F446825

General Info

Members Datasets Scaffolds Average Seq Length
451 235 902 546

Family's Representative Sequence

Representative Sequence 3300039062|Ga0400483_240381|Ga0400483_240381_5154_7004
Length 616
Sequence LRFIRYPLWFRKLTLIVEIRTNIGSIHFATGPAAETTLGRAEQPVSSVIVYWLTTTGRLGYLAAHKGSAMKIALVQFNPVIGDFKHQCRRIVALAEKAKTRGCDLAVFPEMAVCGYPPKDLLDRTSFVEANRRTLDYLVNTVGGIGILLGYVAENPDPSGKPLLNGAVLFEDGHLLHQVHKQLLPTYDVFDERRHFEPGRPDLPYLYKGHRLGVTICEDVWNDKDVFANRLYDVDPIDYLAKNGMDVLINIAASPFHIGKVDFRDHMLSTIAAKHQLPVLFVNQVGGNDQLLFDGASTVFSADGRVLARAEDFVEDLIVFDTQRMHGDMHHLTENRHDSVFKALVMGTRDYVTKCGFKTAVIGLSGGIDSALTACIAAEALGAENVSTVFMPSAYTSQENFEDTRQLARNLGLGYTIIPIDDIFGQFLHLLVPQADGADPGLTEQNIQARIRGTLLMGISNRDGCLVLSTGNKSELAVGYCTLYGDMNGGLAVISDVPKTMVYHLCRRINRKKEVIPQRIIDKPPSAELKPDQTDQDDLPPYEIIDPILEGYVEKSQSVHTLVDAGFDPTVVKEVIRRVDQNEYKRHQAAPGLKVTPKAFGEGRRYPLAKRFRPIS

Samples

Sample ID Description Type Environment
1 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
128 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
132 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
133 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
134 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
155 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
156 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
157 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
158 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
159 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
223 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
224 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
228 2831426010 Nostoc sp. 106C Isolate Unclassified
229 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
230 2849660919 Nostoc sp. T09 Isolate Unclassified
231 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
232 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
233 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
234 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
235 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 0
Isolates 2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 0.89
Rhizosphere 92.24
Stem 0
Stem Tuber 0
Unclassified 2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400483_240381 3300039062 Bacteria 35578
2 Ga0065712_10006010 3300005290 Bacteria 3641
3 Ga0070676_10010608 3300005328 Bacteria 4999
4 Ga0070683_100000041 3300005329 Bacteria 116748
5 Ga0070683_100003485 3300005329 Bacteria 12789
6 Ga0070683_100064949 3300005329 Bacteria 3398
7 Ga0070690_100002754 3300005330 Bacteria 9491
8 Ga0070690_100014702 3300005330 Bacteria 4648
9 Ga0070670_100050461 3300005331 Bacteria 3575
10 Ga0070680_100011166 3300005336 Bacteria 6948
11 Ga0070660_100027507 3300005339 Bacteria 4245
12 Ga0070660_100066140 3300005339 Bacteria 2813
13 Ga0070689_100081662 3300005340 Bacteria 2538
14 Ga0070661_100046557 3300005344 Bacteria 3173
15 Ga0070668_100038865 3300005347 Bacteria 3639
16 Ga0070669_100003153 3300005353 Bacteria 11853
17 Ga0070675_100000453 3300005354 Bacteria 28021
18 Ga0070671_100012531 3300005355 Bacteria 6827
19 Ga0070674_100024593 3300005356 Bacteria 3911
20 Ga0070688_100003250 3300005365 Bacteria 8327
21 Ga0070667_100004658 3300005367 Bacteria 11508
22 Ga0070667_100032926 3300005367 Bacteria 4326
23 Ga0070714_100037396 3300005435 Unclassified 4079
24 Ga0070713_100015825 3300005436 Bacteria 5653
25 Ga0070713_100035749 3300005436 Bacteria 4002
26 Ga0070713_100042071 3300005436 Bacteria 3726
27 Ga0070713_100060280 3300005436 Bacteria 3172
28 Ga0070711_100010558 3300005439 Bacteria 5718
29 Ga0070705_100003696 3300005440 Bacteria 7492
30 Ga0070700_100099182 3300005441 Bacteria 1916
31 Ga0070708_100002693 3300005445 Bacteria 13771
32 Ga0070678_100119484 3300005456 Bacteria 2076
33 Ga0070681_10001296 3300005458 Bacteria 21812
34 Ga0068867_100033147 3300005459 Bacteria 3738
35 Ga0070706_100003186 3300005467 Bacteria 16199
36 Ga0070706_100031277 3300005467 Bacteria 4908
37 Ga0070707_100000129 3300005468 Bacteria 70911
38 Ga0070707_100000947 3300005468 Bacteria 28788
39 Ga0070707_100005109 3300005468 Bacteria 12306
40 Ga0070707_100042689 3300005468 Unclassified 4342
41 Ga0070698_100055851 3300005471 Bacteria 4002
42 Ga0070698_100064735 3300005471 Bacteria 3682
43 Ga0070698_100092790 3300005471 Bacteria 3000
44 Ga0070698_100105004 3300005471 Bacteria 2795
45 Ga0070699_100004292 3300005518 Bacteria 12598
46 Ga0070699_100154284 3300005518 Bacteria 2032
47 Ga0070699_100181526 3300005518 Unclassified 1868
48 Ga0070679_100004541 3300005530 Bacteria 12816
49 Ga0070684_100000029 3300005535 Bacteria 116370
50 Ga0070684_100090846 3300005535 Bacteria 2716
51 Ga0070697_100000215 3300005536 Bacteria 47439
52 Ga0068853_100017153 3300005539 Bacteria 5975
53 Ga0070672_100138898 3300005543 Bacteria 2003
54 Ga0070686_100001994 3300005544 Bacteria 11324
55 Ga0070695_100006421 3300005545 Bacteria 6952
56 Ga0070696_100044569 3300005546 Bacteria 3071
57 Ga0070665_100232555 3300005548 Bacteria 1843
58 Ga0070704_100027336 3300005549 Bacteria 3782
59 Ga0068855_100009306 3300005563 Bacteria 11862
60 Ga0068855_100081652 3300005563 Bacteria 3747
61 Ga0068857_100000258 3300005577 Bacteria 35751
62 Ga0068854_100001865 3300005578 Bacteria 12844
63 Ga0068856_100026067 3300005614 Bacteria 5700
64 Ga0070702_100026023 3300005615 Bacteria 3140
65 Ga0068852_100020317 3300005616 Bacteria 5280
66 Ga0068859_100049794 3300005617 Bacteria 4208
67 Ga0068866_10017338 3300005718 Bacteria 3238
68 Ga0068861_100016441 3300005719 Bacteria 5236
69 Ga0068858_100001969 3300005842 Bacteria 20982
70 Ga0068858_100034578 3300005842 Bacteria 4688
71 Ga0068858_100068726 3300005842 Bacteria 3283
72 Ga0068858_100144165 3300005842 Bacteria 2237
73 Ga0068860_100079364 3300005843 Bacteria 3121
74 Ga0068862_100082995 3300005844 Bacteria 2782
75 Ga0081539_10002859 3300005985 Bacteria 22960
76 Ga0070717_10000622 3300006028 Bacteria 22798
77 Ga0070717_10041065 3300006028 Bacteria 3770
78 Ga0070712_100073980 3300006175 Bacteria 2446
79 Ga0097621_100012115 3300006237 Bacteria 6380
80 Ga0097621_100020407 3300006237 Bacteria 5105
81 Ga0097621_100057030 3300006237 Bacteria 3192
82 Ga0097621_100093101 3300006237 Bacteria 2525
83 Ga0068871_100001883 3300006358 Bacteria 14191
84 Ga0075433_10000310 3300006852 Bacteria 29590
85 Ga0075433_10060373 3300006852 Bacteria 3319
86 Ga0075434_100000326 3300006871 Bacteria 34180
87 Ga0075434_100000966 3300006871 Bacteria 23172
88 Ga0075434_100006572 3300006871 Bacteria 10663
89 Ga0075434_100072350 3300006871 Bacteria 3440
90 Ga0075436_100002847 3300006914 Bacteria 11849
91 Ga0075436_100003971 3300006914 Bacteria 10138
92 Ga0075436_100029174 3300006914 Bacteria 3794
93 Ga0097620_100049797 3300006931 Bacteria 4208
94 Ga0075435_100000020 3300007076 Bacteria 91240
95 Ga0075435_100001632 3300007076 Bacteria 14522
96 Ga0075435_100006343 3300007076 Bacteria 8356
97 Ga0075435_100025399 3300007076 Bacteria 4612
98 Ga0075435_100089695 3300007076 Bacteria 2535
99 Ga0105240_10004037 3300009093 Bacteria 22586
100 Ga0105240_10010414 3300009093 Bacteria 13068
101 Ga0105240_10013598 3300009093 Bacteria 11167
102 Ga0105240_10016014 3300009093 Bacteria 10165
103 Ga0105240_10018794 3300009093 Bacteria 9259
104 Ga0105240_10051569 3300009093 Bacteria 5175
105 Ga0105240_10107795 3300009093 Bacteria 3377
106 Ga0105245_10000754 3300009098 Bacteria 29261
107 Ga0105245_10001068 3300009098 Bacteria 24840
108 Ga0105245_10016565 3300009098 Bacteria 6431
109 Ga0114129_10012769 3300009147 Bacteria 11955
110 Ga0114129_10013906 3300009147 Bacteria 11466
111 Ga0114129_10020263 3300009147 Bacteria 9463
112 Ga0114129_10023072 3300009147 Bacteria 8828
113 Ga0114129_10023484 3300009147 Bacteria 8742
114 Ga0114129_10025400 3300009147 Bacteria 8394
115 Ga0114129_10025859 3300009147 Bacteria 8313
116 Ga0114129_10156529 3300009147 Bacteria 3115
117 Ga0105243_10034082 3300009148 Bacteria 3939
118 Ga0105243_10145511 3300009148 Bacteria 2027
119 Ga0105241_10004476 3300009174 Bacteria 10334
120 Ga0105242_10001588 3300009176 Bacteria 17868
121 Ga0105242_10109190 3300009176 Bacteria 2355
122 Ga0105248_10003926 3300009177 Bacteria 16437
123 Ga0105248_10007502 3300009177 Bacteria 11965
124 Ga0105248_10035321 3300009177 Bacteria 5591
125 Ga0105248_10036629 3300009177 Bacteria 5487
126 Ga0105248_10064650 3300009177 Bacteria 4107
127 Ga0105237_10005980 3300009545 Bacteria 13633
128 Ga0105237_10010302 3300009545 Bacteria 9959
129 Ga0105237_10098974 3300009545 Bacteria 2908
130 Ga0105237_10189082 3300009545 Bacteria 2059
131 Ga0105238_10000501 3300009551 Bacteria 41211
132 Ga0105238_10007557 3300009551 Bacteria 10888
133 Ga0105238_10014073 3300009551 Bacteria 8088
134 Ga0105238_10015567 3300009551 Bacteria 7700
135 Ga0105238_10016962 3300009551 Bacteria 7390
136 Ga0105238_10019109 3300009551 Bacteria 6981
137 Ga0105238_10024586 3300009551 Bacteria 6140
138 Ga0105249_10003665 3300009553 Bacteria 13245
139 Ga0105239_10002493 3300010375 Bacteria 23445
140 Ga0105239_10020834 3300010375 Bacteria 7233
141 Ga0105239_10060157 3300010375 Bacteria 4169
142 Ga0105246_10008582 3300011119 Bacteria 6282
143 Ga0105246_10009440 3300011119 Bacteria 6011
144 Ga0157370_10007929 3300013104 Bacteria 11499
145 Ga0157370_10009793 3300013104 Bacteria 10163
146 Ga0157370_10111571 3300013104 Bacteria 2556
147 Ga0157369_10005007 3300013105 Bacteria 15517
148 Ga0157369_10013273 3300013105 Bacteria 9322
149 Ga0157369_10020027 3300013105 Bacteria 7483
150 Ga0157369_10023126 3300013105 Bacteria 6925
151 Ga0157369_10098931 3300013105 Bacteria 3110
152 Ga0157374_10043802 3300013296 Bacteria 4135
153 Ga0157374_10074965 3300013296 Bacteria 3197
154 Ga0157374_10126985 3300013296 Bacteria 2465
155 Ga0157372_10001007 3300013307 Bacteria 30798
156 Ga0157375_10147477 3300013308 Bacteria 2485
157 Ga0163163_10004379 3300014325 Bacteria 12032
158 Ga0163163_10009916 3300014325 Bacteria 8540
159 Ga0163163_10035080 3300014325 Bacteria 4864
160 Ga0163163_10078769 3300014325 Bacteria 3293
161 Ga0157380_10014366 3300014326 Bacteria 5792
162 Ga0157377_10032374 3300014745 Bacteria 2847
163 Ga0157379_10019180 3300014968 Bacteria 6039
164 Ga0157376_10042491 3300014969 Bacteria 3725
165 Ga0157376_10132899 3300014969 Bacteria 2223
166 Ga0213875_10027126 3300021388 Bacteria 2725
167 Ga0207645_10003184 3300025907 Bacteria 12557
168 Ga0207684_10026953 3300025910 Bacteria 4900
169 Ga0207684_10051837 3300025910 Bacteria 3481
170 Ga0207707_10000919 3300025912 Bacteria 28619
171 Ga0207707_10021120 3300025912 Bacteria 5689
172 Ga0207695_10001615 3300025913 Bacteria 36561
173 Ga0207695_10007350 3300025913 Bacteria 14059
174 Ga0207695_10011965 3300025913 Bacteria 10445
175 Ga0207695_10047847 3300025913 Bacteria 4521
176 Ga0207695_10081330 3300025913 Bacteria 3278
177 Ga0207671_10005560 3300025914 Bacteria 11577
178 Ga0207671_10066673 3300025914 Bacteria 2680
179 Ga0207663_10028581 3300025916 Bacteria 3265
180 Ga0207663_10038601 3300025916 Bacteria 2888
181 Ga0207660_10007720 3300025917 Bacteria 6963
182 Ga0207660_10151673 3300025917 Bacteria 1781
183 Ga0207657_10021904 3300025919 Bacteria 6001
184 Ga0207657_10053005 3300025919 Bacteria 3517
185 Ga0207652_10003735 3300025921 Bacteria 12493
186 Ga0207646_10000012 3300025922 Bacteria 367049
187 Ga0207646_10000046 3300025922 Bacteria 177239
188 Ga0207646_10078582 3300025922 Unclassified 2949
189 Ga0207681_10053578 3300025923 Bacteria 2739
190 Ga0207694_10001532 3300025924 Bacteria 19669
191 Ga0207694_10006159 3300025924 Bacteria 9166
192 Ga0207694_10106192 3300025924 Bacteria 2230
193 Ga0207659_10000106 3300025926 Bacteria 49900
194 Ga0207687_10000849 3300025927 Bacteria 20665
195 Ga0207687_10003798 3300025927 Bacteria 10152
196 Ga0207687_10006990 3300025927 Bacteria 7435
197 Ga0207700_10047690 3300025928 Bacteria 3177
198 Ga0207664_10061534 3300025929 Bacteria 2995
199 Ga0207644_10034834 3300025931 Bacteria 3524
200 Ga0207686_10046700 3300025934 Bacteria 2673
201 Ga0207709_10040555 3300025935 Bacteria 2788
202 Ga0207670_10099535 3300025936 Bacteria 2074
203 Ga0207669_10014742 3300025937 Bacteria 3924
204 Ga0207704_10001950 3300025938 Bacteria 9242
205 Ga0207665_10015170 3300025939 Bacteria 5061
206 Ga0207711_10003941 3300025941 Bacteria 12768
207 Ga0207711_10035967 3300025941 Bacteria 4200
208 Ga0207711_10074096 3300025941 Bacteria 2960
209 Ga0207711_10079558 3300025941 Bacteria 2862
210 Ga0207661_10000040 3300025944 Bacteria 126775
211 Ga0207661_10020775 3300025944 Bacteria 4913
212 Ga0207661_10051405 3300025944 Unclassified 3288
213 Ga0207661_10111089 3300025944 Bacteria 2318
214 Ga0207667_10003475 3300025949 Bacteria 19447
215 Ga0207667_10022451 3300025949 Bacteria 6970
216 Ga0207667_10032728 3300025949 Bacteria 5597
217 Ga0207640_10021448 3300025981 Bacteria 3850
218 Ga0207658_10028715 3300025986 Bacteria 3921
219 Ga0207703_10049222 3300026035 Bacteria 3406
220 Ga0207703_10084451 3300026035 Bacteria 2655
221 Ga0207708_10011209 3300026075 Bacteria 6672
222 Ga0207702_10029858 3300026078 Bacteria 4539
223 Ga0207702_10119295 3300026078 Bacteria 2358
224 Ga0207641_10000875 3300026088 Bacteria 31527
225 Ga0207648_10012617 3300026089 Bacteria 7904
226 Ga0207648_10039599 3300026089 Bacteria 4144
227 Ga0207648_10073615 3300026089 Bacteria 2977
228 Ga0207674_10000035 3300026116 Bacteria 136262
229 Ga0207674_10001346 3300026116 Bacteria 31774
230 Ga0207675_100015864 3300026118 Bacteria 7026
231 Ga0207675_100026946 3300026118 Bacteria 5350
232 Ga0207698_10004118 3300026142 Bacteria 8833
233 Ga0207698_10031916 3300026142 Bacteria 3809
234 Ga0207428_10004967 3300027907 Bacteria 12518
235 Ga0268266_10010036 3300028379 Bacteria 8308
236 Ga0268264_10041437 3300028381 Bacteria 3809
237 Ga0268264_10059144 3300028381 Bacteria 3210
238 Ga0265338_10002394 3300028800 Bacteria 28230
239 Ga0265338_10016701 3300028800 Bacteria 7955
240 Ga0265325_10046997 3300031241 Bacteria 2236
241 Ga0265329_10008667 3300031242 Bacteria 3841
242 Ga0265316_10008312 3300031344 Bacteria 9635
243 Ga0265316_10011238 3300031344 Bacteria 8095
244 Ga0265316_10024360 3300031344 Bacteria 5073
245 Ga0316579_10019636 3300031691 Bacteria 2988
246 Ga0265314_10001766 3300031711 Bacteria 23337
247 Ga0265314_10002451 3300031711 Bacteria 18978
248 Ga0265342_10067695 3300031712 Bacteria 2089
249 Ga0316576_10068544 3300031727 Bacteria 2614
250 Ga0316578_10004118 3300031728 Bacteria 6807
251 Ga0316577_10000636 3300031733 Bacteria 14588
252 Ga0316577_10041306 3300031733 Bacteria 2580
253 Ga0316577_10045363 3300031733 Bacteria 2457
254 Ga0316577_10060556 3300031733 Bacteria 2113
255 Ga0373930_0001110 3300034816 Bacteria 3908
256 Ga0373948_0001264 3300034817 Bacteria 3456
257 Ga0373929_0000371 3300035085 Bacteria 8435
258 Ga0373934_0001281 3300035086 Bacteria 9142
259 Ga0373949_0000394 3300035090 Bacteria 15275
260 Ga0373951_0004663 3300035091 Bacteria 3243
261 Ga0373952_0000554 3300035092 Bacteria 6577
262 Ga0373932_0005619 3300035112 Bacteria 2949
263 Ga0373941_0001988 3300035115 Bacteria 4425
264 Ga0373953_0008813 3300035117 Bacteria 3441
265 Ga0373954_0003669 3300035118 Bacteria 6539
266 Ga0373943_0040884 3300035170 Bacteria 2240
267 Ga0373955_0036930 3300035172 Bacteria 2596
268 Ga0373955_0057901 3300035172 Unclassified 2130
269 Ga0373942_0000347 3300035207 Bacteria 12673
270 Ga0373961_0001167 3300035241 Bacteria 8204
271 Ga0373927_0047855 3300035695 Bacteria 2766
272 Ga0373937_0012516 3300036401 Bacteria 7466
273 Ga0373937_0111782 3300036401 Bacteria 2541
274 Ga0316584_0000596 3300036712 Bacteria 19602
275 Ga0316584_0049638 3300036712 Bacteria 3137
276 Ga0436364_0231727 3300037853 Bacteria 7968
277 Ga0436364_0304215 3300037853 Bacteria 4299
278 Ga0400490_06663 3300038726 Bacteria 42094
279 Ga0400490_07766 3300038726 Bacteria 2956
280 Ga0400490_08242 3300038726 Bacteria 2647
281 Ga0400485_07095 3300038735 Bacteria 2499
282 Ga0400488_01912 3300038741 Bacteria 6324
283 Ga0400488_38307 3300038741 Bacteria 10070
284 Ga0400486_16635 3300038742 Bacteria 11856
285 Ga0400486_20766 3300038742 Bacteria 91783
286 Ga0400486_27056 3300038742 Bacteria 9105
287 Ga0400483_043696 3300039062 Bacteria 7381
288 Ga0400483_145628 3300039062 Bacteria 7144
289 Ga0400489_14732 3300039093 Bacteria 38869
290 Ga0400489_32976 3300039093 Bacteria 10440
291 Ga0400487_03922 3300039110 Bacteria 2356
292 Ga0400487_59477 3300039110 Bacteria 4973
293 Ga0451577_0000157 3300042876 Bacteria 151953
294 Ga0451577_0000313 3300042876 Bacteria 92642
295 Ga0453683_0008191 3300044673 Bacteria 7032
296 Ga0453683_0025102 3300044673 Bacteria 3788
297 Ga0453684_0000205 3300044712 Bacteria 257921
298 Ga0453684_0000324 3300044712 Bacteria 201431
299 Ga0453684_0000992 3300044712 Bacteria 92625
300 Ga0453684_0003182 3300044712 Bacteria 37655
301 Ga0453684_0027381 3300044712 Bacteria 8177
302 Ga0453684_0032355 3300044712 Bacteria 7323
303 Ga0453684_0041169 3300044712 Bacteria 6255
304 Ga0453684_0337897 3300044712 Bacteria 1701
305 Ga0451576_0003464 3300045051 Bacteria 21627
306 Ga0451576_0009194 3300045051 Bacteria 11481
307 Ga0451576_0021291 3300045051 Bacteria 7048
308 Ga0451576_0033374 3300045051 Bacteria 5471
309 Ga0451576_0037517 3300045051 Bacteria 5132
310 Ga0451576_0126756 3300045051 Bacteria 2660
311 Ga0451576_0241324 3300045051 Bacteria 1888
312 Ga0495592_0047298 3300046454 Bacteria 3204
313 Ga0495592_0095772 3300046454 Bacteria 2122
314 Ga0495603_0053257 3300046455 Bacteria 2401
315 Ga0495651_0028553 3300046462 Bacteria 4346
316 Ga0495651_0107820 3300046462 Unclassified 2063
317 Ga0495580_0000349 3300046472 Bacteria 37675
318 Ga0495580_0000506 3300046472 Bacteria 32778
319 Ga0495580_0002637 3300046472 Bacteria 15580
320 Ga0495580_0039051 3300046472 Bacteria 3397
321 Ga0495580_0051791 3300046472 Unclassified 2901
322 Ga0495594_0065897 3300046499 Bacteria 2009
323 Ga0495628_0057151 3300046516 Bacteria 3070
324 Ga0495630_0006972 3300046517 Bacteria 8057
325 Ga0495630_0010930 3300046517 Bacteria 6558
326 Ga0495587_0004248 3300046536 Bacteria 9471
327 Ga0495587_0028863 3300046536 Bacteria 3370
328 Ga0495587_0081448 3300046536 Bacteria 1876
329 Ga0495645_0030120 3300046543 Bacteria 3952
330 Ga0495667_0018866 3300046559 Bacteria 4658
331 Ga0495634_0031435 3300046642 Bacteria 3657
332 Ga0495588_0071044 3300046674 Bacteria 1810
333 Ga0495599_0002284 3300046678 Bacteria 11157
334 Ga0495599_0003107 3300046678 Bacteria 9674
335 Ga0495646_0106128 3300046680 Bacteria 1604
336 Ga0495669_0002783 3300046684 Bacteria 7167
337 Ga0495613_0000186 3300046689 Bacteria 60855
338 Ga0495613_0118409 3300046689 Bacteria 1904
339 Ga0495624_0072257 3300046690 Bacteria 2146
340 Ga0495604_0008852 3300047317 Bacteria 7955
341 Ga0495674_0100850 3300047319 Bacteria 2456
342 Ga0495674_0203234 3300047319 Bacteria 1643
343 Ga0495684_0000099 3300047471 Bacteria 60765
344 Ga0495684_0017345 3300047471 Bacteria 5541
345 Ga0495684_0062730 3300047471 Unclassified 2826
346 Ga0495602_0003694 3300048088 Bacteria 15877
347 Ga0495602_0109987 3300048088 Bacteria 2241
348 Ga0496110_0101850 3300048913 Bacteria 2575
349 Ga0496112_0067306 3300048915 Bacteria 3535
350 Ga0496112_0091837 3300048915 Bacteria 3005
351 Ga0496115_0080650 3300048918 Bacteria 2650
352 Ga0501032_0008415 3300049569 Bacteria 7525
353 Ga0501032_0013706 3300049569 Bacteria 5756
354 Ga0501032_0024886 3300049569 Bacteria 4130
355 Ga0501033_0002456 3300049570 Bacteria 15747
356 Ga0501033_0003979 3300049570 Bacteria 11974
357 Ga0501033_0021247 3300049570 Bacteria 4896
358 Ga0501034_0005216 3300049571 Bacteria 14256
359 Ga0501034_0030202 3300049571 Bacteria 5508
360 Ga0501034_0038968 3300049571 Bacteria 4813
361 Ga0501036_0002351 3300049572 Bacteria 14792
362 Ga0501036_0006207 3300049572 Bacteria 9696
363 Ga0501036_0022833 3300049572 Bacteria 5267
364 Ga0501036_0067667 3300049572 Bacteria 3022
365 Ga0501037_0001676 3300049573 Bacteria 16112
366 Ga0501037_0006021 3300049573 Bacteria 8850
367 Ga0501038_0010776 3300049574 Bacteria 8356
368 Ga0501038_0065146 3300049574 Bacteria 3105
369 Ga0501038_0113746 3300049574 Bacteria 2239
370 Ga0501039_0004195 3300049575 Bacteria 10850
371 Ga0501039_0041404 3300049575 Bacteria 3558
372 Ga0501042_0024787 3300049578 Bacteria 4210
373 Ga0501043_0002980 3300049579 Bacteria 14101
374 Ga0501043_0024628 3300049579 Bacteria 4721
375 Ga0501043_0049088 3300049579 Bacteria 3317
376 Ga0501046_0001842 3300049580 Bacteria 20196
377 Ga0501046_0002495 3300049580 Bacteria 17229
378 Ga0501046_0013593 3300049580 Bacteria 6886
379 Ga0501047_0001243 3300049581 Bacteria 25247
380 Ga0501047_0029953 3300049581 Bacteria 5246
381 Ga0501047_0059876 3300049581 Bacteria 3676
382 Ga0501047_0062673 3300049581 Bacteria 3586
383 Ga0501048_0018920 3300049582 Bacteria 5061
384 Ga0501067_0050387 3300049583 Bacteria 2307
385 Ga0501068_0001579 3300049584 Bacteria 12112
386 Ga0501068_0003583 3300049584 Bacteria 8388
387 Ga0501069_0000718 3300049585 Bacteria 15422
388 Ga0501069_0002944 3300049585 Bacteria 8749
389 Ga0501069_0014465 3300049585 Bacteria 4220
390 Ga0501070_0003319 3300049586 Bacteria 13973
391 Ga0501072_0074765 3300049588 Bacteria 2679
392 Ga0501072_0236174 3300049588 Bacteria 1456
393 Ga0501073_0011305 3300049589 Bacteria 6531
394 Ga0501073_0017403 3300049589 Bacteria 5206
395 Ga0501073_0045216 3300049589 Bacteria 3101
396 Ga0501073_0047194 3300049589 Bacteria 3027
397 Ga0501074_0002287 3300049590 Bacteria 13328
398 Ga0501074_0009003 3300049590 Bacteria 7247
399 Ga0501261_002301 3300049690 Bacteria 2343
400 Ga0501079_0007353 3300049741 Bacteria 8326
401 Ga0501080_0004813 3300049742 Bacteria 12037
402 Ga0501080_0117203 3300049742 Bacteria 2468
403 Ga0501083_0000834 3300049744 Bacteria 20259
404 Ga0501083_0010683 3300049744 Bacteria 6459
405 Ga0501083_0021220 3300049744 Bacteria 4514
406 Ga0501035_0002423 3300049822 Bacteria 18234
407 Ga0501035_0052854 3300049822 Bacteria 3634
408 Ga0501044_0022206 3300049823 Bacteria 6762
409 Ga0501044_0028166 3300049823 Bacteria 5930
410 Ga0501044_0063178 3300049823 Bacteria 3784
411 Ga0501044_0085715 3300049823 Bacteria 3182
412 Ga0501045_0011006 3300049824 Bacteria 6340
413 nmdc:mga05p37_114780_c1 3300050507 Bacteria 3311
414 nmdc:mga05p37_32975_c1 3300050507 Bacteria 6341
415 nmdc:mga05p37_87908_c1 3300050507 Bacteria 3831
416 nmdc:mga09592_229460_c1 3300050508 Bacteria 1608
417 nmdc:mga08y16_20523_c1 3300050511 Bacteria 6974
418 nmdc:mga0n895_38672_c1 3300050512 Bacteria 4624
419 nmdc:mga0n895_40821_c1 3300050512 Bacteria 4509
420 nmdc:mga0n895_5873_c1 3300050512 Bacteria 10316
421 nmdc:mga0n895_80_c1 3300050512 Bacteria 54788
422 nmdc:mga0rr50_11329_c1 3300050513 Bacteria 5704
423 nmdc:mga0rr50_2469_c1 3300050513 Bacteria 10443
424 nmdc:mga0rr50_35_c1 3300050513 Bacteria 91254
425 nmdc:mga0rr50_53951_c1 3300050513 Bacteria 2992
426 nmdc:mga08x19_3873_c1 3300050514 Bacteria 8905
427 nmdc:mga08x19_64_c1 3300050514 Bacteria 24706
428 nmdc:mga08x19_798_c1 3300050514 Bacteria 20114
429 nmdc:mga0a205_520_c1 3300050515 Bacteria 30274
430 nmdc:mga0a205_8057_c1 3300050515 Bacteria 7677
431 nmdc:mga0a205_88144_c1 3300050515 Bacteria 2999
432 Ga0495619_0001935 3300053085 Bacteria 13808
433 Ga0495619_0094236 3300053085 Bacteria 2031
434 Ga0500555_002401 3300053103 Bacteria 5443
435 Ga0500616_0000787 3300053153 Bacteria 36341
436 Ga0500645_000802 3300053730 Bacteria 18860
437 Ga0501084_0007873 3300054114 Bacteria 8772
438 Ga0501084_0035692 3300054114 Bacteria 4156
439 Ga0501082_0000020 3300060353 Bacteria 109889
440 Ga0501082_0001859 3300060353 Bacteria 18564
441 Ga0501082_0011056 3300060353 Bacteria 7761
442 Ga0501082_0065531 3300060353 Bacteria 3128
443 2617914711 2617270889 Bacteria 9064343
444 2831428320 2831426010 Bacteria 8662725
445 2848698482 2848694841 Bacteria 9205737
446 2849664261 2849660919 Bacteria 8251853
447 2886629030 2886627955 Bacteria 7618130
448 2913851421 2913844669 Bacteria 8381711
449 2913914623 2913912277 Bacteria 9037797
450 2913945195 2913939268 Bacteria 8559644
451 642604632 642555144 Bacteria 9059191
452 Ga0400483_240381
453 Ga0065712_10006010
454 Ga0070676_10010608
455 Ga0070683_100000041
456 Ga0070683_100003485
457 Ga0070683_100064949
458 Ga0070690_100002754
459 Ga0070690_100014702
460 Ga0070670_100050461
461 Ga0070680_100011166
462 Ga0070660_100027507
463 Ga0070660_100066140
464 Ga0070689_100081662
465 Ga0070661_100046557
466 Ga0070668_100038865
467 Ga0070669_100003153
468 Ga0070675_100000453
469 Ga0070671_100012531
470 Ga0070674_100024593
471 Ga0070688_100003250
472 Ga0070667_100004658
473 Ga0070667_100032926
474 Ga0070714_100037396
475 Ga0070713_100015825
476 Ga0070713_100035749
477 Ga0070713_100042071
478 Ga0070713_100060280
479 Ga0070711_100010558
480 Ga0070705_100003696
481 Ga0070700_100099182
482 Ga0070708_100002693
483 Ga0070678_100119484
484 Ga0070681_10001296
485 Ga0068867_100033147
486 Ga0070706_100003186
487 Ga0070706_100031277
488 Ga0070707_100000129
489 Ga0070707_100000947
490 Ga0070707_100005109
491 Ga0070707_100042689
492 Ga0070698_100055851
493 Ga0070698_100064735
494 Ga0070698_100092790
495 Ga0070698_100105004
496 Ga0070699_100004292
497 Ga0070699_100154284
498 Ga0070699_100181526
499 Ga0070679_100004541
500 Ga0070684_100000029
501 Ga0070684_100090846
502 Ga0070697_100000215
503 Ga0068853_100017153
504 Ga0070672_100138898
505 Ga0070686_100001994
506 Ga0070695_100006421
507 Ga0070696_100044569
508 Ga0070665_100232555
509 Ga0070704_100027336
510 Ga0068855_100009306
511 Ga0068855_100081652
512 Ga0068857_100000258
513 Ga0068854_100001865
514 Ga0068856_100026067
515 Ga0070702_100026023
516 Ga0068852_100020317
517 Ga0068859_100049794
518 Ga0068866_10017338
519 Ga0068861_100016441
520 Ga0068858_100001969
521 Ga0068858_100034578
522 Ga0068858_100068726
523 Ga0068858_100144165
524 Ga0068860_100079364
525 Ga0068862_100082995
526 Ga0081539_10002859
527 Ga0070717_10000622
528 Ga0070717_10041065
529 Ga0070712_100073980
530 Ga0097621_100012115
531 Ga0097621_100020407
532 Ga0097621_100057030
533 Ga0097621_100093101
534 Ga0068871_100001883
535 Ga0075433_10000310
536 Ga0075433_10060373
537 Ga0075434_100000326
538 Ga0075434_100000966
539 Ga0075434_100006572
540 Ga0075434_100072350
541 Ga0075436_100002847
542 Ga0075436_100003971
543 Ga0075436_100029174
544 Ga0097620_100049797
545 Ga0075435_100000020
546 Ga0075435_100001632
547 Ga0075435_100006343
548 Ga0075435_100025399
549 Ga0075435_100089695
550 Ga0105240_10004037
551 Ga0105240_10010414
552 Ga0105240_10013598
553 Ga0105240_10016014
554 Ga0105240_10018794
555 Ga0105240_10051569
556 Ga0105240_10107795
557 Ga0105245_10000754
558 Ga0105245_10001068
559 Ga0105245_10016565
560 Ga0114129_10012769
561 Ga0114129_10013906
562 Ga0114129_10020263
563 Ga0114129_10023072
564 Ga0114129_10023484
565 Ga0114129_10025400
566 Ga0114129_10025859
567 Ga0114129_10156529
568 Ga0105243_10034082
569 Ga0105243_10145511
570 Ga0105241_10004476
571 Ga0105242_10001588
572 Ga0105242_10109190
573 Ga0105248_10003926
574 Ga0105248_10007502
575 Ga0105248_10035321
576 Ga0105248_10036629
577 Ga0105248_10064650
578 Ga0105237_10005980
579 Ga0105237_10010302
580 Ga0105237_10098974
581 Ga0105237_10189082
582 Ga0105238_10000501
583 Ga0105238_10007557
584 Ga0105238_10014073
585 Ga0105238_10015567
586 Ga0105238_10016962
587 Ga0105238_10019109
588 Ga0105238_10024586
589 Ga0105249_10003665
590 Ga0105239_10002493
591 Ga0105239_10020834
592 Ga0105239_10060157
593 Ga0105246_10008582
594 Ga0105246_10009440
595 Ga0157370_10007929
596 Ga0157370_10009793
597 Ga0157370_10111571
598 Ga0157369_10005007
599 Ga0157369_10013273
600 Ga0157369_10020027
601 Ga0157369_10023126
602 Ga0157369_10098931
603 Ga0157374_10043802
604 Ga0157374_10074965
605 Ga0157374_10126985
606 Ga0157372_10001007
607 Ga0157375_10147477
608 Ga0163163_10004379
609 Ga0163163_10009916
610 Ga0163163_10035080
611 Ga0163163_10078769
612 Ga0157380_10014366
613 Ga0157377_10032374
614 Ga0157379_10019180
615 Ga0157376_10042491
616 Ga0157376_10132899
617 Ga0213875_10027126
618 Ga0207645_10003184
619 Ga0207684_10026953
620 Ga0207684_10051837
621 Ga0207707_10000919
622 Ga0207707_10021120
623 Ga0207695_10001615
624 Ga0207695_10007350
625 Ga0207695_10011965
626 Ga0207695_10047847
627 Ga0207695_10081330
628 Ga0207671_10005560
629 Ga0207671_10066673
630 Ga0207663_10028581
631 Ga0207663_10038601
632 Ga0207660_10007720
633 Ga0207660_10151673
634 Ga0207657_10021904
635 Ga0207657_10053005
636 Ga0207652_10003735
637 Ga0207646_10000012
638 Ga0207646_10000046
639 Ga0207646_10078582
640 Ga0207681_10053578
641 Ga0207694_10001532
642 Ga0207694_10006159
643 Ga0207694_10106192
644 Ga0207659_10000106
645 Ga0207687_10000849
646 Ga0207687_10003798
647 Ga0207687_10006990
648 Ga0207700_10047690
649 Ga0207664_10061534
650 Ga0207644_10034834
651 Ga0207686_10046700
652 Ga0207709_10040555
653 Ga0207670_10099535
654 Ga0207669_10014742
655 Ga0207704_10001950
656 Ga0207665_10015170
657 Ga0207711_10003941
658 Ga0207711_10035967
659 Ga0207711_10074096
660 Ga0207711_10079558
661 Ga0207661_10000040
662 Ga0207661_10020775
663 Ga0207661_10051405
664 Ga0207661_10111089
665 Ga0207667_10003475
666 Ga0207667_10022451
667 Ga0207667_10032728
668 Ga0207640_10021448
669 Ga0207658_10028715
670 Ga0207703_10049222
671 Ga0207703_10084451
672 Ga0207708_10011209
673 Ga0207702_10029858
674 Ga0207702_10119295
675 Ga0207641_10000875
676 Ga0207648_10012617
677 Ga0207648_10039599
678 Ga0207648_10073615
679 Ga0207674_10000035
680 Ga0207674_10001346
681 Ga0207675_100015864
682 Ga0207675_100026946
683 Ga0207698_10004118
684 Ga0207698_10031916
685 Ga0207428_10004967
686 Ga0268266_10010036
687 Ga0268264_10041437
688 Ga0268264_10059144
689 Ga0265338_10002394
690 Ga0265338_10016701
691 Ga0265325_10046997
692 Ga0265329_10008667
693 Ga0265316_10008312
694 Ga0265316_10011238
695 Ga0265316_10024360
696 Ga0316579_10019636
697 Ga0265314_10001766
698 Ga0265314_10002451
699 Ga0265342_10067695
700 Ga0316576_10068544
701 Ga0316578_10004118
702 Ga0316577_10000636
703 Ga0316577_10041306
704 Ga0316577_10045363
705 Ga0316577_10060556
706 Ga0373930_0001110
707 Ga0373948_0001264
708 Ga0373929_0000371
709 Ga0373934_0001281
710 Ga0373949_0000394
711 Ga0373951_0004663
712 Ga0373952_0000554
713 Ga0373932_0005619
714 Ga0373941_0001988
715 Ga0373953_0008813
716 Ga0373954_0003669
717 Ga0373943_0040884
718 Ga0373955_0036930
719 Ga0373955_0057901
720 Ga0373942_0000347
721 Ga0373961_0001167
722 Ga0373927_0047855
723 Ga0373937_0012516
724 Ga0373937_0111782
725 Ga0316584_0000596
726 Ga0316584_0049638
727 Ga0436364_0231727
728 Ga0436364_0304215
729 Ga0400490_06663
730 Ga0400490_07766
731 Ga0400490_08242
732 Ga0400485_07095
733 Ga0400488_01912
734 Ga0400488_38307
735 Ga0400486_16635
736 Ga0400486_20766
737 Ga0400486_27056
738 Ga0400483_043696
739 Ga0400483_145628
740 Ga0400489_14732
741 Ga0400489_32976
742 Ga0400487_03922
743 Ga0400487_59477
744 Ga0451577_0000157
745 Ga0451577_0000313
746 Ga0453683_0008191
747 Ga0453683_0025102
748 Ga0453684_0000205
749 Ga0453684_0000324
750 Ga0453684_0000992
751 Ga0453684_0003182
752 Ga0453684_0027381
753 Ga0453684_0032355
754 Ga0453684_0041169
755 Ga0453684_0337897
756 Ga0451576_0003464
757 Ga0451576_0009194
758 Ga0451576_0021291
759 Ga0451576_0033374
760 Ga0451576_0037517
761 Ga0451576_0126756
762 Ga0451576_0241324
763 Ga0495592_0047298
764 Ga0495592_0095772
765 Ga0495603_0053257
766 Ga0495651_0028553
767 Ga0495651_0107820
768 Ga0495580_0000349
769 Ga0495580_0000506
770 Ga0495580_0002637
771 Ga0495580_0039051
772 Ga0495580_0051791
773 Ga0495594_0065897
774 Ga0495628_0057151
775 Ga0495630_0006972
776 Ga0495630_0010930
777 Ga0495587_0004248
778 Ga0495587_0028863
779 Ga0495587_0081448
780 Ga0495645_0030120
781 Ga0495667_0018866
782 Ga0495634_0031435
783 Ga0495588_0071044
784 Ga0495599_0002284
785 Ga0495599_0003107
786 Ga0495646_0106128
787 Ga0495669_0002783
788 Ga0495613_0000186
789 Ga0495613_0118409
790 Ga0495624_0072257
791 Ga0495604_0008852
792 Ga0495674_0100850
793 Ga0495674_0203234
794 Ga0495684_0000099
795 Ga0495684_0017345
796 Ga0495684_0062730
797 Ga0495602_0003694
798 Ga0495602_0109987
799 Ga0496110_0101850
800 Ga0496112_0067306
801 Ga0496112_0091837
802 Ga0496115_0080650
803 Ga0501032_0008415
804 Ga0501032_0013706
805 Ga0501032_0024886
806 Ga0501033_0002456
807 Ga0501033_0003979
808 Ga0501033_0021247
809 Ga0501034_0005216
810 Ga0501034_0030202
811 Ga0501034_0038968
812 Ga0501036_0002351
813 Ga0501036_0006207
814 Ga0501036_0022833
815 Ga0501036_0067667
816 Ga0501037_0001676
817 Ga0501037_0006021
818 Ga0501038_0010776
819 Ga0501038_0065146
820 Ga0501038_0113746
821 Ga0501039_0004195
822 Ga0501039_0041404
823 Ga0501042_0024787
824 Ga0501043_0002980
825 Ga0501043_0024628
826 Ga0501043_0049088
827 Ga0501046_0001842
828 Ga0501046_0002495
829 Ga0501046_0013593
830 Ga0501047_0001243
831 Ga0501047_0029953
832 Ga0501047_0059876
833 Ga0501047_0062673
834 Ga0501048_0018920
835 Ga0501067_0050387
836 Ga0501068_0001579
837 Ga0501068_0003583
838 Ga0501069_0000718
839 Ga0501069_0002944
840 Ga0501069_0014465
841 Ga0501070_0003319
842 Ga0501072_0074765
843 Ga0501072_0236174
844 Ga0501073_0011305
845 Ga0501073_0017403
846 Ga0501073_0045216
847 Ga0501073_0047194
848 Ga0501074_0002287
849 Ga0501074_0009003
850 Ga0501261_002301
851 Ga0501079_0007353
852 Ga0501080_0004813
853 Ga0501080_0117203
854 Ga0501083_0000834
855 Ga0501083_0010683
856 Ga0501083_0021220
857 Ga0501035_0002423
858 Ga0501035_0052854
859 Ga0501044_0022206
860 Ga0501044_0028166
861 Ga0501044_0063178
862 Ga0501044_0085715
863 Ga0501045_0011006
864 nmdc:mga05p37_114780_c1
865 nmdc:mga05p37_32975_c1
866 nmdc:mga05p37_87908_c1
867 nmdc:mga09592_229460_c1
868 nmdc:mga08y16_20523_c1
869 nmdc:mga0n895_38672_c1
870 nmdc:mga0n895_40821_c1
871 nmdc:mga0n895_5873_c1
872 nmdc:mga0n895_80_c1
873 nmdc:mga0rr50_11329_c1
874 nmdc:mga0rr50_2469_c1
875 nmdc:mga0rr50_35_c1
876 nmdc:mga0rr50_53951_c1
877 nmdc:mga08x19_3873_c1
878 nmdc:mga08x19_64_c1
879 nmdc:mga08x19_798_c1
880 nmdc:mga0a205_520_c1
881 nmdc:mga0a205_8057_c1
882 nmdc:mga0a205_88144_c1
883 Ga0495619_0001935
884 Ga0495619_0094236
885 Ga0500555_002401
886 Ga0500616_0000787
887 Ga0500645_000802
888 Ga0501084_0007873
889 Ga0501084_0035692
890 Ga0501082_0000020
891 Ga0501082_0001859
892 Ga0501082_0011056
893 Ga0501082_0065531
894 2617914711
895 2831428320
896 2848698482
897 2849664261
898 2886629030
899 2913851421
900 2913914623
901 2913945195
902 642604632

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02540

NAD_synthase

NAD synthase

340

589

0.96

PF00795

CN_hydrolase

Carbon-nitrogen hydrolase

71

326

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fiu-assembly2.cif.gz_D structure of nmn synthetase from francisella tularensis 0.9122 269 520
3p52-assembly1.cif.gz_A nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8972 269 519
3p52-assembly1.cif.gz_B nh3-dependent nad synthetase from campylobacter jejuni subsp. jejuni nctc 11168 in complex with the nitrate ion 0.8923 269 519
5ny2-assembly1.cif.gz_A a c145a mutant of nesterenkonia an1 amidase from the nitrilase superfamily 0.8866 1 254
2e18-assembly1.cif.gz_B crystal structure of project ph0182 from pyrococcus horikoshii ot3 0.8849 260 520
ID Description Score Start End Superfamily
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9301 268 457 3.40.50.620
3n05B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9203 268 457 3.40.50.620
3n05B03 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9136 475 546 1.10.10.1510
3fiuC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9103 269 520 3.40.50.620
af_Q58747_4_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8965 267 520 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A534NNB0-F1-model_v4 NH(3)-dependent NAD(+) synthetase (EC 6.3.1.5) 0.9833 271 405 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-Q02BE0-F1-model_v4 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) 0.9767 1 546 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A2I0P0F2-F1-model_v4 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) 0.9758 1 548 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435
AF-A0A842KDF8-F1-model_v4 deleted 0.9751 1 546
AF-Q02BE0-F1-model_v4 Glutamine-dependent NAD(+) synthetase (EC 6.3.5.1) (NAD(+) synthase [glutamine-hydrolyzing]) 0.9749 1 546 GO:0003952
GO:0004359
GO:0005524
GO:0005737
GO:0008795
GO:0009435

Map