3300005548 Bacteria 2213
46 Ga0070665_100671840 3300005548 Bacteria 1049
47 Ga0070704_101047990 3300005549 Bacteria 739
48 Ga0068855_100184799 3300005563 Bacteria 2355
49 Ga0068855_100471398 3300005563 Bacteria 1368
50 Ga0070664_100073834 3300005564 Bacteria 2927
51 Ga0068856_100004065 3300005614 Bacteria 14642
52 Ga0070702_100001812 3300005615 Bacteria 8885
53 Ga0070702_100028584 3300005615 Bacteria 3023
54 Ga0068852_100014455 3300005616 Bacteria 6079
55 Ga0068859_100037480 3300005617 Bacteria 4866
56 Ga0068864_100022741 3300005618 Bacteria 5257
57 Ga0068864_100026412 3300005618 Bacteria 4898
58 Ga0068851_10089285 3300005834 Bacteria 1621
59 Ga0068870_10000283 3300005840 Bacteria 18780
60 Ga0068870_10000970 3300005840 Bacteria 11283
61 Ga0068863_100009002 3300005841 Bacteria 9750
62 Ga0068858_100110519 3300005842 Bacteria 2566
63 Ga0068858_100277781 3300005842 Bacteria 1594
64 Ga0068860_100093440 3300005843 Bacteria 2866
65 Ga0068862_100959393 3300005844 Bacteria 844
66 Ga0081538_10000223 3300005981 Bacteria 63727
67 Ga0081538_10000300 3300005981 Bacteria 57016
68 Ga0081538_10001209 3300005981 Bacteria 27097
69 Ga0081538_10002232 3300005981 Bacteria 19172
70 Ga0081538_10005322 3300005981 Bacteria 11589
71 Ga0081538_10006679 3300005981 Bacteria 10107
72 Ga0081538_10008245 3300005981 Bacteria 8878
73 Ga0081538_10031197 3300005981 Bacteria 3601
74 Ga0081538_10044634 3300005981 Bacteria 2761
75 Ga0081538_10052246 3300005981 Bacteria 2444
76 Ga0081538_10096410 3300005981 Bacteria 1507
77 Ga0081540_1000187 3300005983 Bacteria 64679
78 Ga0081540_1002781 3300005983 Bacteria 14184
79 Ga0081540_1084033 3300005983 Bacteria 1422
80 Ga0070717_10929021 3300006028 Bacteria 792
81 Ga0075432_10019452 3300006058 Bacteria 2321
82 Ga0075432_10020768 3300006058 Bacteria 2245
83 Ga0070715_10008230 3300006163 Bacteria 3627
84 Ga0070712_100039907 3300006175 Bacteria 3215
85 Ga0070712_100769884 3300006175 Unclassified 824
86 Ga0097621_100108272 3300006237 Bacteria 2346
87 Ga0097621_100313302 3300006237 Bacteria 1388
88 Ga0068871_100158524 3300006358 Bacteria 1934
89 Ga0075428_100369723 3300006844 Bacteria 1538
90 Ga0075428_100575235 3300006844 Bacteria 1204
91 Ga0075430_100049009 3300006846 Bacteria 3565
92 Ga0075430_100549054 3300006846 Bacteria 953
93 Ga0075431_100056511 3300006847 Bacteria 4047
94 Ga0075431_100127595 3300006847 Bacteria 2625
95 Ga0075431_100225804 3300006847 Bacteria 1909
96 Ga0075433_10090599 3300006852 Bacteria 2703
97 Ga0075433_10148496 3300006852 Bacteria 2085
98 Ga0075434_100006403 3300006871 Bacteria 10789
99 Ga0075429_100003162 3300006880 Bacteria 13995
100 Ga0075429_100071018 3300006880 Bacteria 3031
101 Ga0075429_100555219 3300006880 Bacteria 1006
102 Ga0075429_100575644 3300006880 Bacteria 987
103 Ga0075429_100920454 3300006880 Bacteria 765
104 Ga0075436_100006761 3300006914 Bacteria 7849
105 Ga0075436_100188642 3300006914 Bacteria 1458
106 Ga0097620_100037480 3300006931 Bacteria 4866
107 Ga0075435_100016682 3300007076 Bacteria 5539
108 Ga0075435_100995637 3300007076 Bacteria 732
109 Ga0105251_10008419 3300009011 Bacteria 6210
110 Ga0105240_10037803 3300009093 Bacteria 6199
111 Ga0105240_10241949 3300009093 Bacteria 2092
112 Ga0105240_10312921 3300009093 Bacteria 1792
113 Ga0111539_10025702 3300009094 Bacteria 7214
114 Ga0111539_10150400 3300009094 Bacteria 2725
115 Ga0105245_11051295 3300009098 Bacteria 859
116 Ga0105247_10070895 3300009101 Bacteria 2178
117 Ga0114129_10001178 3300009147 Bacteria 34683
118 Ga0114129_10007737 3300009147 Bacteria 15290
119 Ga0114129_10037094 3300009147 Bacteria 6882
120 Ga0114129_10313042 3300009147 Bacteria 2089
121 Ga0114129_10391652 3300009147 Bacteria 1832
122 Ga0114129_10800051 3300009147 Bacteria 1203
123 Ga0105243_10004887 3300009148 Bacteria 10516
124 Ga0105241_10046940 3300009174 Bacteria 3282
125 Ga0105242_10011107 3300009176 Bacteria 6922
126 Ga0105248_10026546 3300009177 Bacteria 6442
127 Ga0105248_10239380 3300009177 Bacteria 2043
128 Ga0105237_10018228 3300009545 Bacteria 7263
129 Ga0105237_10563357 3300009545 Bacteria 1146
130 Ga0105238_10899697 3300009551 Bacteria 903
131 Ga0105239_10093047 3300010375 Bacteria 3328
132 Ga0105239_10810865 3300010375 Bacteria 1073
133 Ga0105246_10003140 3300011119 Bacteria 10039
134 Ga0105246_10021605 3300011119 Bacteria 4144
135 Ga0157373_10226909 3300013100 Bacteria 1318
136 Ga0157371_10066300 3300013102 Bacteria 2556
137 Ga0157370_10055358 3300013104 Bacteria 3779
138 Ga0157374_10457564 3300013296 Bacteria 1278
139 Ga0157378_10099719 3300013297 Bacteria 2650
140 Ga0157372_10051036 3300013307 Bacteria 4602
141 Ga0157375_10202572 3300013308 Bacteria 2141
142 Ga0182008_10164895 3300014497 Bacteria 1117
143 Ga0157377_10014293 3300014745 Bacteria 4037
144 Ga0157379_10062337 3300014968 Bacteria 3335
145 Ga0157376_10053626 3300014969 Bacteria 3358
146 Ga0157376_10228397 3300014969 Bacteria 1728
147 Ga0157376_10293616 3300014969 Bacteria 1536
148 Ga0157376_10405094 3300014969 Bacteria 1320
149 Ga0206356_10337122 3300020070 Bacteria 1242
150 Ga0206354_11666831 3300020081 Bacteria 1581
151 Ga0224712_10132063 3300022467 Bacteria 1091
152 Ga0209051_1005804 3300025303 Bacteria 7104
153 Ga0207656_10032105 3300025321 Bacteria 2179
154 Ga0207713_1120000 3300025735 Bacteria 883
155 Ga0207692_10449822 3300025898 Bacteria 811
156 Ga0207710_10035207 3300025900 Bacteria 2202
157 Ga0207688_10016193 3300025901 Bacteria 4042
158 Ga0207680_10251369 3300025903 Bacteria 1221
159 Ga0207685_10000765 3300025905 Bacteria 5894
160 Ga0207699_10111998 3300025906 Bacteria 1750
161 Ga0207645_10023822 3300025907 Bacteria 3974
162 Ga0207643_10000055 3300025908 Bacteria 73929
163 Ga0207643_10001722 3300025908 Bacteria 12265
164 Ga0207705_10010281 3300025909 Bacteria 6809
165 Ga0207705_10200722 3300025909 Bacteria 1511
166 Ga0207707_10030134 3300025912 Bacteria 4745
167 Ga0207695_10064406 3300025913 Bacteria 3774
168 Ga0207671_10539100 3300025914 Bacteria 930
169 Ga0207693_10000637 3300025915 Bacteria 31341
170 Ga0207693_10120711 3300025915 Bacteria 2058
171 Ga0207693_10129270 3300025915 Bacteria 1985
172 Ga0207663_10009992 3300025916 Bacteria 5027
173 Ga0207660_10013891 3300025917 Bacteria 5284
174 Ga0207657_10015056 3300025919 Bacteria 7511
175 Ga0207649_10019454 3300025920 Bacteria 3880
176 Ga0207652_10014344 3300025921 Bacteria 6417
177 Ga0207694_10152818 3300025924 Bacteria 1860
178 Ga0207694_10798054 3300025924 Bacteria 797
179 Ga0207650_10001024 3300025925 Bacteria 20982
180 Ga0207650_10001184 3300025925 Bacteria 19164
181 Ga0207659_10048597 3300025926 Bacteria 3006
182 Ga0207687_10040330 3300025927 Bacteria 3200
183 Ga0207700_10001414 3300025928 Bacteria 13622
184 Ga0207664_10203389 3300025929 Bacteria 1711
185 Ga0207644_10005971 3300025931 Bacteria 7936
186 Ga0207644_10196964 3300025931 Bacteria 1587
187 Ga0207690_10224066 3300025932 Bacteria 1440
188 Ga0207686_10257285 3300025934 Bacteria 1278
189 Ga0207669_10008110 3300025937 Bacteria 4912
190 Ga0207665_10099862 3300025939 Bacteria 2024
191 Ga0207665_10172605 3300025939 Bacteria 1562
192 Ga0207711_10537262 3300025941 Bacteria 1090
193 Ga0207689_10013820 3300025942 Bacteria 6880
194 Ga0207661_10003666 3300025944 Bacteria 10702
195 Ga0207679_10011471 3300025945 Bacteria 5743
196 Ga0207667_10126584 3300025949 Bacteria 2631
197 Ga0207667_10385780 3300025949 Bacteria 1427
198 Ga0207651_10155824 3300025960 Bacteria 1784
199 Ga0207658_10086251 3300025986 Bacteria 2421
200 Ga0207677_10004921 3300026023 Bacteria 7212
201 Ga0207639_10109787 3300026041 Bacteria 2245
202 Ga0207678_10036990 3300026067 Bacteria 4248
203 Ga0207678_10175524 3300026067 Archaea 1830
204 Ga0207708_10004198 3300026075 Bacteria 10595
205 Ga0207708_10080643 3300026075 Bacteria 2500
206 Ga0207708_10733476 3300026075 Bacteria 847
207 Ga0207702_10004466 3300026078 Bacteria 12430
208 Ga0207702_10005896 3300026078 Bacteria 10655
209 Ga0207702_11208680 3300026078 Bacteria 750
210 Ga0207641_10084481 3300026088 Bacteria 2763
211 Ga0207676_10001452 3300026095 Bacteria 17629
212 Ga0207676_10006537 3300026095 Bacteria 8241
213 Ga0207674_10133710 3300026116 Bacteria 2443
214 Ga0207674_10337059 3300026116 Bacteria 1458
215 Ga0207683_10002287 3300026121 Bacteria 16801
216 Ga0207683_10078949 3300026121 Bacteria 2917
217 Ga0207698_10006233 3300026142 Bacteria 7426
218 Ga0207428_10012460 3300027907 Bacteria 7469
219 Ga0268266_10862351 3300028379 Bacteria 875
220 Ga0268265_10628095 3300028380 Bacteria 1030
221 Ga0268264_10430538 3300028381 Bacteria 1274
222 Ga0268264_11217541 3300028381 Bacteria 762
223 Ga0307408_100655915 3300031548 Bacteria 939
224 Ga0307516_10017783 3300031730 Bacteria 7406
225 Ga0307405_10399036 3300031731 Bacteria 1076
226 Ga0307410_10349663 3300031852 Bacteria 1181
227 Ga0307406_10142290 3300031901 Bacteria 1700
228 Ga0307406_10196469 3300031901 Bacteria 1481
229 Ga0307409_100057286 3300031995 Bacteria 3019
230 Ga0307409_100081052 3300031995 Bacteria 2622
231 Ga0307409_100687576 3300031995 Bacteria 1021
232 Ga0307416_100086921 3300032002 Bacteria 2667
233 Ga0307416_100182614 3300032002 Bacteria 1968
234 Ga0307416_100338025 3300032002 Bacteria 1517
235 Ga0307416_100394396 3300032002 Bacteria 1419
236 Ga0307416_101821749 3300032002 Bacteria 712
237 Ga0307415_100000160 3300032126 Bacteria 29647
238 Ga0307415_100413470 3300032126 Bacteria 1155
239 Ga0373944_0000927 3300035089 Bacteria 7258
240 Ga0373923_0000868 3300035111 Bacteria 8018
241 Ga0373923_0156724 3300035111 Bacteria 1037
242 Ga0373936_0001385 3300035113 Bacteria 8797
243 Ga0373945_0008718 3300035116 Bacteria 3309
244 Ga0373945_0020488 3300035116 Bacteria 2264
245 Ga0373943_0002474 3300035170 Bacteria 8397
246 Ga0373943_0096553 3300035170 Bacteria 1539
247 Ga0373946_0000355 3300035171 Bacteria 14839
248 Ga0373946_0174096 3300035171 Bacteria 1018
249 Ga0373924_0010803 3300035410 Bacteria 3379
250 Ga0373935_0011898 3300035692 Bacteria 5228
251 Ga0373927_0008317 3300035695 Bacteria 6984
252 Ga0373947_0001218 3300035725 Bacteria 15844
253 Ga0373947_0007214 3300035725 Bacteria 6440
254 Ga0373947_0123468 3300035725 Bacteria 1647
255 Ga0373947_0138770 3300035725 Bacteria 1558
256 Ga0373937_0899888 3300036401 Bacteria 834
257 Ga0373925_0018961 3300037068 Bacteria 5000
258 Ga0373925_0089165 3300037068 Bacteria 2356
259 Ga0395899_0045882 3300037312 Bacteria 3256
260 Ga0395899_0057471 3300037312 Bacteria 2872
261 Ga0395899_0108232 3300037312 Bacteria 2000
262 Ga0395899_0250878 3300037312 Bacteria 1214
263 Ga0395899_0486498 3300037312 Bacteria 803
264 Ga0395900_0001574 3300037418 Bacteria 27021
265 Ga0395900_0031326 3300037418 Bacteria 5463
266 Ga0395900_0032932 3300037418 Bacteria 5332
267 Ga0395900_0058688 3300037418 Bacteria 3961
268 Ga0395900_0088771 3300037418 Bacteria 3178
269 Ga0395900_0243875 3300037418 Bacteria 1801
270 Ga0395900_0372991 3300037418 Bacteria 1396
271 Ga0395900_0487535 3300037418 Bacteria 1184
272 Ga0395900_0808951 3300037418 Bacteria 865
273 Ga0395898_0016863 3300037466 Bacteria 7460
274 Ga0395898_0034118 3300037466 Bacteria 5074
275 Ga0395898_0071195 3300037466 Bacteria 3360
276 Ga0395898_0124763 3300037466 Bacteria 2467
277 Ga0395898_0159235 3300037466 Bacteria 2159
278 Ga0395898_0269961 3300037466 Bacteria 1622
279 Ga0395898_0353571 3300037466 Bacteria 1401
280 Ga0395898_0567348 3300037466 Bacteria 1077
281 Ga0395905_0042847 3300037471 Bacteria 4246
282 Ga0395905_0144634 3300037471 Bacteria 2237
283 Ga0395905_0389254 3300037471 Bacteria 1288
284 Ga0395901_0003078 3300038443 Bacteria 16794
285 Ga0395901_0024578 3300038443 Bacteria 6186
286 Ga0395901_0050512 3300038443 Bacteria 4320
287 Ga0395901_0062635 3300038443 Bacteria 3870
288 Ga0395901_0109769 3300038443 Bacteria 2896
289 Ga0395901_0383564 3300038443 Bacteria 1446
290 Ga0395901_0442600 3300038443 Bacteria 1330
291 Ga0395901_0603322 3300038443 Bacteria 1107
292 Ga0451789_1169764 3300041443 Bacteria 2518
293 Ga0451791_0229508 3300041451 Bacteria 3978
294 Ga0451793_0627869 3300041452 Bacteria 3632
295 Ga0451795_0744018 3300041456 Bacteria 3087
296 Ga0451843_0108918 3300041509 Bacteria 1687
297 Ga0451853_3892623 3300041512 Bacteria 2148
298 Ga0439448_0007418 3300042005 Bacteria 3180
299 Ga0439463_003756 3300042016 Bacteria 3825
300 Ga0439458_0062026 3300042157 Bacteria 934
301 Ga0439459_0004583 3300042438 Bacteria 2228
302 Ga0439464_0017438 3300042439 Bacteria 1948
303 Ga0439464_0031616 3300042439 Bacteria 1486
304 Ga0451576_0069160 3300045051 Bacteria 3674
305 Ga0466958_0565617 3300045836 Bacteria 739
306 Ga0495603_0041077 3300046455 Bacteria 2767
307 Ga0495629_0000904 3300046459 Bacteria 23809
308 Ga0495629_0002949 3300046459 Bacteria 12958
309 Ga0495629_0362388 3300046459 Bacteria 988
310 Ga0495641_0002891 3300046461 Bacteria 13239
311 Ga0495580_0064130 3300046472 Bacteria 2576
312 Ga0495582_0000767 3300046473 Bacteria 17774
313 Ga0495582_0004817 3300046473 Bacteria 7571
314 Ga0495582_0250293 3300046473 Bacteria 1016
315 Ga0495582_0324549 3300046473 Bacteria 886
316 Ga0495639_0000236 3300046475 Bacteria 27605
317 Ga0495662_0000767 3300046476 Bacteria 15477
318 Ga0495630_0000421 3300046517 Bacteria 32672
319 Ga0495630_1008982 3300046517 Bacteria 632
320 Ga0495666_0000094 3300046526 Bacteria 36379
321 Ga0495652_0059017 3300046529 Bacteria 3247
322 Ga0495665_0001644 3300046531 Bacteria 11971
323 Ga0495586_0082540 3300046535 Bacteria 1767
324 Ga0495645_0042732 3300046543 Bacteria 3304
325 Ga0495634_0000485 3300046642 Bacteria 39124
326 Ga0495635_0001902 3300046663 Bacteria 14189
327 Ga0495661_0112294 3300046665 Bacteria 1517
328 Ga0495588_0006128 3300046674 Bacteria 5399
329 Ga0495588_0057632 3300046674 Bacteria 2007
330 Ga0495623_0165306 3300046679 Bacteria 1297
331 Ga0495647_0005021 3300046681 Bacteria 4332
332 Ga0495658_0002631 3300046683 Bacteria 9020
333 Ga0495658_0003934 3300046683 Bacteria 7335
334 Ga0495658_0020994 3300046683 Bacteria 3437
335 Ga0495613_0000245 3300046689 Bacteria 51376
336 Ga0495613_0002527 3300046689 Bacteria 13762
337 Ga0495624_0028906 3300046690 Bacteria 3617
338 Ga0495624_0086923 3300046690 Bacteria 1931
339 Ga0495670_0383314 3300046691 Bacteria 759
340 Ga0495581_0009100 3300047315 Bacteria 5744
341 Ga0495581_0011402 3300047315 Bacteria 5143
342 Ga0495674_0004759 3300047319 Bacteria 13048
343 Ga0495676_0032282 3300047321 Bacteria 4421
344 Ga0495676_0045984 3300047321 Bacteria 3548
345 Ga0495676_0191134 3300047321 Bacteria 1428
346 Ga0495676_0446975 3300047321 Bacteria 853
347 Ga0495680_0000581 3300047322 Bacteria 41016
348 Ga0495675_0180649 3300047444 Bacteria 1292
349 Ga0495593_0001946 3300047673 Bacteria 12324
350 Ga0495593_0028820 3300047673 Bacteria 3048
351 Ga0495602_0051691 3300048088 Bacteria 3658
352 Ga0495602_0723572 3300048088 Bacteria 674
353 Ga0495614_0054016 3300048089 Bacteria 1722
354 Ga0496100_0082670 3300048903 Bacteria 2172
355 Ga0496100_0394939 3300048903 Bacteria 1052
356 Ga0496101_0069830 3300048904 Bacteria 2571
357 Ga0496101_0613378 3300048904 Bacteria 860
358 Ga0496102_0021088 3300048905 Bacteria 5762
359 Ga0496102_0096622 3300048905 Bacteria 2739
360 Ga0496102_0248530 3300048905 Bacteria 1677
361 Ga0496103_0029137 3300048906 Bacteria 3354
362 Ga0496103_0107125 3300048906 Bacteria 1773
363 Ga0496103_0147446 3300048906 Bacteria 1507
364 Ga0496104_0021316 3300048907 Bacteria 5947
365 Ga0496104_0057783 3300048907 Bacteria 3671
366 Ga0496105_0033243 3300048908 Bacteria 4233
367 Ga0496105_0507304 3300048908 Bacteria 946
368 Ga0496106_0006794 3300048909 Bacteria 8471
369 Ga0496106_0056639 3300048909 Bacteria 2963
370 Ga0496107_0011988 3300048910 Bacteria 6049
371 Ga0496107_0279198 3300048910 Bacteria 1243
372 Ga0496108_0051439 3300048911 Bacteria 3451
373 Ga0496108_0230453 3300048911 Bacteria 1611
374 Ga0496109_0144775 3300048912 Bacteria 2223
375 Ga0496109_0346276 3300048912 Bacteria 1403
376 Ga0496110_0002154 3300048913 Bacteria 14698
377 Ga0496110_0144286 3300048913 Bacteria 2153
378 Ga0496111_0093489 3300048914 Bacteria 2204
379 Ga0496113_0014036 3300048916 Bacteria 5450
380 Ga0496114_0024692 3300048917 Bacteria 4907
381 Ga0496114_0055439 3300048917 Bacteria 3306
382 Ga0496114_0148695 3300048917 Bacteria 2031
383 Ga0496115_0229366 3300048918 Bacteria 1532
384 Ga0496115_0605118 3300048918 Bacteria 871
385 Ga0496118_0366251 3300048921 Bacteria 762
386 Ga0496121_0036670 3300048924 Bacteria 4366
387 Ga0501031_0044764 3300049568 Bacteria 2888
388 Ga0501036_0069971 3300049572 Bacteria 2967
389 Ga0501036_0081294 3300049572 Bacteria 2738
390 Ga0501038_0218665 3300049574 Bacteria 1521
391 Ga0501039_0014972 3300049575 Bacteria 5932
392 Ga0501039_0015141 3300049575 Bacteria 5901
393 Ga0501039_0044928 3300049575 Bacteria 3412
394 Ga0501039_0047319 3300049575 Bacteria 3324
395 Ga0501039_0246898 3300049575 Bacteria 1404
396 Ga0501040_0152264 3300049576 Bacteria 1632
397 Ga0501041_0129179 3300049577 Bacteria 1574
398 Ga0501041_0388582 3300049577 Bacteria 883
399 Ga0501042_0092953 3300049578 Bacteria 2166
400 Ga0501042_0124224 3300049578 Bacteria 1858
401 Ga0501042_0215176 3300049578 Bacteria 1386
402 Ga0501046_0045622 3300049580 Bacteria 3482
403 Ga0501048_0070320 3300049582 Bacteria 2472
404 Ga0501067_0063970 3300049583 Bacteria 2037
405 Ga0501069_0478816 3300049585 Bacteria 741
406 Ga0501070_0140642 3300049586 Bacteria 1993
407 Ga0501071_0079300 3300049587 Bacteria 2400
408 Ga0501071_0092536 3300049587 Bacteria 2222
409 Ga0501072_0052908 3300049588 Bacteria 3197
410 Ga0501074_0222041 3300049590 Bacteria 1345
411 Ga0501074_0261614 3300049590 Bacteria 1230
412 Ga0501075_0147283 3300049591 Bacteria 1794
413 Ga0501076_0056218 3300049592 Bacteria 3123
414 Ga0501076_0661097 3300049592 Bacteria 862
415 Ga0501077_0094129 3300049593 Bacteria 1899
416 Ga0501079_0324601 3300049741 Bacteria 1205
417 Ga0501080_0127162 3300049742 Bacteria 2360
418 Ga0501080_0695343 3300049742 Bacteria 897
419 Ga0501081_0016045 3300049743 Bacteria 4947
420 Ga0501083_0073967 3300049744 Bacteria 2265
421 Ga0501270_020521 3300049767 Bacteria 1002
422 Ga0501044_0140531 3300049823 Bacteria 2404
423 Ga0501045_0019674 3300049824 Bacteria 4817
424 Ga0501045_0130498 3300049824 Bacteria 1868
425 Ga0501045_0163715 3300049824 Bacteria 1656
426 nmdc:mga0yw44_248937_c1 3300050492 Bacteria 1182
427 nmdc:mga05p37_169229_c1 3300050507 Bacteria 2666
428 nmdc:mga05p37_1842_c1 3300050507 Bacteria 24712
429 nmdc:mga09592_74118_c1 3300050508 Bacteria 2893
430 nmdc:mga0qj67_523700_c1 3300050509 Bacteria 952
431 nmdc:mga06r32_177397_c1 3300050510 Bacteria 2115
432 nmdc:mga08y16_18407_c1 3300050511 Bacteria 7363
433 nmdc:mga0n895_11213_c1 3300050512 Bacteria 7983
434 nmdc:mga0n895_114531_c1 3300050512 Bacteria 2715
435 nmdc:mga0n895_764025_c1 3300050512 Bacteria 959
436 nmdc:mga0rr50_1147001_c1 3300050513 Bacteria 661
437 nmdc:mga0rr50_3155_c1 3300050513 Bacteria 9422
438 nmdc:mga08x19_83451_c1 3300050514 Bacteria 2101
439 nmdc:mga0a205_84720_c1 3300050515 Bacteria 3062
440 Ga0495601_0175296 3300053077 Bacteria 1402
441 Ga0495619_0006174 3300053085 Bacteria 7592
442 Ga0500595_094970 3300053119 Bacteria 859
443 Ga0501084_0048855 3300054114 Bacteria 3542
444 Ga0501084_0098420 3300054114 Bacteria 2456
445 Ga0590075_032430 3300059424 Bacteria 1326
446 Ga0501082_0050274 3300060353 Bacteria 3595
447 Ga0501082_0227480 3300060353 Bacteria 1623
448 Ga0501082_0237456 3300060353 Bacteria 1586
449 Ga0530510_0187956 3300061734 Bacteria 1533
450 2644488940 2643221687 Bacteria 6500351
451 2902838751 2902837492 Bacteria 6697721
452 8003857308 8003856774 Bacteria 7675274
453 Ga0496102_0038333
454 JGI24752J21851_1025269
455 JGI24747J21853_1007177
456 JGI24747J21853_1007324
457 JGI24751J29686_10000508
458 JGI24751J29686_10007492
459 JGI25407J50210_10004794
460 JGI25407J50210_10020401
461 Ga0055535_1020850
462 Ga0070676_10050580
463 Ga0070683_100154359
464 Ga0070690_100222288
465 Ga0070670_100066751
466 Ga0070670_100151021
467 Ga0068869_100000712
468 Ga0070682_100009889
469 Ga0070682_100218624
470 Ga0070660_100270689
471 Ga0070689_100068102
472 Ga0070691_10007937
473 Ga0070661_100018148
474 Ga0070692_10008091
475 Ga0070671_100187209
476 Ga0070673_100254657
477 Ga0070659_100018597
478 Ga0070667_100138437
479 Ga0070667_100223634
480 Ga0070709_10093600
481 Ga0070714_100194422
482 Ga0070713_100006618
483 Ga0070710_10125031
484 Ga0070701_10108372
485 Ga0070711_100104145
486 Ga0070711_100425381
487 Ga0070705_100057987
488 Ga0070700_100010644
489 Ga0070700_100353083
490 Ga0070663_100024018
491 Ga0070678_100006770
492 Ga0070678_100055738
493 Ga0070681_10015989
494 Ga0070706_100495502
495 Ga0070686_100133420
496 Ga0070693_100002149
497 Ga0070665_100165597
498 Ga0070665_100671840
499 Ga0070704_101047990
500 Ga0068855_100184799
501 Ga0068855_100471398
502 Ga0070664_100073834
503 Ga0068856_100004065
504 Ga0070702_100001812
505 Ga0070702_100028584
506 Ga0068852_100014455
507 Ga0068859_100037480
508 Ga0068864_100022741
509 Ga0068864_100026412
510 Ga0068851_10089285
511 Ga0068870_10000283
512 Ga0068870_10000970
513 Ga0068863_100009002
514 Ga0068858_100110519
515 Ga0068858_100277781
516 Ga0068860_100093440
517 Ga0068862_100959393
518 Ga0081538_10000223
519 Ga0081538_10000300
520 Ga0081538_10001209
521 Ga0081538_10002232
522 Ga0081538_10005322
523 Ga0081538_10006679
524 Ga0081538_10008245
525 Ga0081538_10031197
526 Ga0081538_10044634
527 Ga0081538_10052246
528 Ga0081538_10096410
529 Ga0081540_1000187
530 Ga0081540_1002781
531 Ga0081540_1084033
532 Ga0070717_10929021
533 Ga0075432_10019452
534 Ga0075432_10020768
535 Ga0070715_10008230
536 Ga0070712_100039907
537 Ga0070712_100769884
538 Ga0097621_100108272
539 Ga0097621_100313302
540 Ga0068871_100158524
541 Ga0075428_100369723
542 Ga0075428_100575235
543 Ga0075430_100049009
544 Ga0075430_100549054
545 Ga0075431_100056511
546 Ga0075431_100127595
547 Ga0075431_100225804
548 Ga0075433_10090599
549 Ga0075433_10148496
550 Ga0075434_100006403
551 Ga0075429_100003162
552 Ga0075429_100071018
553 Ga0075429_100555219
554 Ga0075429_100575644
555 Ga0075429_100920454
556 Ga0075436_100006761
557 Ga0075436_100188642
558 Ga0097620_100037480
559 Ga0075435_100016682
560 Ga0075435_100995637
561 Ga0105251_10008419
562 Ga0105240_10037803
563 Ga0105240_10241949
564 Ga0105240_10312921
565 Ga0111539_10025702
566 Ga0111539_10150400
567 Ga0105245_11051295
568 Ga0105247_10070895
569 Ga0114129_10001178
570 Ga0114129_10007737
571 Ga0114129_10037094
572 Ga0114129_10313042
573 Ga0114129_10391652
574 Ga0114129_10800051
575 Ga0105243_10004887
576 Ga0105241_10046940
577 Ga0105242_10011107
578 Ga0105248_10026546
579 Ga0105248_10239380
580 Ga0105237_10018228
581 Ga0105237_10563357
582 Ga0105238_10899697
583 Ga0105239_10093047
584 Ga0105239_10810865
585 Ga0105246_10003140
586 Ga0105246_10021605
587 Ga0157373_10226909
588 Ga0157371_10066300
589 Ga0157370_10055358
590 Ga0157374_10457564
591 Ga0157378_10099719
592 Ga0157372_10051036
593 Ga0157375_10202572
594 Ga0182008_10164895
595 Ga0157377_10014293
596 Ga0157379_10062337
597 Ga0157376_10053626
598 Ga0157376_10228397
599 Ga0157376_10293616
600 Ga0157376_10405094
601 Ga0206356_10337122
602 Ga0206354_11666831
603 Ga0224712_10132063
604 Ga0209051_1005804
605 Ga0207656_10032105
606 Ga0207713_1120000
607 Ga0207692_10449822
608 Ga0207710_10035207
609 Ga0207688_10016193
610 Ga0207680_10251369
611 Ga0207685_10000765
612 Ga0207699_10111998
613 Ga0207645_10023822
614 Ga0207643_10000055
615 Ga0207643_10001722
616 Ga0207705_10010281
617 Ga0207705_10200722
618 Ga0207707_10030134
619 Ga0207695_10064406
620 Ga0207671_10539100
621 Ga0207693_10000637
622 Ga0207693_10120711
623 Ga0207693_10129270
624 Ga0207663_10009992
625 Ga0207660_10013891
626 Ga0207657_10015056
627 Ga0207649_10019454
628 Ga0207652_10014344
629 Ga0207694_10152818
630 Ga0207694_10798054
631 Ga0207650_10001024
632 Ga0207650_10001184
633 Ga0207659_10048597
634 Ga0207687_10040330
635 Ga0207700_10001414
636 Ga0207664_10203389
637 Ga0207644_10005971
638 Ga0207644_10196964
639 Ga0207690_10224066
640 Ga0207686_10257285
641 Ga0207669_10008110
642 Ga0207665_10099862
643 Ga0207665_10172605
644 Ga0207711_10537262
645 Ga0207689_10013820
646 Ga0207661_10003666
647 Ga0207679_10011471
648 Ga0207667_10126584
649 Ga0207667_10385780
650 Ga0207651_10155824
651 Ga0207658_10086251
652 Ga0207677_10004921
653 Ga0207639_10109787
654 Ga0207678_10036990
655 Ga0207678_10175524
656 Ga0207708_10004198
657 Ga0207708_10080643
658 Ga0207708_10733476
659 Ga0207702_10004466
660 Ga0207702_10005896
661 Ga0207702_11208680
662 Ga0207641_10084481
663 Ga0207676_10001452
664 Ga0207676_10006537
665 Ga0207674_10133710
666 Ga0207674_10337059
667 Ga0207683_10002287
668 Ga0207683_10078949
669 Ga0207698_10006233
670 Ga0207428_10012460
671 Ga0268266_10862351
672 Ga0268265_10628095
673 Ga0268264_10430538
674 Ga0268264_11217541
675 Ga0307408_100655915
676 Ga0307516_10017783
677 Ga0307405_10399036
678 Ga0307410_10349663
679 Ga0307406_10142290
680 Ga0307406_10196469
681 Ga0307409_100057286
682 Ga0307409_100081052
683 Ga0307409_100687576
684 Ga0307416_100086921
685 Ga0307416_100182614
686 Ga0307416_100338025
687 Ga0307416_100394396
688 Ga0307416_101821749
689 Ga0307415_100000160
690 Ga0307415_100413470
691 Ga0373944_0000927
692 Ga0373923_0000868
693 Ga0373923_0156724
694 Ga0373936_0001385
695 Ga0373945_0008718
696 Ga0373945_0020488
697 Ga0373943_0002474
698 Ga0373943_0096553
699 Ga0373946_0000355
700 Ga0373946_0174096
701 Ga0373924_0010803
702 Ga0373935_0011898
703 Ga0373927_0008317
704 Ga0373947_0001218
705 Ga0373947_0007214
706 Ga0373947_0123468
707 Ga0373947_0138770
708 Ga0373937_0899888
709 Ga0373925_0018961
710 Ga0373925_0089165
711 Ga0395899_0045882
712 Ga0395899_0057471
713 Ga0395899_0108232
714 Ga0395899_0250878
715 Ga0395899_0486498
716 Ga0395900_0001574
717 Ga0395900_0031326
718 Ga0395900_0032932
719 Ga0395900_0058688
720 Ga0395900_0088771
721 Ga0395900_0243875
722 Ga0395900_0372991
723 Ga0395900_0487535
724 Ga0395900_0808951
725 Ga0395898_0016863
726 Ga0395898_0034118
727 Ga0395898_0071195
728 Ga0395898_0124763
729 Ga0395898_0159235
730 Ga0395898_0269961
731 Ga0395898_0353571
732 Ga0395898_0567348
733 Ga0395905_0042847
734 Ga0395905_0144634
735 Ga0395905_0389254
736 Ga0395901_0003078
737 Ga0395901_0024578
738 Ga0395901_0050512
739 Ga0395901_0062635
740 Ga0395901_0109769
741 Ga0395901_0383564
742 Ga0395901_0442600
743 Ga0395901_0603322
744 Ga0451789_1169764
745 Ga0451791_0229508
746 Ga0451793_0627869
747 Ga0451795_0744018
748 Ga0451843_0108918
749 Ga0451853_3892623
750 Ga0439448_0007418
751 Ga0439463_003756
752 Ga0439458_0062026
753 Ga0439459_0004583
754 Ga0439464_0017438
755 Ga0439464_0031616
756 Ga0451576_0069160
757 Ga0466958_0565617
758 Ga0495603_0041077
759 Ga0495629_0000904
760 Ga0495629_0002949
761 Ga0495629_0362388
762 Ga0495641_0002891
763 Ga0495580_0064130
764 Ga0495582_0000767
765 Ga0495582_0004817
766 Ga0495582_0250293
767 Ga0495582_0324549
768 Ga0495639_0000236
769 Ga0495662_0000767
770 Ga0495630_0000421
771 Ga0495630_1008982
772 Ga0495666_0000094
773 Ga0495652_0059017
774 Ga0495665_0001644
775 Ga0495586_0082540
776 Ga0495645_0042732
777 Ga0495634_0000485
778 Ga0495635_0001902
779 Ga0495661_0112294
780 Ga0495588_0006128
781 Ga0495588_0057632
782 Ga0495623_0165306
783 Ga0495647_0005021
784 Ga0495658_0002631
785 Ga0495658_0003934
786 Ga0495658_0020994
787 Ga0495613_0000245
788 Ga0495613_0002527
789 Ga0495624_0028906
790 Ga0495624_0086923
791 Ga0495670_0383314
792 Ga0495581_0009100
793 Ga0495581_0011402
794 Ga0495674_0004759
795 Ga0495676_0032282
796 Ga0495676_0045984
797 Ga0495676_0191134
798 Ga0495676_0446975
799 Ga0495680_0000581
800 Ga0495675_0180649
801 Ga0495593_0001946
802 Ga0495593_0028820
803 Ga0495602_0051691
804 Ga0495602_0723572
805 Ga0495614_0054016
806 Ga0496100_0082670
807 Ga0496100_0394939
808 Ga0496101_0069830
809 Ga0496101_0613378
810 Ga0496102_0021088
811 Ga0496102_0096622
812 Ga0496102_0248530
813 Ga0496103_0029137
814 Ga0496103_0107125
815 Ga0496103_0147446
816 Ga0496104_0021316
817 Ga0496104_0057783
818 Ga0496105_0033243
819 Ga0496105_0507304
820 Ga0496106_0006794
821 Ga0496106_0056639
822 Ga0496107_0011988
823 Ga0496107_0279198
824 Ga0496108_0051439
825 Ga0496108_0230453
826 Ga0496109_0144775
827 Ga0496109_0346276
828 Ga0496110_0002154
829 Ga0496110_0144286
830 Ga0496111_0093489
831 Ga0496113_0014036
832 Ga0496114_0024692
833 Ga0496114_0055439
834 Ga0496114_0148695
835 Ga0496115_0229366
836 Ga0496115_0605118
837 Ga0496118_0366251
838 Ga0496121_0036670
839 Ga0501031_0044764
840 Ga0501036_0069971
841 Ga0501036_0081294
842 Ga0501038_0218665
843 Ga0501039_0014972
844 Ga0501039_0015141
845 Ga0501039_0044928
846 Ga0501039_0047319
847 Ga0501039_0246898
848 Ga0501040_0152264
849 Ga0501041_0129179
850 Ga0501041_0388582
851 Ga0501042_0092953
852 Ga0501042_0124224
853 Ga0501042_0215176
854 Ga0501046_0045622
855 Ga0501048_0070320
856 Ga0501067_0063970
857 Ga0501069_0478816
858 Ga0501070_0140642
859 Ga0501071_0079300
860 Ga0501071_0092536
861 Ga0501072_0052908
862 Ga0501074_0222041
863 Ga0501074_0261614
864 Ga0501075_0147283
865 Ga0501076_0056218
866 Ga0501076_0661097
867 Ga0501077_0094129
868 Ga0501079_0324601
869 Ga0501080_0127162
870 Ga0501080_0695343
871 Ga0501081_0016045
872 Ga0501083_0073967
873 Ga0501270_020521
874 Ga0501044_0140531
875 Ga0501045_0019674
876 Ga0501045_0130498
877 Ga0501045_0163715
878 nmdc:mga0yw44_248937_c1
879 nmdc:mga05p37_169229_c1
880 nmdc:mga05p37_1842_c1
881 nmdc:mga09592_74118_c1
882 nmdc:mga0qj67_523700_c1
883 nmdc:mga06r32_177397_c1
884 nmdc:mga08y16_18407_c1
885 nmdc:mga0n895_11213_c1
886 nmdc:mga0n895_114531_c1
887 nmdc:mga0n895_764025_c1
888 nmdc:mga0rr50_1147001_c1
889 nmdc:mga0rr50_3155_c1
890 nmdc:mga08x19_83451_c1
891 nmdc:mga0a205_84720_c1
892 Ga0495601_0175296
893 Ga0495619_0006174
894 Ga0500595_094970
895 Ga0501084_0048855
896 Ga0501084_0098420
897 Ga0590075_032430
898 Ga0501082_0050274
899 Ga0501082_0227480
900 Ga0501082_0237456
901 Ga0530510_0187956
902 2644488940
903 2902838751
904 8003857308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

28

212

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8121 1 191
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.808 1 191
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7919 3 191
2gd9-assembly1.cif.gz_B crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7918 2 189
2gd9-assembly1.cif.gz_A crystal structure of a putative dihydrofolate reductase (bsu40760, yyap) from bacillus subtilis at 2.30 a resolution 0.7888 2 189
ID Description Score Start End Superfamily
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7966 2 195 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7924 2 195 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7913 2 188 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7867 2 188 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7862 3 189 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A530GKI4-F1-model_v4 Dihydrofolate reductase 0.9628 53 188 GO:0008703
GO:0009231
AF-A0A3S1EWK5-F1-model_v4 Dihydrofolate reductase 0.9492 40 191 GO:0008703
GO:0009231
AF-A0A538BRR6-F1-model_v4 Dihydrofolate reductase 0.9479 54 200 GO:0008703
GO:0009231
AF-A0A1G3G7P7-F1-model_v4 Deaminase 0.9473 61 197 GO:0008703
GO:0009231
AF-A0A7W7SZ10-F1-model_v4 Dihydrofolate reductase 0.9452 39 192 GO:0008703
GO:0009231

Map