F446996

General Info

Members Datasets Scaffolds Average Seq Length
452 255 904 272

Family's Representative Sequence

Representative Sequence 3300025297|Ga0209758_1002667|Ga0209758_100266713
Length 273
Sequence VSLPPTLQPYADAWTHSIEAISELVKPLVEGEWNRRTPCPGWSVRDIVSHVIGMDSEMLGDPRPIHTLPRDLFHVTNEHQRYMEMQVDVRRHHTAPEMTSELEYTIIRRNRQLRNESRDPGAKVRGPLGTEQTLEEAMRYRAFDVWVHEQDLRAALGRPGNLDSPGAYITRDELLAALPKVVEEAGAPAGSATVFDVHGPVEFLRTVRLDAEGRGSIDSAPSLGPTVSLTLDWETYVRLACGRVPADVVADRIKAEGDPELTAAIFLAFAVTK

Samples

Sample ID Description Type Environment
1 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
38 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
39 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
40 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
44 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
45 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
46 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
47 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
48 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
49 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
50 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
51 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
52 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
53 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
54 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
55 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
56 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
57 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
58 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
59 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
60 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
61 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
97 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
98 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
99 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
100 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
125 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
129 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
136 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
137 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
142 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
171 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
172 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
173 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
174 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
177 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
180 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
183 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
184 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
185 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
186 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
187 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
188 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
189 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
192 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
195 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
196 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
197 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
202 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
203 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
204 2643221578 Streptomyces sp. Root63 Isolate Unclassified
205 2643221647 Streptomyces sp. Root369 Isolate Unclassified
206 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
207 2643221714 Streptomyces sp. Root264 Isolate Unclassified
208 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
209 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
210 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
211 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
212 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
213 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
214 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
215 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
216 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
217 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
218 2862574272 Streptomyces sp. AcE210 Isolate Nodule
219 2867428634 Streptomyces sp. RP5T Isolate Unclassified
220 2867475112 Streptomyces sp. TM32 Isolate Unclassified
221 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
222 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
223 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
224 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
225 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
226 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
227 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
228 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
229 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
230 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
231 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
232 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
233 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
234 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
235 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
236 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
237 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
238 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
239 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
240 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
241 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
242 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
243 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
244 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
245 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
246 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
247 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
248 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
249 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
250 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
251 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
252 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
253 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
254 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
255 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.61
Metatranscriptomes 0.22
Isolates 12.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.97
Nodule 0.22
Rhizoplane 0.66
Rhizosphere 83.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209758_1002667 3300025297 Bacteria 17635
2 JGI24737J22298_10018570 3300001990 Bacteria 2230
3 JGI24738J21930_10007110 3300002075 Bacteria 2597
4 rootH2_10000022 3300003320 Bacteria 7082
5 rootH2_10115570 3300003320 Bacteria 2471
6 rootH1_10009375 3300003323 Bacteria 2573
7 rootH1_10009376 3300003323 Bacteria 9165
8 Ga0006562J51391_1048212 3300003578 Bacteria 6920
9 Ga0070683_100210702 3300005329 Bacteria 1846
10 Ga0070665_100282094 3300005548 Bacteria 1663
11 Ga0081455_10109182 3300005937 Bacteria 2202
12 Ga0075367_10001095 3300006178 Bacteria 11193
13 Ga0105248_10104830 3300009177 Bacteria 3188
14 Ga0105246_10000853 3300011119 Bacteria 17428
15 Ga0157378_10351936 3300013297 Bacteria 1439
16 Ga0157372_10378687 3300013307 Bacteria 1649
17 Ga0182008_10005794 3300014497 Bacteria 6987
18 Ga0182007_10002177 3300015262 Bacteria 9937
19 Ga0183367_1008 3300015688 Bacteria 490626
20 Ga0207426_1001153 3300025302 Bacteria 23778
21 Ga0207426_1002259 3300025302 Bacteria 12748
22 Ga0207426_1031317 3300025302 Bacteria 1736
23 Ga0207647_10022494 3300025904 Bacteria 4185
24 Ga0207687_10027277 3300025927 Bacteria 3831
25 Ga0207691_10295240 3300025940 Bacteria 1393
26 Ga0207711_10156645 3300025941 Bacteria 2059
27 Ga0207661_10176958 3300025944 Bacteria 1861
28 Ga0207703_10492524 3300026035 Bacteria 1150
29 Ga0207639_10104210 3300026041 Bacteria 2300
30 Ga0209371_1010148 3300027312 Bacteria 2925
31 Ga0307517_10001459 3300028786 Bacteria 39609
32 Ga0307515_10001228 3300028794 Bacteria 58620
33 Ga0268256_1004775 3300030500 Bacteria 5509
34 Ga0307511_10143785 3300030521 Bacteria 1391
35 Ga0307512_10046272 3300030522 Bacteria 3550
36 Ga0307512_10073656 3300030522 Bacteria 2514
37 Ga0307513_10007723 3300031456 Bacteria 13886
38 Ga0307513_10139487 3300031456 Bacteria 2353
39 Ga0307509_10007036 3300031507 Bacteria 14878
40 Ga0307509_10214844 3300031507 Bacteria 1743
41 Ga0307508_10007296 3300031616 Bacteria 10297
42 Ga0307508_10027501 3300031616 Bacteria 5146
43 Ga0307514_10050839 3300031649 Bacteria 3214
44 Ga0307514_10168074 3300031649 Bacteria 1438
45 Ga0307516_10006594 3300031730 Bacteria 13567
46 Ga0307516_10013058 3300031730 Bacteria 8885
47 Ga0307516_10036044 3300031730 Bacteria 4955
48 Ga0307516_10043474 3300031730 Bacteria 4452
49 Ga0307516_10073218 3300031730 Bacteria 3283
50 Ga0307507_10107960 3300033179 Bacteria 2291
51 Ga0307510_10005928 3300033180 Bacteria 14580
52 Ga0395900_0122625 3300037418 Bacteria 2666
53 Ga0395898_0011142 3300037466 Bacteria 9362
54 Ga0395901_0019666 3300038443 Bacteria 6903
55 Ga0395901_0219109 3300038443 Bacteria 1990
56 Ga0439436_0010184 3300041404 Bacteria 2870
57 Ga0439439_0000291 3300041406 Bacteria 7988
58 Ga0439439_0021811 3300041406 Bacteria 1597
59 Ga0451845_0220726 3300041501 Bacteria 1182
60 Ga0451853_2936658 3300041512 Bacteria 1141
61 Ga0439433_0002770 3300041999 Bacteria 3733
62 Ga0439433_0003387 3300041999 Bacteria 3420
63 Ga0439448_0074215 3300042005 Bacteria 1135
64 Ga0439449_0006459 3300042007 Bacteria 4483
65 Ga0439449_0023618 3300042007 Bacteria 2298
66 Ga0439450_015426 3300042008 Bacteria 1565
67 Ga0439455_0011980 3300042012 Bacteria 1938
68 Ga0439457_001124 3300042014 Bacteria 8048
69 Ga0439457_007321 3300042014 Bacteria 2655
70 Ga0439462_0052389 3300042015 Bacteria 1098
71 Ga0450903_000147 3300042138 Bacteria 15381
72 Ga0439458_0004219 3300042157 Bacteria 3320
73 Ga0450901_010784 3300042533 Bacteria 948
74 Ga0466969_0022128 3300044656 Bacteria 3284
75 Ga0466972_0004231 3300044658 Bacteria 7174
76 Ga0466972_0019849 3300044658 Bacteria 3359
77 Ga0466972_0116896 3300044658 Bacteria 1258
78 Ga0466965_0000128 3300044683 Bacteria 21771
79 Ga0466965_0016527 3300044683 Bacteria 3514
80 Ga0466966_0013735 3300044684 Bacteria 5359
81 Ga0466961_0000532 3300044693 Bacteria 24186
82 Ga0466963_0000112 3300044694 Bacteria 29946
83 Ga0466963_0000340 3300044694 Bacteria 21185
84 Ga0466963_0028753 3300044694 Bacteria 3573
85 Ga0466971_0018394 3300044719 Bacteria 3095
86 Ga0466971_0021924 3300044719 Bacteria 2843
87 Ga0466971_0039562 3300044719 Bacteria 2116
88 Ga0466968_0051018 3300044735 Bacteria 1767
89 Ga0466968_0101211 3300044735 Bacteria 1286
90 Ga0466970_0000296 3300044765 Bacteria 24328
91 Ga0466970_0119654 3300044765 Bacteria 1442
92 Ga0466957_0000238 3300044842 Bacteria 26166
93 Ga0466960_0001938 3300044901 Bacteria 7648
94 Ga0466959_0002993 3300045049 Bacteria 10918
95 Ga0466959_0120928 3300045049 Bacteria 1862
96 Ga0466958_0003193 3300045836 Bacteria 8452
97 Ga0466958_0151472 3300045836 Bacteria 1463
98 Ga0466967_0004797 3300045976 Bacteria 9214
99 Ga0466967_0015310 3300045976 Bacteria 6009
100 Ga0466967_0379986 3300045976 Bacteria 1371
101 Ga0495617_015203 3300046452 Bacteria 2611
102 Ga0495627_035600 3300046453 Bacteria 1551
103 Ga0495627_098673 3300046453 Bacteria 835
104 Ga0495592_0007095 3300046454 Bacteria 8385
105 Ga0495592_0018846 3300046454 Bacteria 5255
106 Ga0495592_0243354 3300046454 Bacteria 1192
107 Ga0495603_0004749 3300046455 Bacteria 8116
108 Ga0495603_0061540 3300046455 Bacteria 2217
109 Ga0495603_0098696 3300046455 Bacteria 1705
110 Ga0495603_0115850 3300046455 Bacteria 1562
111 Ga0495590_0083400 3300046457 Bacteria 1126
112 Ga0495629_0006158 3300046459 Bacteria 8907
113 Ga0495629_0063762 3300046459 Bacteria 2573
114 Ga0495629_0063802 3300046459 Bacteria 2572
115 Ga0495629_0135633 3300046459 Bacteria 1713
116 Ga0495638_0014721 3300046460 Bacteria 5276
117 Ga0495638_0017529 3300046460 Bacteria 4771
118 Ga0495651_0002109 3300046462 Bacteria 15350
119 Ga0495651_0002277 3300046462 Bacteria 14820
120 Ga0495651_0091196 3300046462 Bacteria 2284
121 Ga0495582_0069447 3300046473 Bacteria 1948
122 Ga0495582_0113960 3300046473 Bacteria 1520
123 Ga0495605_0005130 3300046474 Bacteria 7634
124 Ga0495639_0001135 3300046475 Bacteria 12028
125 Ga0495662_0000521 3300046476 Bacteria 17569
126 Ga0495662_0008861 3300046476 Bacteria 4942
127 Ga0495662_0013375 3300046476 Bacteria 3992
128 Ga0495664_0006775 3300046477 Bacteria 6335
129 Ga0495664_0065968 3300046477 Bacteria 2159
130 Ga0495664_0170299 3300046477 Bacteria 1321
131 Ga0495585_0005430 3300046492 Bacteria 8037
132 Ga0495585_0094769 3300046492 Bacteria 1604
133 Ga0495594_0003897 3300046499 Bacteria 7676
134 Ga0495594_0027372 3300046499 Bacteria 3072
135 Ga0495594_0040743 3300046499 Bacteria 2543
136 Ga0495594_0059886 3300046499 Bacteria 2106
137 Ga0495594_0061308 3300046499 Bacteria 2081
138 Ga0495594_0180322 3300046499 Bacteria 1202
139 Ga0495596_0088287 3300046500 Bacteria 1203
140 Ga0495607_0100673 3300046501 Bacteria 1548
141 Ga0495606_0029016 3300046507 Bacteria 3891
142 Ga0495610_0005905 3300046512 Bacteria 8577
143 Ga0495616_0182588 3300046513 Bacteria 931
144 Ga0495618_0062862 3300046514 Bacteria 2356
145 Ga0495618_0079972 3300046514 Bacteria 2085
146 Ga0495618_0210276 3300046514 Bacteria 1229
147 Ga0495620_0042945 3300046515 Bacteria 1972
148 Ga0495628_0014305 3300046516 Bacteria 6657
149 Ga0495628_0099732 3300046516 Bacteria 2242
150 Ga0495631_0014521 3300046518 Bacteria 3799
151 Ga0495632_0040155 3300046519 Bacteria 2358
152 Ga0495632_0081564 3300046519 Bacteria 1542
153 Ga0495637_0046906 3300046520 Bacteria 1826
154 Ga0495637_0110639 3300046520 Bacteria 1065
155 Ga0495643_0026348 3300046522 Bacteria 3281
156 Ga0495643_0035938 3300046522 Bacteria 2725
157 Ga0495643_0047629 3300046522 Bacteria 2320
158 Ga0495666_0038620 3300046526 Bacteria 2321
159 Ga0495666_0076881 3300046526 Bacteria 1582
160 Ga0495652_0006379 3300046529 Bacteria 10980
161 Ga0495652_0067863 3300046529 Bacteria 2989
162 Ga0495654_0017357 3300046530 Bacteria 3786
163 Ga0495665_0129616 3300046531 Bacteria 1320
164 Ga0495640_0001208 3300046533 Bacteria 20192
165 Ga0495640_0035074 3300046533 Bacteria 3553
166 Ga0495586_0137727 3300046535 Bacteria 1369
167 Ga0495587_0000883 3300046536 Bacteria 19828
168 Ga0495609_0065000 3300046538 Bacteria 1608
169 Ga0495597_0119690 3300046542 Bacteria 1098
170 Ga0495645_0020996 3300046543 Bacteria 4719
171 Ga0495645_0146213 3300046543 Bacteria 1646
172 Ga0495622_0028516 3300046557 Bacteria 2607
173 Ga0495622_0052571 3300046557 Bacteria 1890
174 Ga0495633_0012595 3300046558 Bacteria 4488
175 Ga0495667_0030622 3300046559 Bacteria 3615
176 Ga0495668_0020272 3300046616 Bacteria 3825
177 Ga0495634_0004050 3300046642 Bacteria 11612
178 Ga0495634_0096447 3300046642 Bacteria 1915
179 Ga0495634_0163046 3300046642 Bacteria 1404
180 Ga0495634_0288648 3300046642 Bacteria 994
181 Ga0495611_0005056 3300046648 Bacteria 5655
182 Ga0495611_0025869 3300046648 Bacteria 2559
183 Ga0495625_0176870 3300046660 Bacteria 1421
184 Ga0495635_0000321 3300046663 Bacteria 30958
185 Ga0495635_0212971 3300046663 Bacteria 1308
186 Ga0495588_0001891 3300046674 Bacteria 8936
187 Ga0495588_0013628 3300046674 Bacteria 3875
188 Ga0495588_0120959 3300046674 Bacteria 1380
189 Ga0495657_0008424 3300046675 Bacteria 7886
190 Ga0495657_0021229 3300046675 Bacteria 4660
191 Ga0495657_0022666 3300046675 Bacteria 4494
192 Ga0495657_0033691 3300046675 Bacteria 3564
193 Ga0495657_0050223 3300046675 Bacteria 2804
194 Ga0495599_0331911 3300046678 Bacteria 914
195 Ga0495623_0013822 3300046679 Bacteria 5233
196 Ga0495623_0087982 3300046679 Bacteria 1913
197 Ga0495646_0000440 3300046680 Bacteria 21966
198 Ga0495646_0177284 3300046680 Bacteria 1171
199 Ga0495658_0005888 3300046683 Bacteria 6016
200 Ga0495613_0002118 3300046689 Bacteria 15063
201 Ga0495613_0012787 3300046689 Bacteria 6241
202 Ga0495613_0057735 3300046689 Bacteria 2849
203 Ga0495613_0071837 3300046689 Bacteria 2522
204 Ga0495613_0193536 3300046689 Bacteria 1436
205 Ga0495613_0452658 3300046689 Bacteria 869
206 Ga0495613_0455356 3300046689 Bacteria 866
207 Ga0495624_0029661 3300046690 Bacteria 3567
208 Ga0495624_0099964 3300046690 Bacteria 1786
209 Ga0495671_0002010 3300046692 Bacteria 13073
210 Ga0495671_0300273 3300046692 Bacteria 772
211 Ga0495589_0006851 3300046794 Bacteria 5992
212 Ga0495589_0008999 3300046794 Bacteria 5193
213 Ga0495589_0052713 3300046794 Bacteria 2009
214 Ga0495600_0066663 3300046809 Bacteria 2353
215 Ga0495600_0077301 3300046809 Bacteria 2173
216 Ga0495600_0267176 3300046809 Bacteria 1085
217 Ga0495660_0006011 3300046810 Bacteria 7217
218 Ga0495660_0167138 3300046810 Bacteria 1074
219 Ga0495581_0000548 3300047315 Bacteria 19401
220 Ga0495581_0132313 3300047315 Bacteria 1453
221 Ga0495581_0164818 3300047315 Bacteria 1296
222 Ga0495581_0166207 3300047315 Bacteria 1290
223 Ga0495604_0011837 3300047317 Bacteria 6939
224 Ga0495636_0010580 3300047318 Bacteria 3645
225 Ga0495636_0013138 3300047318 Bacteria 3284
226 Ga0495636_0014651 3300047318 Bacteria 3119
227 Ga0495636_0017231 3300047318 Bacteria 2891
228 Ga0495676_0068281 3300047321 Bacteria 2747
229 Ga0495676_0068622 3300047321 Bacteria 2738
230 Ga0495676_0079908 3300047321 Bacteria 2484
231 Ga0495676_0091142 3300047321 Bacteria 2279
232 Ga0495680_0041229 3300047322 Bacteria 3672
233 Ga0495687_011537 3300047443 Bacteria 4743
234 Ga0495687_015505 3300047443 Bacteria 3871
235 Ga0495687_028117 3300047443 Bacteria 2619
236 Ga0495687_042692 3300047443 Bacteria 1980
237 Ga0495687_049820 3300047443 Bacteria 1788
238 Ga0495687_111351 3300047443 Bacteria 1005
239 Ga0495687_116982 3300047443 Bacteria 968
240 Ga0495675_0056956 3300047444 Bacteria 2478
241 Ga0495675_0061276 3300047444 Bacteria 2383
242 Ga0495675_0129930 3300047444 Bacteria 1566
243 Ga0495677_0013704 3300047445 Bacteria 2950
244 Ga0495679_032380 3300047446 Bacteria 1677
245 Ga0495685_003213 3300047447 Bacteria 5192
246 Ga0495685_005272 3300047447 Bacteria 4211
247 Ga0495685_009194 3300047447 Bacteria 3296
248 Ga0495685_011486 3300047447 Bacteria 2989
249 Ga0495685_038793 3300047447 Bacteria 1631
250 Ga0495681_0001734 3300047470 Bacteria 16131
251 Ga0495681_0005770 3300047470 Bacteria 8233
252 Ga0495681_0115954 3300047470 Bacteria 1155
253 Ga0495684_0051049 3300047471 Bacteria 3157
254 Ga0495684_0301383 3300047471 Bacteria 1151
255 Ga0495686_0035689 3300047472 Bacteria 3195
256 Ga0495686_0071144 3300047472 Bacteria 2142
257 Ga0495593_0010263 3300047673 Bacteria 5414
258 Ga0495593_0029648 3300047673 Bacteria 2998
259 Ga0495602_0080695 3300048088 Bacteria 2739
260 Ga0495614_0029242 3300048089 Bacteria 2371
261 Ga0496108_0098434 3300048911 Bacteria 2493
262 Ga0496109_0288649 3300048912 Bacteria 1546
263 Ga0495678_018464 3300049459 Bacteria 3135
264 Ga0501031_0001700 3300049568 Bacteria 13820
265 Ga0501031_0006767 3300049568 Bacteria 7478
266 Ga0501031_0049273 3300049568 Bacteria 2745
267 Ga0501031_0138299 3300049568 Bacteria 1591
268 Ga0501031_0358926 3300049568 Bacteria 943
269 Ga0501032_0001406 3300049569 Bacteria 19142
270 Ga0501032_0014702 3300049569 Bacteria 5538
271 Ga0501032_0014818 3300049569 Bacteria 5517
272 Ga0501032_0019090 3300049569 Bacteria 4797
273 Ga0501032_0080644 3300049569 Bacteria 2165
274 Ga0501032_0250718 3300049569 Bacteria 1149
275 Ga0501033_0013505 3300049570 Bacteria 6218
276 Ga0501033_0016154 3300049570 Bacteria 5652
277 Ga0501033_0035422 3300049570 Bacteria 3742
278 Ga0501033_0118701 3300049570 Bacteria 1921
279 Ga0501033_0233655 3300049570 Bacteria 1305
280 Ga0501033_0294181 3300049570 Bacteria 1144
281 Ga0501034_0001466 3300049571 Bacteria 31246
282 Ga0501034_0009762 3300049571 Bacteria 10037
283 Ga0501034_0012189 3300049571 Bacteria 8890
284 Ga0501034_0074783 3300049571 Bacteria 3395
285 Ga0501034_0111730 3300049571 Bacteria 2723
286 Ga0501036_0001337 3300049572 Bacteria 18941
287 Ga0501036_0003976 3300049572 Bacteria 11878
288 Ga0501036_0014596 3300049572 Bacteria 6543
289 Ga0501036_0015430 3300049572 Bacteria 6381
290 Ga0501036_0041588 3300049572 Bacteria 3888
291 Ga0501036_0144950 3300049572 Bacteria 2003
292 Ga0501037_0003867 3300049573 Bacteria 10863
293 Ga0501037_0009593 3300049573 Bacteria 7103
294 Ga0501037_0219443 3300049573 Bacteria 1338
295 Ga0501037_0387139 3300049573 Bacteria 960
296 Ga0501037_0451047 3300049573 Bacteria 877
297 Ga0501038_0007868 3300049574 Bacteria 9824
298 Ga0501038_0013078 3300049574 Bacteria 7570
299 Ga0501038_0083193 3300049574 Bacteria 2694
300 Ga0501038_0193918 3300049574 Bacteria 1633
301 Ga0501038_0299442 3300049574 Bacteria 1262
302 Ga0501039_0009160 3300049575 Bacteria 7541
303 Ga0501039_0055325 3300049575 Bacteria 3072
304 Ga0501039_0064071 3300049575 Bacteria 2848
305 Ga0501040_0013631 3300049576 Bacteria 5346
306 Ga0501041_0002784 3300049577 Bacteria 9982
307 Ga0501042_0002104 3300049578 Bacteria 12071
308 Ga0501042_0003669 3300049578 Bacteria 9680
309 Ga0501042_0049367 3300049578 Bacteria 3002
310 Ga0501043_0001759 3300049579 Bacteria 18643
311 Ga0501043_0002734 3300049579 Bacteria 14745
312 Ga0501043_0008305 3300049579 Bacteria 8176
313 Ga0501043_0009220 3300049579 Bacteria 7755
314 Ga0501043_0070567 3300049579 Bacteria 2744
315 Ga0501043_0080740 3300049579 Bacteria 2555
316 Ga0501046_0023396 3300049580 Bacteria 5084
317 Ga0501046_0027907 3300049580 Bacteria 4601
318 Ga0501046_0155593 3300049580 Bacteria 1722
319 Ga0501046_0203242 3300049580 Bacteria 1473
320 Ga0501047_0000075 3300049581 Bacteria 124995
321 Ga0501047_0000638 3300049581 Bacteria 36795
322 Ga0501047_0001798 3300049581 Bacteria 20753
323 Ga0501047_0025454 3300049581 Bacteria 5689
324 Ga0501047_0082620 3300049581 Bacteria 3087
325 Ga0501047_0195087 3300049581 Bacteria 1887
326 Ga0501047_0229688 3300049581 Bacteria 1709
327 Ga0501047_0426145 3300049581 Bacteria 1158
328 Ga0501047_0528128 3300049581 Bacteria 1005
329 Ga0501048_0002395 3300049582 Bacteria 14308
330 Ga0501048_0045364 3300049582 Bacteria 3139
331 Ga0501067_0002514 3300049583 Bacteria 10125
332 Ga0501068_0001298 3300049584 Bacteria 13241
333 Ga0501069_0011949 3300049585 Bacteria 4607
334 Ga0501070_0000544 3300049586 Bacteria 34498
335 Ga0501070_0024643 3300049586 Bacteria 5045
336 Ga0501070_0086149 3300049586 Bacteria 2600
337 Ga0501070_0107887 3300049586 Bacteria 2301
338 Ga0501070_0350452 3300049586 Bacteria 1198
339 Ga0501071_0001084 3300049587 Bacteria 15117
340 Ga0501072_0011659 3300049588 Bacteria 6715
341 Ga0501072_0237700 3300049588 Bacteria 1451
342 Ga0501073_0060620 3300049589 Bacteria 2640
343 Ga0501073_0170365 3300049589 Bacteria 1507
344 Ga0501074_0015747 3300049590 Bacteria 5497
345 Ga0501074_0016734 3300049590 Bacteria 5321
346 Ga0501076_0004528 3300049592 Bacteria 9900
347 Ga0501077_0037410 3300049593 Bacteria 3091
348 Ga0501079_0012379 3300049741 Bacteria 6510
349 Ga0501080_0092169 3300049742 Bacteria 2814
350 Ga0501080_0165548 3300049742 Bacteria 2040
351 Ga0501083_0002375 3300049744 Bacteria 12890
352 Ga0501035_0002359 3300049822 Bacteria 18572
353 Ga0501035_0003731 3300049822 Bacteria 14524
354 Ga0501035_0004616 3300049822 Bacteria 13065
355 Ga0501035_0016796 3300049822 Bacteria 6748
356 Ga0501035_0067418 3300049822 Bacteria 3175
357 Ga0501035_0122559 3300049822 Bacteria 2271
358 Ga0501035_0296046 3300049822 Bacteria 1364
359 Ga0501044_0002888 3300049823 Bacteria 19567
360 Ga0501044_0015483 3300049823 Bacteria 8213
361 Ga0501044_0022233 3300049823 Bacteria 6758
362 Ga0501044_0029951 3300049823 Bacteria 5738
363 Ga0501044_0063182 3300049823 Bacteria 3783
364 Ga0501044_0068052 3300049823 Bacteria 3628
365 Ga0501044_0190046 3300049823 Bacteria 2016
366 Ga0501044_0342603 3300049823 Bacteria 1415
367 Ga0501045_0065001 3300049824 Bacteria 2678
368 Ga0501045_0168016 3300049824 Bacteria 1634
369 nmdc:mga03n38_28402_c1 3300050490 Bacteria 2331
370 nmdc:mga07m45_26411_c1 3300050496 Bacteria 3192
371 nmdc:mga07m45_396990_c1 3300050496 Bacteria 800
372 Ga0495655_0017988 3300053083 Bacteria 1547
373 Ga0495619_0027043 3300053085 Bacteria 3695
374 Ga0500583_0147119 3300053092 Bacteria 1172
375 Ga0500566_0033550 3300053094 Bacteria 2990
376 Ga0500640_054671 3300053095 Bacteria 1740
377 Ga0500553_121693 3300053101 Bacteria 1073
378 Ga0500560_002661 3300053107 Bacteria 3464
379 Ga0500560_005043 3300053107 Bacteria 2879
380 Ga0500569_002592 3300053109 Bacteria 3589
381 Ga0500652_000928 3300053131 Bacteria 9675
382 Ga0500652_187257 3300053131 Bacteria 846
383 Ga0500658_0004108 3300053134 Bacteria 5473
384 Ga0500561_0001772 3300053137 Bacteria 3556
385 Ga0500573_0038221 3300053140 Bacteria 2774
386 Ga0500579_027310 3300053143 Bacteria 3674
387 Ga0500588_0013738 3300053146 Bacteria 2037
388 Ga0500616_0079448 3300053153 Bacteria 1651
389 Ga0500633_0002142 3300053160 Bacteria 3985
390 Ga0500634_0049452 3300053161 Bacteria 2266
391 Ga0500656_000117 3300053732 Bacteria 4602
392 Ga0500587_003904 3300053739 Bacteria 2063
393 Ga0501084_0001682 3300054114 Bacteria 17575
394 Ga0501084_0433143 3300054114 Bacteria 1112
395 Ga0501082_0001998 3300060353 Bacteria 17925
396 Ga0466962_0001620 3300061719 Bacteria 10547
397 Ga0530510_0146279 3300061734 Bacteria 1743
398 2547406204 2547132111 Bacteria 8013147
399 2616700547 2616644814 Bacteria 11555299
400 2643900288 2643221578 Bacteria 9213798
401 2644262774 2643221647 Bacteria 10741251
402 2644405488 2643221673 Bacteria 9196637
403 2644628355 2643221714 Bacteria 9015452
404 2784589129 2784132148 Bacteria 8627943
405 2785370148 2784746768 Bacteria 10036182
406 2786671161 2786546132 Bacteria 10419719
407 2793980918 2791355406 Bacteria 11364898
408 2804846250 2802429296 Bacteria 7227771
409 2808921100 2808606375 Bacteria 9466072
410 2812357518 2811994879 Bacteria 9313447
411 2852637405 2852635781 Bacteria 8251373
412 2862286192 2862281513 Bacteria 9621493
413 2862295345 2862290372 Bacteria 7471434
414 2862578729 2862574272 Bacteria 10567477
415 2867429159 2867428634 Bacteria 9590268
416 2867480358 2867475112 Bacteria 6909112
417 2875395066 2875391855 Bacteria 7600475
418 2877680544 2877676314 Bacteria 9512378
419 2912719194 2912715099 Bacteria 9460473
420 2912724065 2912723979 Bacteria 8557534
421 2912731464 2912723979 Bacteria 8557534
422 2946049374 2946045630 Bacteria 8527308
423 2946068358 2946064051 Bacteria 8957905
424 2947228552 2947224130 Bacteria 9938529
425 2954006972 2954002825 Bacteria 9173742
426 2954385661 2954380949 Bacteria 10050426
427 2954677494 2954673503 Bacteria 9685905
428 2954686660 2954682443 Bacteria 9862841
429 2954696311 2954691527 Bacteria 10720516
430 2954711474 2954701450 Bacteria 10834262
431 2954715677 2954711539 Bacteria 10867210
432 2954725614 2954721474 Bacteria 10456478
433 2954736198 2954731030 Bacteria 10243860
434 2954744553 2954740390 Bacteria 10229294
435 2954755045 2954749733 Bacteria 10366972
436 2954763536 2954759201 Bacteria 9358192
437 2997458927 2997451912 Bacteria 8492419
438 3006325843 3006321560 Bacteria 8247479
439 3006398305 3006393351 Bacteria 6615579
440 3006489760 3006486233 Bacteria 8157040
441 3006499521 3006493962 Bacteria 8825450
442 8008578382 8008574985 Bacteria 7815457
443 8023630763 8023623736 Bacteria 8593882
444 8025418846 8025413630 Bacteria 7014048
445 8025534551 8025530807 Bacteria 8495698
446 8047897485 8047893842 Bacteria 11723082
447 8048127928 8048127548 Bacteria 11053136
448 8048361385 8048356638 Bacteria 11044339
449 8048374472 8048369669 Bacteria 11666822
450 8048383750 8048379754 Bacteria 11877923
451 8048410325 8048406513 Bacteria 8936924
452 8056837926 8056829672 Bacteria 9045328
453 Ga0209758_1002667
454 JGI24737J22298_10018570
455 JGI24738J21930_10007110
456 rootH2_10000022
457 rootH2_10115570
458 rootH1_10009375
459 rootH1_10009376
460 Ga0006562J51391_1048212
461 Ga0070683_100210702
462 Ga0070665_100282094
463 Ga0081455_10109182
464 Ga0075367_10001095
465 Ga0105248_10104830
466 Ga0105246_10000853
467 Ga0157378_10351936
468 Ga0157372_10378687
469 Ga0182008_10005794
470 Ga0182007_10002177
471 Ga0183367_1008
472 Ga0207426_1001153
473 Ga0207426_1002259
474 Ga0207426_1031317
475 Ga0207647_10022494
476 Ga0207687_10027277
477 Ga0207691_10295240
478 Ga0207711_10156645
479 Ga0207661_10176958
480 Ga0207703_10492524
481 Ga0207639_10104210
482 Ga0209371_1010148
483 Ga0307517_10001459
484 Ga0307515_10001228
485 Ga0268256_1004775
486 Ga0307511_10143785
487 Ga0307512_10046272
488 Ga0307512_10073656
489 Ga0307513_10007723
490 Ga0307513_10139487
491 Ga0307509_10007036
492 Ga0307509_10214844
493 Ga0307508_10007296
494 Ga0307508_10027501
495 Ga0307514_10050839
496 Ga0307514_10168074
497 Ga0307516_10006594
498 Ga0307516_10013058
499 Ga0307516_10036044
500 Ga0307516_10043474
501 Ga0307516_10073218
502 Ga0307507_10107960
503 Ga0307510_10005928
504 Ga0395900_0122625
505 Ga0395898_0011142
506 Ga0395901_0019666
507 Ga0395901_0219109
508 Ga0439436_0010184
509 Ga0439439_0000291
510 Ga0439439_0021811
511 Ga0451845_0220726
512 Ga0451853_2936658
513 Ga0439433_0002770
514 Ga0439433_0003387
515 Ga0439448_0074215
516 Ga0439449_0006459
517 Ga0439449_0023618
518 Ga0439450_015426
519 Ga0439455_0011980
520 Ga0439457_001124
521 Ga0439457_007321
522 Ga0439462_0052389
523 Ga0450903_000147
524 Ga0439458_0004219
525 Ga0450901_010784
526 Ga0466969_0022128
527 Ga0466972_0004231
528 Ga0466972_0019849
529 Ga0466972_0116896
530 Ga0466965_0000128
531 Ga0466965_0016527
532 Ga0466966_0013735
533 Ga0466961_0000532
534 Ga0466963_0000112
535 Ga0466963_0000340
536 Ga0466963_0028753
537 Ga0466971_0018394
538 Ga0466971_0021924
539 Ga0466971_0039562
540 Ga0466968_0051018
541 Ga0466968_0101211
542 Ga0466970_0000296
543 Ga0466970_0119654
544 Ga0466957_0000238
545 Ga0466960_0001938
546 Ga0466959_0002993
547 Ga0466959_0120928
548 Ga0466958_0003193
549 Ga0466958_0151472
550 Ga0466967_0004797
551 Ga0466967_0015310
552 Ga0466967_0379986
553 Ga0495617_015203
554 Ga0495627_035600
555 Ga0495627_098673
556 Ga0495592_0007095
557 Ga0495592_0018846
558 Ga0495592_0243354
559 Ga0495603_0004749
560 Ga0495603_0061540
561 Ga0495603_0098696
562 Ga0495603_0115850
563 Ga0495590_0083400
564 Ga0495629_0006158
565 Ga0495629_0063762
566 Ga0495629_0063802
567 Ga0495629_0135633
568 Ga0495638_0014721
569 Ga0495638_0017529
570 Ga0495651_0002109
571 Ga0495651_0002277
572 Ga0495651_0091196
573 Ga0495582_0069447
574 Ga0495582_0113960
575 Ga0495605_0005130
576 Ga0495639_0001135
577 Ga0495662_0000521
578 Ga0495662_0008861
579 Ga0495662_0013375
580 Ga0495664_0006775
581 Ga0495664_0065968
582 Ga0495664_0170299
583 Ga0495585_0005430
584 Ga0495585_0094769
585 Ga0495594_0003897
586 Ga0495594_0027372
587 Ga0495594_0040743
588 Ga0495594_0059886
589 Ga0495594_0061308
590 Ga0495594_0180322
591 Ga0495596_0088287
592 Ga0495607_0100673
593 Ga0495606_0029016
594 Ga0495610_0005905
595 Ga0495616_0182588
596 Ga0495618_0062862
597 Ga0495618_0079972
598 Ga0495618_0210276
599 Ga0495620_0042945
600 Ga0495628_0014305
601 Ga0495628_0099732
602 Ga0495631_0014521
603 Ga0495632_0040155
604 Ga0495632_0081564
605 Ga0495637_0046906
606 Ga0495637_0110639
607 Ga0495643_0026348
608 Ga0495643_0035938
609 Ga0495643_0047629
610 Ga0495666_0038620
611 Ga0495666_0076881
612 Ga0495652_0006379
613 Ga0495652_0067863
614 Ga0495654_0017357
615 Ga0495665_0129616
616 Ga0495640_0001208
617 Ga0495640_0035074
618 Ga0495586_0137727
619 Ga0495587_0000883
620 Ga0495609_0065000
621 Ga0495597_0119690
622 Ga0495645_0020996
623 Ga0495645_0146213
624 Ga0495622_0028516
625 Ga0495622_0052571
626 Ga0495633_0012595
627 Ga0495667_0030622
628 Ga0495668_0020272
629 Ga0495634_0004050
630 Ga0495634_0096447
631 Ga0495634_0163046
632 Ga0495634_0288648
633 Ga0495611_0005056
634 Ga0495611_0025869
635 Ga0495625_0176870
636 Ga0495635_0000321
637 Ga0495635_0212971
638 Ga0495588_0001891
639 Ga0495588_0013628
640 Ga0495588_0120959
641 Ga0495657_0008424
642 Ga0495657_0021229
643 Ga0495657_0022666
644 Ga0495657_0033691
645 Ga0495657_0050223
646 Ga0495599_0331911
647 Ga0495623_0013822
648 Ga0495623_0087982
649 Ga0495646_0000440
650 Ga0495646_0177284
651 Ga0495658_0005888
652 Ga0495613_0002118
653 Ga0495613_0012787
654 Ga0495613_0057735
655 Ga0495613_0071837
656 Ga0495613_0193536
657 Ga0495613_0452658
658 Ga0495613_0455356
659 Ga0495624_0029661
660 Ga0495624_0099964
661 Ga0495671_0002010
662 Ga0495671_0300273
663 Ga0495589_0006851
664 Ga0495589_0008999
665 Ga0495589_0052713
666 Ga0495600_0066663
667 Ga0495600_0077301
668 Ga0495600_0267176
669 Ga0495660_0006011
670 Ga0495660_0167138
671 Ga0495581_0000548
672 Ga0495581_0132313
673 Ga0495581_0164818
674 Ga0495581_0166207
675 Ga0495604_0011837
676 Ga0495636_0010580
677 Ga0495636_0013138
678 Ga0495636_0014651
679 Ga0495636_0017231
680 Ga0495676_0068281
681 Ga0495676_0068622
682 Ga0495676_0079908
683 Ga0495676_0091142
684 Ga0495680_0041229
685 Ga0495687_011537
686 Ga0495687_015505
687 Ga0495687_028117
688 Ga0495687_042692
689 Ga0495687_049820
690 Ga0495687_111351
691 Ga0495687_116982
692 Ga0495675_0056956
693 Ga0495675_0061276
694 Ga0495675_0129930
695 Ga0495677_0013704
696 Ga0495679_032380
697 Ga0495685_003213
698 Ga0495685_005272
699 Ga0495685_009194
700 Ga0495685_011486
701 Ga0495685_038793
702 Ga0495681_0001734
703 Ga0495681_0005770
704 Ga0495681_0115954
705 Ga0495684_0051049
706 Ga0495684_0301383
707 Ga0495686_0035689
708 Ga0495686_0071144
709 Ga0495593_0010263
710 Ga0495593_0029648
711 Ga0495602_0080695
712 Ga0495614_0029242
713 Ga0496108_0098434
714 Ga0496109_0288649
715 Ga0495678_018464
716 Ga0501031_0001700
717 Ga0501031_0006767
718 Ga0501031_0049273
719 Ga0501031_0138299
720 Ga0501031_0358926
721 Ga0501032_0001406
722 Ga0501032_0014702
723 Ga0501032_0014818
724 Ga0501032_0019090
725 Ga0501032_0080644
726 Ga0501032_0250718
727 Ga0501033_0013505
728 Ga0501033_0016154
729 Ga0501033_0035422
730 Ga0501033_0118701
731 Ga0501033_0233655
732 Ga0501033_0294181
733 Ga0501034_0001466
734 Ga0501034_0009762
735 Ga0501034_0012189
736 Ga0501034_0074783
737 Ga0501034_0111730
738 Ga0501036_0001337
739 Ga0501036_0003976
740 Ga0501036_0014596
741 Ga0501036_0015430
742 Ga0501036_0041588
743 Ga0501036_0144950
744 Ga0501037_0003867
745 Ga0501037_0009593
746 Ga0501037_0219443
747 Ga0501037_0387139
748 Ga0501037_0451047
749 Ga0501038_0007868
750 Ga0501038_0013078
751 Ga0501038_0083193
752 Ga0501038_0193918
753 Ga0501038_0299442
754 Ga0501039_0009160
755 Ga0501039_0055325
756 Ga0501039_0064071
757 Ga0501040_0013631
758 Ga0501041_0002784
759 Ga0501042_0002104
760 Ga0501042_0003669
761 Ga0501042_0049367
762 Ga0501043_0001759
763 Ga0501043_0002734
764 Ga0501043_0008305
765 Ga0501043_0009220
766 Ga0501043_0070567
767 Ga0501043_0080740
768 Ga0501046_0023396
769 Ga0501046_0027907
770 Ga0501046_0155593
771 Ga0501046_0203242
772 Ga0501047_0000075
773 Ga0501047_0000638
774 Ga0501047_0001798
775 Ga0501047_0025454
776 Ga0501047_0082620
777 Ga0501047_0195087
778 Ga0501047_0229688
779 Ga0501047_0426145
780 Ga0501047_0528128
781 Ga0501048_0002395
782 Ga0501048_0045364
783 Ga0501067_0002514
784 Ga0501068_0001298
785 Ga0501069_0011949
786 Ga0501070_0000544
787 Ga0501070_0024643
788 Ga0501070_0086149
789 Ga0501070_0107887
790 Ga0501070_0350452
791 Ga0501071_0001084
792 Ga0501072_0011659
793 Ga0501072_0237700
794 Ga0501073_0060620
795 Ga0501073_0170365
796 Ga0501074_0015747
797 Ga0501074_0016734
798 Ga0501076_0004528
799 Ga0501077_0037410
800 Ga0501079_0012379
801 Ga0501080_0092169
802 Ga0501080_0165548
803 Ga0501083_0002375
804 Ga0501035_0002359
805 Ga0501035_0003731
806 Ga0501035_0004616
807 Ga0501035_0016796
808 Ga0501035_0067418
809 Ga0501035_0122559
810 Ga0501035_0296046
811 Ga0501044_0002888
812 Ga0501044_0015483
813 Ga0501044_0022233
814 Ga0501044_0029951
815 Ga0501044_0063182
816 Ga0501044_0068052
817 Ga0501044_0190046
818 Ga0501044_0342603
819 Ga0501045_0065001
820 Ga0501045_0168016
821 nmdc:mga03n38_28402_c1
822 nmdc:mga07m45_26411_c1
823 nmdc:mga07m45_396990_c1
824 Ga0495655_0017988
825 Ga0495619_0027043
826 Ga0500583_0147119
827 Ga0500566_0033550
828 Ga0500640_054671
829 Ga0500553_121693
830 Ga0500560_002661
831 Ga0500560_005043
832 Ga0500569_002592
833 Ga0500652_000928
834 Ga0500652_187257
835 Ga0500658_0004108
836 Ga0500561_0001772
837 Ga0500573_0038221
838 Ga0500579_027310
839 Ga0500588_0013738
840 Ga0500616_0079448
841 Ga0500633_0002142
842 Ga0500634_0049452
843 Ga0500656_000117
844 Ga0500587_003904
845 Ga0501084_0001682
846 Ga0501084_0433143
847 Ga0501082_0001998
848 Ga0466962_0001620
849 Ga0530510_0146279
850 2547406204
851 2616700547
852 2643900288
853 2644262774
854 2644405488
855 2644628355
856 2784589129
857 2785370148
858 2786671161
859 2793980918
860 2804846250
861 2808921100
862 2812357518
863 2852637405
864 2862286192
865 2862295345
866 2862578729
867 2867429159
868 2867480358
869 2875395066
870 2877680544
871 2912719194
872 2912724065
873 2912731464
874 2946049374
875 2946068358
876 2947228552
877 2954006972
878 2954385661
879 2954677494
880 2954686660
881 2954696311
882 2954711474
883 2954715677
884 2954725614
885 2954736198
886 2954744553
887 2954755045
888 2954763536
889 2997458927
890 3006325843
891 3006398305
892 3006489760
893 3006499521
894 8008578382
895 8023630763
896 8025418846
897 8025534551
898 8047897485
899 8048127928
900 8048361385
901 8048374472
902 8048383750
903 8048410325
904 8056837926

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11716

MDMPI_N

Mycothiol maleylpyruvate isomerase N-terminal domain

14

153

0.94

PF07398

MDMPI_C

MDMPI C-terminal domain

169

264

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qzt-assembly1.cif.gz_A crystal structure of sterol carrier protein 2 like 2 (scp2-l2) from aedes aegypti 0.7401 168 264
6da0-assembly1.cif.gz_A crystal structure of glucokinase (nfhk) from naegleria fowleri 0.7386 191 223
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.734 7 153
1c44-assembly1.cif.gz_A sterol carrier protein 2 (scp2) from rabbit 0.7299 171 271
5cof-assembly1.cif.gz_A crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 0.7104 10 157
ID Description Score Start End Superfamily
af_O05777_178_274_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8646 171 264 3.30.1050.10
af_P64599_56_138_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8351 193 263 3.30.1050.10
af_O05777_178_274_3.30.1050.10 Alpha Beta;2-Layer Sandwich;Nonspecific Lipid-transfer Protein; Chain A;SCP2 sterol-binding domain 0.8227 171 264 3.30.1050.10
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8124 4 156 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7986 13 155 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A454VZA1-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9936 126 274 GO:0016853
AF-A0A1Z1WFA9-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9857 83 274 GO:0046872
AF-A0A1Z1WFA9-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9806 83 274 GO:0046872
AF-A0A454VZA1-F1-model_v4 Maleylpyruvate isomerase family mycothiol-dependent enzyme 0.9805 126 274 GO:0016853
AF-A0A6B3CWU0-F1-model_v4 MDMPI C-terminal domain-containing protein 0.9792 181 261

Map