F446911

General Info

Members Datasets Scaffolds Average Seq Length
452 274 904 205

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10030109|Ga0065715_100301092
Length 245
Sequence LPGHLHVPTGIGVLTSLFVGXTVKLMTPLAARKASPIPDDPVHVVRGAAEAAALLNPDRVRILAALEGPGSASSLAAHVGMTRQRANYHLRELERAGLVELVEERRKGNCTERVLRASARSYLISPEVLGAVGRTPAAEAVQDRFSAAYLITAIARLLRDVALLRHRADRAGKPLATLALETDITFASAADRAAFAEELSGTLAALAAKYHRDQPGGRSFRFVIGGYPAITKREEKSGAEQDHHA

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
145 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
146 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
171 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
204 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
205 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
206 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
242 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
243 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
246 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
247 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
248 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
256 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
261 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
267 2508501039 Frankia saprophytica CN3 Isolate Nodule
268 2517572101 Frankia sp. DC12 Isolate Nodule
269 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
270 2687453737 Frankia sp. BMG5.36 Isolate Nodule
271 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
272 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
273 8002784119 Frankia sp. AgB1.9 Isolate Nodule
274 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.11
Nodule 0.88
Rhizoplane 11.5
Rhizosphere 84.96
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10030109 3300005293 Bacteria 1188
2 Ga0070670_100086231 3300005331 Bacteria 2698
3 Ga0070670_100289469 3300005331 Bacteria 1431
4 Ga0068869_100526491 3300005334 Bacteria 990
5 Ga0070666_10002348 3300005335 Bacteria 11433
6 Ga0070680_100517116 3300005336 Bacteria 1022
7 Ga0070682_100135964 3300005337 Bacteria 1670
8 Ga0068868_100243204 3300005338 Bacteria 1513
9 Ga0070660_100041866 3300005339 Bacteria 3493
10 Ga0070660_100744871 3300005339 Bacteria 823
11 Ga0070691_10105365 3300005341 Bacteria 1405
12 Ga0070668_100021850 3300005347 Bacteria 4833
13 Ga0070675_100197994 3300005354 Bacteria 1743
14 Ga0070675_100359164 3300005354 Unclassified 1293
15 Ga0070671_100318141 3300005355 Bacteria 1326
16 Ga0070674_100645218 3300005356 Bacteria 899
17 Ga0070673_100462399 3300005364 Bacteria 1143
18 Ga0070659_100485560 3300005366 Bacteria 1052
19 Ga0070667_100002656 3300005367 Bacteria 15480
20 Ga0070703_10070893 3300005406 Bacteria 1164
21 Ga0070714_100004495 3300005435 Bacteria 10511
22 Ga0070714_100361450 3300005435 Bacteria 1365
23 Ga0070713_100062880 3300005436 Bacteria 3110
24 Ga0070713_100346481 3300005436 Bacteria 1377
25 Ga0070713_100467015 3300005436 Bacteria 1187
26 Ga0070710_10039635 3300005437 Bacteria 2593
27 Ga0070701_10319440 3300005438 Bacteria 960
28 Ga0070701_10387241 3300005438 Bacteria 883
29 Ga0070705_100030970 3300005440 Bacteria 2958
30 Ga0070700_100095349 3300005441 Bacteria 1950
31 Ga0070700_100116083 3300005441 Bacteria 1787
32 Ga0070700_100307719 3300005441 Bacteria 1159
33 Ga0070708_100428308 3300005445 Bacteria 1248
34 Ga0070678_100214454 3300005456 Bacteria 1597
35 Ga0070662_100111298 3300005457 Bacteria 2086
36 Ga0070662_100124126 3300005457 Bacteria 1982
37 Ga0070681_10096073 3300005458 Bacteria 2912
38 Ga0068867_100233569 3300005459 Bacteria 1488
39 Ga0070685_10645144 3300005466 Bacteria 767
40 Ga0070707_100027141 3300005468 Bacteria 5445
41 Ga0070699_100414905 3300005518 Unclassified 1218
42 Ga0070679_100369673 3300005530 Bacteria 1381
43 Ga0070697_100054941 3300005536 Bacteria 3237
44 Ga0068853_100194239 3300005539 Bacteria 1845
45 Ga0070672_100390826 3300005543 Bacteria 1191
46 Ga0070686_100455980 3300005544 Bacteria 984
47 Ga0070695_100056612 3300005545 Bacteria 2531
48 Ga0070696_100162710 3300005546 Bacteria 1645
49 Ga0070696_100343111 3300005546 Unclassified 1155
50 Ga0070665_100006979 3300005548 Bacteria 11481
51 Ga0070665_100388407 3300005548 Bacteria 1403
52 Ga0070704_100148484 3300005549 Unclassified 1840
53 Ga0070704_100321642 3300005549 Bacteria 1296
54 Ga0068855_100300917 3300005563 Bacteria 1776
55 Ga0070664_100420451 3300005564 Unclassified 1224
56 Ga0070664_101346639 3300005564 Bacteria 674
57 Ga0068857_100024809 3300005577 Bacteria 5281
58 Ga0068854_100262314 3300005578 Bacteria 1384
59 Ga0068856_100011679 3300005614 Bacteria 8518
60 Ga0068856_100482495 3300005614 Bacteria 1261
61 Ga0070702_100037394 3300005615 Bacteria 2696
62 Ga0068852_100170971 3300005616 Bacteria 2037
63 Ga0068852_100193709 3300005616 Bacteria 1920
64 Ga0068852_100510783 3300005616 Bacteria 1198
65 Ga0068859_100000135 3300005617 Bacteria 69109
66 Ga0068864_100068494 3300005618 Bacteria 3083
67 Ga0068864_100071077 3300005618 Bacteria 3030
68 Ga0068864_100259104 3300005618 Bacteria 1617
69 Ga0068866_10096445 3300005718 Bacteria 1622
70 Ga0068861_100049588 3300005719 Bacteria 3180
71 Ga0068870_10015757 3300005840 Bacteria 3595
72 Ga0068870_10083418 3300005840 Bacteria 1771
73 Ga0068870_10091690 3300005840 Bacteria 1700
74 Ga0068858_100022250 3300005842 Bacteria 5919
75 Ga0068858_100312794 3300005842 Bacteria 1500
76 Ga0068858_100339365 3300005842 Bacteria 1438
77 Ga0068860_100871546 3300005843 Bacteria 916
78 Ga0068862_100000116 3300005844 Bacteria 94558
79 Ga0068862_100004179 3300005844 Bacteria 12229
80 Ga0068862_100146460 3300005844 Bacteria 2099
81 Ga0068862_101452925 3300005844 Bacteria 690
82 Ga0081455_10038944 3300005937 Bacteria 4205
83 Ga0081538_10010874 3300005981 Bacteria 7423
84 Ga0081538_10089114 3300005981 Bacteria 1603
85 Ga0070717_10017919 3300006028 Bacteria 5522
86 Ga0070717_10071805 3300006028 Bacteria 2889
87 Ga0070712_100309932 3300006175 Bacteria 1280
88 Ga0070712_100981449 3300006175 Bacteria 730
89 Ga0075428_100001325 3300006844 Bacteria 26235
90 Ga0075428_100015349 3300006844 Bacteria 8494
91 Ga0075428_100263318 3300006844 Bacteria 1856
92 Ga0075431_100118234 3300006847 Bacteria 2735
93 Ga0075431_100258683 3300006847 Bacteria 1767
94 Ga0075433_10048988 3300006852 Bacteria 3675
95 Ga0075433_10328605 3300006852 Unclassified 1352
96 Ga0075434_100002204 3300006871 Bacteria 16981
97 Ga0075434_100010674 3300006871 Bacteria 8624
98 Ga0075434_100659421 3300006871 Bacteria 1064
99 Ga0075429_100011689 3300006880 Bacteria 7611
100 Ga0075429_100210673 3300006880 Bacteria 1703
101 Ga0075436_100037230 3300006914 Bacteria 3359
102 Ga0075436_100310071 3300006914 Bacteria 1132
103 Ga0097620_100000135 3300006931 Bacteria 69109
104 Ga0075435_100000942 3300007076 Bacteria 18348
105 Ga0105240_10503163 3300009093 Bacteria 1347
106 Ga0111539_10155436 3300009094 Bacteria 2676
107 Ga0111539_10295884 3300009094 Bacteria 1884
108 Ga0111539_10866718 3300009094 Bacteria 1050
109 Ga0105245_10038999 3300009098 Bacteria 4227
110 Ga0105245_11324534 3300009098 Bacteria 769
111 Ga0105247_10048810 3300009101 Bacteria 2600
112 Ga0114129_10000343 3300009147 Bacteria 54262
113 Ga0114129_10006217 3300009147 Bacteria 16934
114 Ga0114129_10063735 3300009147 Bacteria 5145
115 Ga0114129_11839728 3300009147 Bacteria 735
116 Ga0105243_10133234 3300009148 Bacteria 2111
117 Ga0105243_10497339 3300009148 Bacteria 1154
118 Ga0105243_10531355 3300009148 Bacteria 1120
119 Ga0105241_10126517 3300009174 Bacteria 2064
120 Ga0105242_10269018 3300009176 Bacteria 1543
121 Ga0105248_10178836 3300009177 Bacteria 2391
122 Ga0105237_10185309 3300009545 Bacteria 2081
123 Ga0105237_11245051 3300009545 Bacteria 751
124 Ga0105238_10012703 3300009551 Bacteria 8499
125 Ga0105249_10001141 3300009553 Bacteria 23504
126 Ga0105249_10233191 3300009553 Bacteria 1816
127 Ga0105249_10380464 3300009553 Bacteria 1437
128 Ga0105249_10891145 3300009553 Bacteria 956
129 Ga0105239_10280327 3300010375 Bacteria 1876
130 Ga0105239_10418761 3300010375 Bacteria 1517
131 Ga0105246_10278324 3300011119 Bacteria 1341
132 Ga0105246_10362573 3300011119 Bacteria 1191
133 Ga0105246_11036723 3300011119 Bacteria 745
134 Ga0157369_10343914 3300013105 Bacteria 1549
135 Ga0157369_10489394 3300013105 Bacteria 1273
136 Ga0157374_10473298 3300013296 Bacteria 1255
137 Ga0163162_10783721 3300013306 Bacteria 1071
138 Ga0157375_10268170 3300013308 Bacteria 1869
139 Ga0157375_10322276 3300013308 Bacteria 1710
140 Ga0163163_10008521 3300014325 Bacteria 9113
141 Ga0163163_10301549 3300014325 Bacteria 1655
142 Ga0157377_10202868 3300014745 Bacteria 1260
143 Ga0157379_10009709 3300014968 Bacteria 8382
144 Ga0157379_10010125 3300014968 Bacteria 8219
145 Ga0157376_10020969 3300014969 Bacteria 5068
146 Ga0157376_10576691 3300014969 Bacteria 1117
147 Ga0207653_10049986 3300025885 Bacteria 1389
148 Ga0207692_10088096 3300025898 Bacteria 1677
149 Ga0207642_10099193 3300025899 Bacteria 1458
150 Ga0207710_10057154 3300025900 Bacteria 1762
151 Ga0207688_10001758 3300025901 Bacteria 11505
152 Ga0207680_10004564 3300025903 Bacteria 6576
153 Ga0207680_10318390 3300025903 Bacteria 1087
154 Ga0207685_10246729 3300025905 Bacteria 862
155 Ga0207643_10023322 3300025908 Bacteria 3411
156 Ga0207643_10051781 3300025908 Bacteria 2331
157 Ga0207705_10152694 3300025909 Bacteria 1731
158 Ga0207654_10046095 3300025911 Bacteria 2485
159 Ga0207707_10026059 3300025912 Bacteria 5112
160 Ga0207707_10309837 3300025912 Bacteria 1364
161 Ga0207695_10559648 3300025913 Bacteria 1025
162 Ga0207671_10139793 3300025914 Bacteria 1865
163 Ga0207663_10122829 3300025916 Bacteria 1781
164 Ga0207660_10330135 3300025917 Bacteria 1219
165 Ga0207657_10002052 3300025919 Bacteria 21796
166 Ga0207657_10037341 3300025919 Bacteria 4339
167 Ga0207652_10151512 3300025921 Bacteria 2076
168 Ga0207646_10082653 3300025922 Bacteria 2872
169 Ga0207694_10101035 3300025924 Bacteria 2285
170 Ga0207650_10243908 3300025925 Bacteria 1453
171 Ga0207650_10330876 3300025925 Bacteria 1249
172 Ga0207659_10137541 3300025926 Bacteria 1893
173 Ga0207687_10003997 3300025927 Bacteria 9884
174 Ga0207687_10061967 3300025927 Bacteria 2643
175 Ga0207700_10105429 3300025928 Bacteria 2258
176 Ga0207664_10004318 3300025929 Bacteria 9626
177 Ga0207664_10135708 3300025929 Bacteria 2076
178 Ga0207690_10114949 3300025932 Bacteria 1944
179 Ga0207706_10049432 3300025933 Bacteria 3715
180 Ga0207709_10151696 3300025935 Bacteria 1606
181 Ga0207709_10181229 3300025935 Bacteria 1488
182 Ga0207670_10522500 3300025936 Bacteria 966
183 Ga0207704_10064614 3300025938 Bacteria 2287
184 Ga0207704_10123780 3300025938 Bacteria 1775
185 Ga0207665_10025758 3300025939 Bacteria 3881
186 Ga0207691_10258329 3300025940 Bacteria 1502
187 Ga0207689_10304954 3300025942 Bacteria 1320
188 Ga0207661_10130917 3300025944 Bacteria 2149
189 Ga0207679_11253528 3300025945 Bacteria 680
190 Ga0207667_10072913 3300025949 Bacteria 3568
191 Ga0207667_10086518 3300025949 Bacteria 3243
192 Ga0207651_10174191 3300025960 Bacteria 1700
193 Ga0207712_10092101 3300025961 Bacteria 2234
194 Ga0207712_10100507 3300025961 Bacteria 2149
195 Ga0207668_10015246 3300025972 Bacteria 4771
196 Ga0207640_10185860 3300025981 Bacteria 1562
197 Ga0207658_10002131 3300025986 Bacteria 14704
198 Ga0207677_10077991 3300026023 Bacteria 2364
199 Ga0207703_10379553 3300026035 Bacteria 1307
200 Ga0207639_10104373 3300026041 Bacteria 2298
201 Ga0207639_11142877 3300026041 Bacteria 731
202 Ga0207708_10023581 3300026075 Bacteria 4653
203 Ga0207708_10100182 3300026075 Bacteria 2242
204 Ga0207708_10178131 3300026075 Bacteria 1687
205 Ga0207702_10003309 3300026078 Bacteria 14833
206 Ga0207702_10259952 3300026078 Bacteria 1634
207 Ga0207648_10013540 3300026089 Bacteria 7582
208 Ga0207648_10081047 3300026089 Bacteria 2831
209 Ga0207676_10483456 3300026095 Bacteria 1173
210 Ga0207674_10022976 3300026116 Bacteria 6689
211 Ga0207675_100347124 3300026118 Bacteria 1454
212 Ga0207683_10093536 3300026121 Bacteria 2679
213 Ga0207683_10125920 3300026121 Bacteria 2302
214 Ga0207683_11301972 3300026121 Bacteria 673
215 Ga0207698_10217684 3300026142 Bacteria 1723
216 Ga0268266_10000097 3300028379 Bacteria 184541
217 Ga0268266_10176969 3300028379 Bacteria 1940
218 Ga0268266_10219083 3300028379 Bacteria 1748
219 Ga0268266_10576857 3300028379 Bacteria 1079
220 Ga0268265_10000126 3300028380 Bacteria 96627
221 Ga0268265_10426543 3300028380 Bacteria 1232
222 Ga0268265_10933788 3300028380 Bacteria 854
223 Ga0268264_10236549 3300028381 Bacteria 1689
224 Ga0268264_10441098 3300028381 Unclassified 1259
225 Ga0268264_10925946 3300028381 Bacteria 876
226 Ga0316576_10000700 3300031727 Bacteria 16505
227 Ga0316576_10119997 3300031727 Bacteria 1974
228 Ga0316578_10013612 3300031728 Bacteria 4320
229 Ga0307518_10001041 3300031838 Bacteria 20741
230 Ga0307410_10260693 3300031852 Bacteria 1352
231 Ga0307410_10529263 3300031852 Bacteria 974
232 Ga0307406_10070344 3300031901 Bacteria 2291
233 Ga0307412_10402236 3300031911 Unclassified 1115
234 Ga0307409_100268763 3300031995 Bacteria 1569
235 Ga0307409_100289152 3300031995 Bacteria 1519
236 Ga0307409_100978542 3300031995 Bacteria 863
237 Ga0307416_100005249 3300032002 Bacteria 7926
238 Ga0307416_100019270 3300032002 Bacteria 4833
239 Ga0307416_100954141 3300032002 Unclassified 960
240 Ga0307416_101299575 3300032002 Bacteria 833
241 Ga0307414_10542600 3300032004 Bacteria 1035
242 Ga0307415_100000605 3300032126 Bacteria 15694
243 Ga0307415_100003723 3300032126 Bacteria 7804
244 Ga0373923_0042808 3300035111 Bacteria 1872
245 Ga0373936_0118064 3300035113 Bacteria 1131
246 Ga0373945_0026182 3300035116 Bacteria 2031
247 Ga0373943_0073909 3300035170 Bacteria 1732
248 Ga0373943_0090980 3300035170 Bacteria 1580
249 Ga0373946_0013351 3300035171 Bacteria 3088
250 Ga0316574_0045421 3300035398 Bacteria 2720
251 Ga0373924_0010957 3300035410 Bacteria 3357
252 Ga0373935_0600116 3300035692 Bacteria 805
253 Ga0373935_0734561 3300035692 Bacteria 727
254 Ga0373947_0017455 3300035725 Bacteria 4127
255 Ga0373947_0325343 3300035725 Bacteria 1029
256 Ga0373947_0364203 3300035725 Bacteria 971
257 Ga0373937_0045089 3300036401 Bacteria 4028
258 Ga0316584_0032437 3300036712 Bacteria 3867
259 Ga0373925_0186570 3300037068 Bacteria 1644
260 Ga0395900_0337130 3300037418 Bacteria 1484
261 Ga0395900_0373572 3300037418 Bacteria 1395
262 Ga0395898_1149854 3300037466 Bacteria 708
263 Ga0395901_0145172 3300038443 Bacteria 2494
264 Ga0395901_0278562 3300038443 Bacteria 1738
265 Ga0439461_0092684 3300041410 Bacteria 726
266 Ga0451837_0569775 3300041494 Unclassified 1324
267 Ga0439434_0059086 3300042435 Bacteria 1197
268 Ga0466966_0405562 3300044684 Bacteria 819
269 Ga0466960_0439458 3300044901 Bacteria 757
270 Ga0466967_0157680 3300045976 Bacteria 2128
271 Ga0495603_0036167 3300046455 Bacteria 2964
272 Ga0495603_0041532 3300046455 Bacteria 2750
273 Ga0495629_0085553 3300046459 Bacteria 2200
274 Ga0495629_0203995 3300046459 Bacteria 1366
275 Ga0495629_0551474 3300046459 Bacteria 774
276 Ga0495653_0134036 3300046463 Bacteria 1749
277 Ga0495582_0006636 3300046473 Bacteria 6429
278 Ga0495639_0060027 3300046475 Bacteria 1741
279 Ga0495662_0033814 3300046476 Bacteria 2469
280 Ga0495662_0056020 3300046476 Bacteria 1904
281 Ga0495664_0011541 3300046477 Bacteria 4982
282 Ga0495584_0024217 3300046491 Bacteria 3078
283 Ga0495585_0288315 3300046492 Bacteria 810
284 Ga0495594_0035393 3300046499 Bacteria 2720
285 Ga0495608_0098419 3300046511 Bacteria 1887
286 Ga0495618_0144690 3300046514 Bacteria 1520
287 Ga0495618_0227676 3300046514 Bacteria 1174
288 Ga0495644_0289339 3300046523 Bacteria 640
289 Ga0495666_0021753 3300046526 Bacteria 3174
290 Ga0495665_0017895 3300046531 Bacteria 3808
291 Ga0495587_0026535 3300046536 Bacteria 3532
292 Ga0495609_0313990 3300046538 Bacteria 637
293 Ga0495645_0339996 3300046543 Bacteria 970
294 Ga0495667_0052945 3300046559 Bacteria 2673
295 Ga0495656_0191134 3300046615 Bacteria 1011
296 Ga0495634_0151166 3300046642 Bacteria 1468
297 Ga0495635_0020755 3300046663 Bacteria 4576
298 Ga0495661_0279118 3300046665 Bacteria 843
299 Ga0495588_0044781 3300046674 Bacteria 2267
300 Ga0495657_0038134 3300046675 Bacteria 3309
301 Ga0495657_0180833 3300046675 Bacteria 1294
302 Ga0495623_0363048 3300046679 Bacteria 786
303 Ga0495658_0015472 3300046683 Bacteria 3914
304 Ga0495624_0012435 3300046690 Bacteria 5819
305 Ga0495624_0021132 3300046690 Bacteria 4321
306 Ga0495589_0140689 3300046794 Bacteria 1156
307 Ga0495600_0018389 3300046809 Bacteria 4451
308 Ga0495581_0012920 3300047315 Bacteria 4839
309 Ga0495604_0164994 3300047317 Bacteria 1562
310 Ga0495676_0037760 3300047321 Bacteria 4016
311 Ga0495680_0043261 3300047322 Bacteria 3567
312 Ga0495677_0161113 3300047445 Bacteria 866
313 Ga0495684_0126691 3300047471 Bacteria 1920
314 Ga0495593_0026574 3300047673 Bacteria 3194
315 Ga0495602_0081884 3300048088 Bacteria 2711
316 Ga0496100_0025192 3300048903 Bacteria 3636
317 Ga0496100_0176201 3300048903 Bacteria 1544
318 Ga0496100_0631394 3300048903 Bacteria 833
319 Ga0496101_0046463 3300048904 Bacteria 3114
320 Ga0496101_0048536 3300048904 Bacteria 3051
321 Ga0496101_0109057 3300048904 Bacteria 2082
322 Ga0496102_0035651 3300048905 Bacteria 4478
323 Ga0496102_0239662 3300048905 Bacteria 1710
324 Ga0496102_0807218 3300048905 Bacteria 860
325 Ga0496102_1057331 3300048905 Bacteria 732
326 Ga0496103_0591081 3300048906 Bacteria 707
327 Ga0496104_0015049 3300048907 Bacteria 7001
328 Ga0496104_0057749 3300048907 Bacteria 3672
329 Ga0496104_0221151 3300048907 Bacteria 1806
330 Ga0496105_0058670 3300048908 Bacteria 3176
331 Ga0496105_0252026 3300048908 Bacteria 1430
332 Ga0496106_0014119 3300048909 Bacteria 5901
333 Ga0496106_0104717 3300048909 Bacteria 2197
334 Ga0496107_0082768 3300048910 Bacteria 2340
335 Ga0496108_0014042 3300048911 Bacteria 6534
336 Ga0496108_0094595 3300048911 Bacteria 2543
337 Ga0496108_0132856 3300048911 Bacteria 2139
338 Ga0496108_0544913 3300048911 Bacteria 1012
339 Ga0496109_0018074 3300048912 Bacteria 6190
340 Ga0496109_0021874 3300048912 Bacteria 5660
341 Ga0496109_0071561 3300048912 Bacteria 3184
342 Ga0496109_0109441 3300048912 Bacteria 2568
343 Ga0496109_0396850 3300048912 Bacteria 1303
344 Ga0496109_0450437 3300048912 Bacteria 1216
345 Ga0496109_0747841 3300048912 Bacteria 915
346 Ga0496110_0013593 3300048913 Bacteria 6738
347 Ga0496110_0242954 3300048913 Bacteria 1638
348 Ga0496111_0006002 3300048914 Bacteria 7845
349 Ga0496111_0036475 3300048914 Bacteria 3515
350 Ga0496111_0098397 3300048914 Bacteria 2148
351 Ga0496111_0468867 3300048914 Bacteria 928
352 Ga0496111_0679267 3300048914 Bacteria 750
353 Ga0496112_0006471 3300048915 Bacteria 10288
354 Ga0496112_0013773 3300048915 Bacteria 7479
355 Ga0496112_0055056 3300048915 Bacteria 3910
356 Ga0496112_0104129 3300048915 Bacteria 2808
357 Ga0496112_0112313 3300048915 Bacteria 2695
358 Ga0496112_0139296 3300048915 Bacteria 2395
359 Ga0496112_0178814 3300048915 Bacteria 2085
360 Ga0496112_0215933 3300048915 Bacteria 1874
361 Ga0496113_0022321 3300048916 Bacteria 4474
362 Ga0496113_0034771 3300048916 Bacteria 3680
363 Ga0496113_0220484 3300048916 Bacteria 1511
364 Ga0496114_0019083 3300048917 Bacteria 5556
365 Ga0496114_0183288 3300048917 Bacteria 1829
366 Ga0496115_0175749 3300048918 Bacteria 1770
367 Ga0496115_0406469 3300048918 Bacteria 1104
368 Ga0496121_0001188 3300048924 Bacteria 45596
369 Ga0501036_0510739 3300049572 Bacteria 1000
370 Ga0501038_0233345 3300049574 Bacteria 1463
371 Ga0501039_0543114 3300049575 Unclassified 912
372 Ga0501040_0073803 3300049576 Bacteria 2358
373 Ga0501040_0336737 3300049576 Unclassified 1080
374 Ga0501042_0047037 3300049578 Bacteria 3076
375 Ga0501042_0159784 3300049578 Bacteria 1626
376 Ga0501042_0186915 3300049578 Bacteria 1494
377 Ga0501042_0288666 3300049578 Bacteria 1185
378 Ga0501046_0548021 3300049580 Bacteria 825
379 Ga0501048_0241394 3300049582 Bacteria 1282
380 Ga0501048_0363358 3300049582 Unclassified 1033
381 Ga0501048_0485677 3300049582 Bacteria 885
382 Ga0501068_0354223 3300049584 Bacteria 944
383 Ga0501071_0093597 3300049587 Bacteria 2210
384 Ga0501072_0071680 3300049588 Bacteria 2738
385 Ga0501072_0645540 3300049588 Bacteria 833
386 Ga0501072_0720580 3300049588 Unclassified 783
387 Ga0501072_0797564 3300049588 Bacteria 740
388 Ga0501072_0964128 3300049588 Bacteria 665
389 Ga0501074_0293132 3300049590 Bacteria 1156
390 Ga0501074_0477589 3300049590 Bacteria 884
391 Ga0501075_0068988 3300049591 Bacteria 2672
392 Ga0501075_0151586 3300049591 Unclassified 1767
393 Ga0501075_0155409 3300049591 Bacteria 1744
394 Ga0501075_1010042 3300049591 Unclassified 632
395 Ga0501076_0135124 3300049592 Bacteria 2002
396 Ga0501249_003419 3300049679 Unclassified 3187
397 Ga0501079_0019740 3300049741 Bacteria 5148
398 Ga0501079_0129031 3300049741 Bacteria 1967
399 Ga0501079_0414709 3300049741 Unclassified 1057
400 Ga0501081_0067164 3300049743 Bacteria 2495
401 Ga0501081_0106460 3300049743 Bacteria 1988
402 Ga0501081_0177406 3300049743 Bacteria 1540
403 Ga0501081_0191073 3300049743 Bacteria 1483
404 Ga0501045_0195432 3300049824 Bacteria 1508
405 Ga0501045_0531855 3300049824 Unclassified 872
406 nmdc:mga05p37_17_c1 3300050507 Bacteria 129520
407 nmdc:mga05p37_317031_c1 3300050507 Bacteria 1846
408 nmdc:mga05p37_7076_c1 3300050507 Bacteria 13227
409 nmdc:mga09592_452768_c1 3300050508 Unclassified 1107
410 nmdc:mga06r32_138985_c1 3300050510 Bacteria 2404
411 nmdc:mga06r32_277199_c1 3300050510 Bacteria 1664
412 nmdc:mga06r32_80323_c1 3300050510 Unclassified 3173
413 nmdc:mga0n895_120320_c1 3300050512 Bacteria 2647
414 nmdc:mga0n895_29112_c1 3300050512 Bacteria 5262
415 nmdc:mga0n895_7282_c1 3300050512 Bacteria 9480
416 nmdc:mga0rr50_31646_c1 3300050513 Bacteria 3761
417 nmdc:mga08x19_18968_c1 3300050514 Bacteria 4217
418 nmdc:mga0a205_150029_c1 3300050515 Bacteria 2231
419 nmdc:mga0a205_152083_c1 3300050515 Bacteria 2213
420 nmdc:mga0a205_18169_c1 3300050515 Bacteria 6606
421 Ga0495601_0007207 3300053077 Bacteria 6523
422 Ga0495601_0096453 3300053077 Bacteria 1907
423 Ga0495612_0025157 3300053078 Bacteria 2391
424 Ga0495655_0011419 3300053083 Bacteria 1784
425 Ga0495655_0021379 3300053083 Bacteria 1464
426 Ga0495595_0014887 3300053084 Bacteria 3307
427 Ga0495595_0044620 3300053084 Bacteria 2037
428 Ga0495619_0014153 3300053085 Bacteria 5037
429 Ga0495619_0025957 3300053085 Bacteria 3767
430 Ga0495619_0193525 3300053085 Bacteria 1408
431 Ga0500583_0034276 3300053092 Bacteria 2256
432 Ga0500654_058546 3300053099 Bacteria 1996
433 Ga0500595_033377 3300053119 Bacteria 1709
434 Ga0500568_0027635 3300053139 Bacteria 2371
435 Ga0500616_0208466 3300053153 Bacteria 861
436 Ga0501084_0238120 3300054114 Bacteria 1536
437 Ga0501084_0332891 3300054114 Unclassified 1282
438 Ga0501084_0365375 3300054114 Bacteria 1219
439 Ga0501084_0584479 3300054114 Bacteria 944
440 Ga0501082_0165117 3300060353 Bacteria 1924
441 Ga0501082_0333682 3300060353 Unclassified 1321
442 Ga0501082_0620261 3300060353 Bacteria 946
443 Ga0530510_0028668 3300061734 Bacteria 3992
444 Ga0530510_0475144 3300061734 Unclassified 946
445 2508678498 2508501039 Bacteria 9978592
446 2517760137 2517572101 Bacteria 6884336
447 2586060990 2585427649 Bacteria 9053857
448 2689958547 2687453737 Bacteria 11203906
449 2809589981 2808606522 Bacteria 9488490
450 2891330022 2891326441 Bacteria 6439512
451 8002786490 8002784119 Bacteria 9788632
452 8003860559 8003856774 Bacteria 7675274
453 Ga0065715_10030109
454 Ga0070670_100086231
455 Ga0070670_100289469
456 Ga0068869_100526491
457 Ga0070666_10002348
458 Ga0070680_100517116
459 Ga0070682_100135964
460 Ga0068868_100243204
461 Ga0070660_100041866
462 Ga0070660_100744871
463 Ga0070691_10105365
464 Ga0070668_100021850
465 Ga0070675_100197994
466 Ga0070675_100359164
467 Ga0070671_100318141
468 Ga0070674_100645218
469 Ga0070673_100462399
470 Ga0070659_100485560
471 Ga0070667_100002656
472 Ga0070703_10070893
473 Ga0070714_100004495
474 Ga0070714_100361450
475 Ga0070713_100062880
476 Ga0070713_100346481
477 Ga0070713_100467015
478 Ga0070710_10039635
479 Ga0070701_10319440
480 Ga0070701_10387241
481 Ga0070705_100030970
482 Ga0070700_100095349
483 Ga0070700_100116083
484 Ga0070700_100307719
485 Ga0070708_100428308
486 Ga0070678_100214454
487 Ga0070662_100111298
488 Ga0070662_100124126
489 Ga0070681_10096073
490 Ga0068867_100233569
491 Ga0070685_10645144
492 Ga0070707_100027141
493 Ga0070699_100414905
494 Ga0070679_100369673
495 Ga0070697_100054941
496 Ga0068853_100194239
497 Ga0070672_100390826
498 Ga0070686_100455980
499 Ga0070695_100056612
500 Ga0070696_100162710
501 Ga0070696_100343111
502 Ga0070665_100006979
503 Ga0070665_100388407
504 Ga0070704_100148484
505 Ga0070704_100321642
506 Ga0068855_100300917
507 Ga0070664_100420451
508 Ga0070664_101346639
509 Ga0068857_100024809
510 Ga0068854_100262314
511 Ga0068856_100011679
512 Ga0068856_100482495
513 Ga0070702_100037394
514 Ga0068852_100170971
515 Ga0068852_100193709
516 Ga0068852_100510783
517 Ga0068859_100000135
518 Ga0068864_100068494
519 Ga0068864_100071077
520 Ga0068864_100259104
521 Ga0068866_10096445
522 Ga0068861_100049588
523 Ga0068870_10015757
524 Ga0068870_10083418
525 Ga0068870_10091690
526 Ga0068858_100022250
527 Ga0068858_100312794
528 Ga0068858_100339365
529 Ga0068860_100871546
530 Ga0068862_100000116
531 Ga0068862_100004179
532 Ga0068862_100146460
533 Ga0068862_101452925
534 Ga0081455_10038944
535 Ga0081538_10010874
536 Ga0081538_10089114
537 Ga0070717_10017919
538 Ga0070717_10071805
539 Ga0070712_100309932
540 Ga0070712_100981449
541 Ga0075428_100001325
542 Ga0075428_100015349
543 Ga0075428_100263318
544 Ga0075431_100118234
545 Ga0075431_100258683
546 Ga0075433_10048988
547 Ga0075433_10328605
548 Ga0075434_100002204
549 Ga0075434_100010674
550 Ga0075434_100659421
551 Ga0075429_100011689
552 Ga0075429_100210673
553 Ga0075436_100037230
554 Ga0075436_100310071
555 Ga0097620_100000135
556 Ga0075435_100000942
557 Ga0105240_10503163
558 Ga0111539_10155436
559 Ga0111539_10295884
560 Ga0111539_10866718
561 Ga0105245_10038999
562 Ga0105245_11324534
563 Ga0105247_10048810
564 Ga0114129_10000343
565 Ga0114129_10006217
566 Ga0114129_10063735
567 Ga0114129_11839728
568 Ga0105243_10133234
569 Ga0105243_10497339
570 Ga0105243_10531355
571 Ga0105241_10126517
572 Ga0105242_10269018
573 Ga0105248_10178836
574 Ga0105237_10185309
575 Ga0105237_11245051
576 Ga0105238_10012703
577 Ga0105249_10001141
578 Ga0105249_10233191
579 Ga0105249_10380464
580 Ga0105249_10891145
581 Ga0105239_10280327
582 Ga0105239_10418761
583 Ga0105246_10278324
584 Ga0105246_10362573
585 Ga0105246_11036723
586 Ga0157369_10343914
587 Ga0157369_10489394
588 Ga0157374_10473298
589 Ga0163162_10783721
590 Ga0157375_10268170
591 Ga0157375_10322276
592 Ga0163163_10008521
593 Ga0163163_10301549
594 Ga0157377_10202868
595 Ga0157379_10009709
596 Ga0157379_10010125
597 Ga0157376_10020969
598 Ga0157376_10576691
599 Ga0207653_10049986
600 Ga0207692_10088096
601 Ga0207642_10099193
602 Ga0207710_10057154
603 Ga0207688_10001758
604 Ga0207680_10004564
605 Ga0207680_10318390
606 Ga0207685_10246729
607 Ga0207643_10023322
608 Ga0207643_10051781
609 Ga0207705_10152694
610 Ga0207654_10046095
611 Ga0207707_10026059
612 Ga0207707_10309837
613 Ga0207695_10559648
614 Ga0207671_10139793
615 Ga0207663_10122829
616 Ga0207660_10330135
617 Ga0207657_10002052
618 Ga0207657_10037341
619 Ga0207652_10151512
620 Ga0207646_10082653
621 Ga0207694_10101035
622 Ga0207650_10243908
623 Ga0207650_10330876
624 Ga0207659_10137541
625 Ga0207687_10003997
626 Ga0207687_10061967
627 Ga0207700_10105429
628 Ga0207664_10004318
629 Ga0207664_10135708
630 Ga0207690_10114949
631 Ga0207706_10049432
632 Ga0207709_10151696
633 Ga0207709_10181229
634 Ga0207670_10522500
635 Ga0207704_10064614
636 Ga0207704_10123780
637 Ga0207665_10025758
638 Ga0207691_10258329
639 Ga0207689_10304954
640 Ga0207661_10130917
641 Ga0207679_11253528
642 Ga0207667_10072913
643 Ga0207667_10086518
644 Ga0207651_10174191
645 Ga0207712_10092101
646 Ga0207712_10100507
647 Ga0207668_10015246
648 Ga0207640_10185860
649 Ga0207658_10002131
650 Ga0207677_10077991
651 Ga0207703_10379553
652 Ga0207639_10104373
653 Ga0207639_11142877
654 Ga0207708_10023581
655 Ga0207708_10100182
656 Ga0207708_10178131
657 Ga0207702_10003309
658 Ga0207702_10259952
659 Ga0207648_10013540
660 Ga0207648_10081047
661 Ga0207676_10483456
662 Ga0207674_10022976
663 Ga0207675_100347124
664 Ga0207683_10093536
665 Ga0207683_10125920
666 Ga0207683_11301972
667 Ga0207698_10217684
668 Ga0268266_10000097
669 Ga0268266_10176969
670 Ga0268266_10219083
671 Ga0268266_10576857
672 Ga0268265_10000126
673 Ga0268265_10426543
674 Ga0268265_10933788
675 Ga0268264_10236549
676 Ga0268264_10441098
677 Ga0268264_10925946
678 Ga0316576_10000700
679 Ga0316576_10119997
680 Ga0316578_10013612
681 Ga0307518_10001041
682 Ga0307410_10260693
683 Ga0307410_10529263
684 Ga0307406_10070344
685 Ga0307412_10402236
686 Ga0307409_100268763
687 Ga0307409_100289152
688 Ga0307409_100978542
689 Ga0307416_100005249
690 Ga0307416_100019270
691 Ga0307416_100954141
692 Ga0307416_101299575
693 Ga0307414_10542600
694 Ga0307415_100000605
695 Ga0307415_100003723
696 Ga0373923_0042808
697 Ga0373936_0118064
698 Ga0373945_0026182
699 Ga0373943_0073909
700 Ga0373943_0090980
701 Ga0373946_0013351
702 Ga0316574_0045421
703 Ga0373924_0010957
704 Ga0373935_0600116
705 Ga0373935_0734561
706 Ga0373947_0017455
707 Ga0373947_0325343
708 Ga0373947_0364203
709 Ga0373937_0045089
710 Ga0316584_0032437
711 Ga0373925_0186570
712 Ga0395900_0337130
713 Ga0395900_0373572
714 Ga0395898_1149854
715 Ga0395901_0145172
716 Ga0395901_0278562
717 Ga0439461_0092684
718 Ga0451837_0569775
719 Ga0439434_0059086
720 Ga0466966_0405562
721 Ga0466960_0439458
722 Ga0466967_0157680
723 Ga0495603_0036167
724 Ga0495603_0041532
725 Ga0495629_0085553
726 Ga0495629_0203995
727 Ga0495629_0551474
728 Ga0495653_0134036
729 Ga0495582_0006636
730 Ga0495639_0060027
731 Ga0495662_0033814
732 Ga0495662_0056020
733 Ga0495664_0011541
734 Ga0495584_0024217
735 Ga0495585_0288315
736 Ga0495594_0035393
737 Ga0495608_0098419
738 Ga0495618_0144690
739 Ga0495618_0227676
740 Ga0495644_0289339
741 Ga0495666_0021753
742 Ga0495665_0017895
743 Ga0495587_0026535
744 Ga0495609_0313990
745 Ga0495645_0339996
746 Ga0495667_0052945
747 Ga0495656_0191134
748 Ga0495634_0151166
749 Ga0495635_0020755
750 Ga0495661_0279118
751 Ga0495588_0044781
752 Ga0495657_0038134
753 Ga0495657_0180833
754 Ga0495623_0363048
755 Ga0495658_0015472
756 Ga0495624_0012435
757 Ga0495624_0021132
758 Ga0495589_0140689
759 Ga0495600_0018389
760 Ga0495581_0012920
761 Ga0495604_0164994
762 Ga0495676_0037760
763 Ga0495680_0043261
764 Ga0495677_0161113
765 Ga0495684_0126691
766 Ga0495593_0026574
767 Ga0495602_0081884
768 Ga0496100_0025192
769 Ga0496100_0176201
770 Ga0496100_0631394
771 Ga0496101_0046463
772 Ga0496101_0048536
773 Ga0496101_0109057
774 Ga0496102_0035651
775 Ga0496102_0239662
776 Ga0496102_0807218
777 Ga0496102_1057331
778 Ga0496103_0591081
779 Ga0496104_0015049
780 Ga0496104_0057749
781 Ga0496104_0221151
782 Ga0496105_0058670
783 Ga0496105_0252026
784 Ga0496106_0014119
785 Ga0496106_0104717
786 Ga0496107_0082768
787 Ga0496108_0014042
788 Ga0496108_0094595
789 Ga0496108_0132856
790 Ga0496108_0544913
791 Ga0496109_0018074
792 Ga0496109_0021874
793 Ga0496109_0071561
794 Ga0496109_0109441
795 Ga0496109_0396850
796 Ga0496109_0450437
797 Ga0496109_0747841
798 Ga0496110_0013593
799 Ga0496110_0242954
800 Ga0496111_0006002
801 Ga0496111_0036475
802 Ga0496111_0098397
803 Ga0496111_0468867
804 Ga0496111_0679267
805 Ga0496112_0006471
806 Ga0496112_0013773
807 Ga0496112_0055056
808 Ga0496112_0104129
809 Ga0496112_0112313
810 Ga0496112_0139296
811 Ga0496112_0178814
812 Ga0496112_0215933
813 Ga0496113_0022321
814 Ga0496113_0034771
815 Ga0496113_0220484
816 Ga0496114_0019083
817 Ga0496114_0183288
818 Ga0496115_0175749
819 Ga0496115_0406469
820 Ga0496121_0001188
821 Ga0501036_0510739
822 Ga0501038_0233345
823 Ga0501039_0543114
824 Ga0501040_0073803
825 Ga0501040_0336737
826 Ga0501042_0047037
827 Ga0501042_0159784
828 Ga0501042_0186915
829 Ga0501042_0288666
830 Ga0501046_0548021
831 Ga0501048_0241394
832 Ga0501048_0363358
833 Ga0501048_0485677
834 Ga0501068_0354223
835 Ga0501071_0093597
836 Ga0501072_0071680
837 Ga0501072_0645540
838 Ga0501072_0720580
839 Ga0501072_0797564
840 Ga0501072_0964128
841 Ga0501074_0293132
842 Ga0501074_0477589
843 Ga0501075_0068988
844 Ga0501075_0151586
845 Ga0501075_0155409
846 Ga0501075_1010042
847 Ga0501076_0135124
848 Ga0501249_003419
849 Ga0501079_0019740
850 Ga0501079_0129031
851 Ga0501079_0414709
852 Ga0501081_0067164
853 Ga0501081_0106460
854 Ga0501081_0177406
855 Ga0501081_0191073
856 Ga0501045_0195432
857 Ga0501045_0531855
858 nmdc:mga05p37_17_c1
859 nmdc:mga05p37_317031_c1
860 nmdc:mga05p37_7076_c1
861 nmdc:mga09592_452768_c1
862 nmdc:mga06r32_138985_c1
863 nmdc:mga06r32_277199_c1
864 nmdc:mga06r32_80323_c1
865 nmdc:mga0n895_120320_c1
866 nmdc:mga0n895_29112_c1
867 nmdc:mga0n895_7282_c1
868 nmdc:mga0rr50_31646_c1
869 nmdc:mga08x19_18968_c1
870 nmdc:mga0a205_150029_c1
871 nmdc:mga0a205_152083_c1
872 nmdc:mga0a205_18169_c1
873 Ga0495601_0007207
874 Ga0495601_0096453
875 Ga0495612_0025157
876 Ga0495655_0011419
877 Ga0495655_0021379
878 Ga0495595_0014887
879 Ga0495595_0044620
880 Ga0495619_0014153
881 Ga0495619_0025957
882 Ga0495619_0193525
883 Ga0500583_0034276
884 Ga0500654_058546
885 Ga0500595_033377
886 Ga0500568_0027635
887 Ga0500616_0208466
888 Ga0501084_0238120
889 Ga0501084_0332891
890 Ga0501084_0365375
891 Ga0501084_0584479
892 Ga0501082_0165117
893 Ga0501082_0333682
894 Ga0501082_0620261
895 Ga0530510_0028668
896 Ga0530510_0475144
897 2508678498
898 2517760137
899 2586060990
900 2689958547
901 2809589981
902 2891330022
903 8002786490
904 8003860559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

54

102

0.98

PF01022

HTH_5

Bacterial regulatory protein, arsR family

56

100

0.96

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

61

100

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f72-assembly3.cif.gz_E crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9373 48 99
3f72-assembly2.cif.gz_D crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.9304 48 99
3f72-assembly3.cif.gz_F crystal structure of the staphylococcus aureus pi258 cadc metal binding site 2 mutant 0.8942 47 101
1u2w-assembly1.cif.gz_A crystal structure of the staphylococcus aureus pi258 cadc 0.8904 48 117
1z6r-assembly1.cif.gz_A crystal structure of mlc from escherichia coli 0.8745 57 103
ID Description Score Start End Superfamily
1ulyA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9308 41 123 1.10.10.10
3f72D00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9304 48 99 1.10.10.10
3bp8A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9286 57 101 1.10.10.10
3tgnA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9245 55 99 1.10.10.10
4ijaB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8956 57 116 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6B1KAE5-F1-model_v4 deleted 0.9437 41 131
AF-A0A662JEJ3-F1-model_v4 HTH arsR-type domain-containing protein 0.9354 48 119 GO:0003700
AF-A0A5E4IQZ5-F1-model_v4 EF-hand domain-containing protein 0.9353 41 123 GO:0003700
GO:0005509
AF-A0A7T5R925-F1-model_v4 S-layer protein 0.931 41 123 GO:0005509
AF-A0A842XUQ2-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9298 41 121 GO:0003700

Map