F446772

General Info

Members Datasets Scaffolds Average Seq Length
451 167 902 77

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10946949|Ga0111539_109469492
Length 87
Sequence MRGLLFLALAALVLVAVMPLLRGWRPRLPTTRPAGGTTAGGNELVKDPVCQTYVVRSRAVKRGDGERAIYFCSADCADRYSGRERRA

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
111 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
115 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
127 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
153 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
154 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.78
Stem 0
Stem Tuber 0
Unclassified 15.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10946949 3300009094 Bacteria 1001
2 Ga0065704_10332876 3300005289 Unclassified 835
3 Ga0065707_10194268 3300005295 Bacteria 1344
4 Ga0070676_10097464 3300005328 Bacteria 1811
5 Ga0070670_101762292 3300005331 Unclassified 570
6 Ga0070677_10327936 3300005333 Unclassified 786
7 Ga0068869_100023996 3300005334 Bacteria 4221
8 Ga0068869_100370591 3300005334 Bacteria 1172
9 Ga0068869_101737029 3300005334 Bacteria 557
10 Ga0068868_100640968 3300005338 Bacteria 945
11 Ga0070692_10185793 3300005345 Bacteria 1208
12 Ga0070668_100273066 3300005347 Unclassified 1410
13 Ga0070668_100919043 3300005347 Unclassified 783
14 Ga0070669_100062749 3300005353 Bacteria 2733
15 Ga0070669_100161170 3300005353 Bacteria 1743
16 Ga0070669_101242193 3300005353 Bacteria 644
17 Ga0070703_10020251 3300005406 Bacteria 1934
18 Ga0070703_10591875 3300005406 Bacteria 511
19 Ga0070705_100017102 3300005440 Bacteria 3780
20 Ga0070705_100066937 3300005440 Bacteria 2156
21 Ga0070705_100123952 3300005440 Unclassified 1673
22 Ga0070705_100710354 3300005440 Bacteria 791
23 Ga0070700_101054533 3300005441 Bacteria 671
24 Ga0070700_101704125 3300005441 Bacteria 541
25 Ga0070694_100022707 3300005444 Bacteria 4024
26 Ga0070694_100040693 3300005444 Bacteria 3098
27 Ga0070694_100747645 3300005444 Bacteria 798
28 Ga0070708_100012156 3300005445 Bacteria 7018
29 Ga0070708_100014430 3300005445 Bacteria 6501
30 Ga0070708_100016300 3300005445 Bacteria 6163
31 Ga0070708_100125213 3300005445 Unclassified 2374
32 Ga0070708_100154326 3300005445 Bacteria 2137
33 Ga0070708_100176794 3300005445 Bacteria 1995
34 Ga0070708_100822260 3300005445 Bacteria 873
35 Ga0070708_100906668 3300005445 Bacteria 827
36 Ga0070708_101007257 3300005445 Unclassified 781
37 Ga0070708_102148622 3300005445 Bacteria 516
38 Ga0070662_100006539 3300005457 Bacteria 7520
39 Ga0070681_11846811 3300005458 Bacteria 531
40 Ga0070706_100005873 3300005467 Bacteria 11639
41 Ga0070706_100007686 3300005467 Bacteria 10080
42 Ga0070706_100090027 3300005467 Bacteria 2845
43 Ga0070706_100188525 3300005467 Bacteria 1927
44 Ga0070706_100262753 3300005467 Bacteria 1611
45 Ga0070707_100037892 3300005468 Bacteria 4604
46 Ga0070707_100041567 3300005468 Bacteria 4400
47 Ga0070707_100054518 3300005468 Bacteria 3833
48 Ga0070707_100098485 3300005468 Unclassified 2832
49 Ga0070707_100374765 3300005468 Bacteria 1383
50 Ga0070707_100496705 3300005468 Bacteria 1182
51 Ga0070707_101095525 3300005468 Bacteria 762
52 Ga0070698_100003188 3300005471 Bacteria 18088
53 Ga0070698_100024395 3300005471 Bacteria 6312
54 Ga0070698_100059128 3300005471 Bacteria 3872
55 Ga0070698_101801179 3300005471 Bacteria 565
56 Ga0070699_100004718 3300005518 Bacteria 12055
57 Ga0070699_100012669 3300005518 Bacteria 7273
58 Ga0070699_100020289 3300005518 Bacteria 5731
59 Ga0070699_100293633 3300005518 Bacteria 1458
60 Ga0070699_100375424 3300005518 Bacteria 1283
61 Ga0070699_100764936 3300005518 Bacteria 884
62 Ga0070699_101972349 3300005518 Unclassified 534
63 Ga0070697_100001059 3300005536 Bacteria 20805
64 Ga0070697_100050748 3300005536 Bacteria 3368
65 Ga0070697_100409882 3300005536 Unclassified 1177
66 Ga0070697_100942243 3300005536 Unclassified 767
67 Ga0070686_100084452 3300005544 Unclassified 2110
68 Ga0070686_100276444 3300005544 Bacteria 1237
69 Ga0070695_100019330 3300005545 Bacteria 4147
70 Ga0070696_100009902 3300005546 Bacteria 6376
71 Ga0070696_100626628 3300005546 Bacteria 870
72 Ga0070696_100839310 3300005546 Bacteria 759
73 Ga0070693_100106647 3300005547 Bacteria 1716
74 Ga0070693_100569973 3300005547 Bacteria 813
75 Ga0070704_100023862 3300005549 Bacteria 4004
76 Ga0070704_100099903 3300005549 Bacteria 2183
77 Ga0070704_100185944 3300005549 Unclassified 1666
78 Ga0070704_100657071 3300005549 Bacteria 926
79 Ga0070704_102193178 3300005549 Bacteria 514
80 Ga0068857_100046327 3300005577 Bacteria 3859
81 Ga0068854_100386058 3300005578 Bacteria 1155
82 Ga0068859_100018441 3300005617 Bacteria 7014
83 Ga0068859_100045597 3300005617 Bacteria 4404
84 Ga0068859_101392800 3300005617 Archaea 773
85 Ga0068859_101788937 3300005617 Bacteria 679
86 Ga0068864_100659088 3300005618 Bacteria 1020
87 Ga0068864_101195633 3300005618 Bacteria 759
88 Ga0068864_102531072 3300005618 Archaea 519
89 Ga0068866_11228627 3300005718 Bacteria 542
90 Ga0068861_100197796 3300005719 Bacteria 1685
91 Ga0068861_100632083 3300005719 Bacteria 987
92 Ga0068861_101688449 3300005719 Bacteria 626
93 Ga0068863_100680475 3300005841 Unclassified 1022
94 Ga0068858_101837961 3300005842 Bacteria 598
95 Ga0068860_100064609 3300005843 Bacteria 3476
96 Ga0068860_100085565 3300005843 Unclassified 3000
97 Ga0068860_100264989 3300005843 Bacteria 1676
98 Ga0068860_100476824 3300005843 Bacteria 1243
99 Ga0068862_100010873 3300005844 Bacteria 7516
100 Ga0068862_100042798 3300005844 Bacteria 3859
101 Ga0068862_100594571 3300005844 Unclassified 1061
102 Ga0068862_100598506 3300005844 Bacteria 1058
103 Ga0068862_100639207 3300005844 Bacteria 1025
104 Ga0068862_101371822 3300005844 Unclassified 710
105 Ga0081455_10260931 3300005937 Bacteria 1262
106 Ga0081455_10302626 3300005937 Bacteria 1146
107 Ga0075427_10053880 3300006194 Bacteria 696
108 Ga0075428_100016010 3300006844 Bacteria 8293
109 Ga0075428_100034742 3300006844 Bacteria 5560
110 Ga0075428_100230011 3300006844 Unclassified 2001
111 Ga0075428_100593758 3300006844 Bacteria 1183
112 Ga0075428_100596649 3300006844 Bacteria 1180
113 Ga0075428_100781952 3300006844 Unclassified 1015
114 Ga0075428_102695598 3300006844 Bacteria 506
115 Ga0075430_100092122 3300006846 Bacteria 2534
116 Ga0075431_100035328 3300006847 Bacteria 5145
117 Ga0075431_100070685 3300006847 Bacteria 3602
118 Ga0075431_100089800 3300006847 Bacteria 3171
119 Ga0075431_100166462 3300006847 Unclassified 2266
120 Ga0075431_100299997 3300006847 Bacteria 1623
121 Ga0075431_100508458 3300006847 Bacteria 1195
122 Ga0075431_100806350 3300006847 Bacteria 912
123 Ga0075431_101066092 3300006847 Bacteria 773
124 Ga0075431_101164349 3300006847 Bacteria 734
125 Ga0075433_10026507 3300006852 Bacteria 4907
126 Ga0075433_10029675 3300006852 Bacteria 4662
127 Ga0075433_10056731 3300006852 Bacteria 3422
128 Ga0075433_10152591 3300006852 Unclassified 2055
129 Ga0075433_10244973 3300006852 Bacteria 1591
130 Ga0075434_100003456 3300006871 Bacteria 14115
131 Ga0075434_100025210 3300006871 Bacteria 5819
132 Ga0075434_100082438 3300006871 Bacteria 3213
133 Ga0075434_100085097 3300006871 Bacteria 3161
134 Ga0075434_100683529 3300006871 Bacteria 1044
135 Ga0075434_101206008 3300006871 Bacteria 769
136 Ga0075434_101427549 3300006871 Bacteria 702
137 Ga0075434_101497196 3300006871 Bacteria 684
138 Ga0075429_100001836 3300006880 Bacteria 17570
139 Ga0075429_100051508 3300006880 Bacteria 3582
140 Ga0075429_100454366 3300006880 Bacteria 1122
141 Ga0075429_100479669 3300006880 Bacteria 1090
142 Ga0068865_100556178 3300006881 Unclassified 964
143 Ga0068865_100657660 3300006881 Unclassified 891
144 Ga0068865_101268924 3300006881 Bacteria 654
145 Ga0075436_100266643 3300006914 Bacteria 1222
146 Ga0097620_100018442 3300006931 Bacteria 7014
147 Ga0097620_100045598 3300006931 Bacteria 4404
148 Ga0097620_101392411 3300006931 Archaea 773
149 Ga0097620_101788982 3300006931 Bacteria 679
150 Ga0075435_100020529 3300007076 Bacteria 5064
151 Ga0075435_100031010 3300007076 Bacteria 4209
152 Ga0075435_100040992 3300007076 Bacteria 3699
153 Ga0075435_100045941 3300007076 Bacteria 3502
154 Ga0075435_100071124 3300007076 Bacteria 2840
155 Ga0075435_100146778 3300007076 Bacteria 1981
156 Ga0075435_100182778 3300007076 Bacteria 1772
157 Ga0099794_10004332 3300007265 Bacteria 5557
158 Ga0099794_10090967 3300007265 Bacteria 1514
159 Ga0099794_10766865 3300007265 Bacteria 515
160 Ga0105250_10162079 3300009092 Bacteria 934
161 Ga0111539_10001884 3300009094 Bacteria 27868
162 Ga0111539_10029726 3300009094 Bacteria 6652
163 Ga0111539_10298557 3300009094 Unclassified 1875
164 Ga0105245_10230224 3300009098 Bacteria 1792
165 Ga0105247_10050338 3300009101 Bacteria 2563
166 Ga0114129_10004059 3300009147 Bacteria 20667
167 Ga0114129_10057298 3300009147 Bacteria 5454
168 Ga0114129_10067412 3300009147 Bacteria 4991
169 Ga0114129_10093057 3300009147 Bacteria 4176
170 Ga0114129_10228467 3300009147 Bacteria 2507
171 Ga0114129_10571609 3300009147 Bacteria 1468
172 Ga0114129_11184216 3300009147 Unclassified 953
173 Ga0114129_13199041 3300009147 Unclassified 532
174 Ga0105243_10058538 3300009148 Bacteria 3071
175 Ga0105243_10094223 3300009148 Bacteria 2472
176 Ga0105243_10561613 3300009148 Unclassified 1092
177 Ga0105243_11110679 3300009148 Bacteria 799
178 Ga0105243_11642944 3300009148 Bacteria 670
179 Ga0105241_10035496 3300009174 Bacteria 3750
180 Ga0105242_10231795 3300009176 Bacteria 1655
181 Ga0105242_10754361 3300009176 Bacteria 958
182 Ga0105242_11374570 3300009176 Bacteria 732
183 Ga0105248_10188804 3300009177 Bacteria 2322
184 Ga0105248_10354916 3300009177 Bacteria 1651
185 Ga0105249_10027602 3300009553 Bacteria 5123
186 Ga0105249_10111878 3300009553 Bacteria 2582
187 Ga0105249_10115782 3300009553 Bacteria 2540
188 Ga0105249_10282154 3300009553 Bacteria 1659
189 Ga0105249_10940286 3300009553 Bacteria 932
190 Ga0105249_12591251 3300009553 Bacteria 579
191 Ga0157373_10354459 3300013100 Bacteria 1047
192 Ga0157378_12591139 3300013297 Bacteria 559
193 Ga0163162_10873585 3300013306 Bacteria 1013
194 Ga0157380_10623031 3300014326 Archaea 1071
195 Ga0157380_11388487 3300014326 Bacteria 752
196 Ga0157380_12116391 3300014326 Bacteria 626
197 Ga0157379_10917023 3300014968 Unclassified 832
198 Ga0157379_11759742 3300014968 Unclassified 608
199 Ga0207653_10018024 3300025885 Bacteria 2224
200 Ga0207653_10020088 3300025885 Bacteria 2111
201 Ga0207710_10046492 3300025900 Unclassified 1938
202 Ga0207645_10080310 3300025907 Bacteria 2091
203 Ga0207684_10011152 3300025910 Bacteria 7868
204 Ga0207684_10036096 3300025910 Bacteria 4196
205 Ga0207684_10049928 3300025910 Bacteria 3548
206 Ga0207684_10337988 3300025910 Bacteria 1297
207 Ga0207684_10654911 3300025910 Bacteria 895
208 Ga0207684_10907862 3300025910 Bacteria 740
209 Ga0207654_11381119 3300025911 Bacteria 514
210 Ga0207660_10122339 3300025917 Bacteria 1972
211 Ga0207662_10867748 3300025918 Bacteria 638
212 Ga0207646_10001645 3300025922 Bacteria 27312
213 Ga0207646_10034276 3300025922 Bacteria 4589
214 Ga0207646_10060321 3300025922 Bacteria 3387
215 Ga0207646_10064592 3300025922 Bacteria 3267
216 Ga0207646_10278704 3300025922 Bacteria 1511
217 Ga0207646_10285212 3300025922 Bacteria 1492
218 Ga0207646_10477163 3300025922 Bacteria 1125
219 Ga0207646_10510267 3300025922 Bacteria 1083
220 Ga0207681_10020853 3300025923 Bacteria 4159
221 Ga0207681_10084726 3300025923 Unclassified 2248
222 Ga0207681_10260600 3300025923 Bacteria 1357
223 Ga0207687_11723887 3300025927 Bacteria 537
224 Ga0207706_10053786 3300025933 Bacteria 3553
225 Ga0207686_10193989 3300025934 Unclassified 1450
226 Ga0207709_10212918 3300025935 Bacteria 1388
227 Ga0207709_11553780 3300025935 Bacteria 549
228 Ga0207704_10409454 3300025938 Unclassified 1072
229 Ga0207704_10731604 3300025938 Unclassified 821
230 Ga0207691_10056295 3300025940 Bacteria 3582
231 Ga0207711_10287796 3300025941 Bacteria 1514
232 Ga0207711_10426811 3300025941 Unclassified 1233
233 Ga0207711_10734233 3300025941 Bacteria 921
234 Ga0207689_10030696 3300025942 Bacteria 4478
235 Ga0207689_10249381 3300025942 Bacteria 1468
236 Ga0207689_10699920 3300025942 Unclassified 854
237 Ga0207689_11050799 3300025942 Bacteria 687
238 Ga0207712_10034726 3300025961 Bacteria 3419
239 Ga0207712_10142871 3300025961 Bacteria 1839
240 Ga0207712_10180080 3300025961 Bacteria 1659
241 Ga0207712_10385658 3300025961 Bacteria 1174
242 Ga0207712_10771538 3300025961 Bacteria 843
243 Ga0207668_12023963 3300025972 Bacteria 519
244 Ga0207640_10329676 3300025981 Bacteria 1218
245 Ga0207640_10400314 3300025981 Bacteria 1118
246 Ga0207677_10450325 3300026023 Bacteria 1103
247 Ga0207703_10903328 3300026035 Unclassified 846
248 Ga0207703_11632982 3300026035 Bacteria 620
249 Ga0207708_10483604 3300026075 Bacteria 1035
250 Ga0207708_11716178 3300026075 Bacteria 551
251 Ga0207641_10090600 3300026088 Unclassified 2675
252 Ga0207648_10127865 3300026089 Bacteria 2235
253 Ga0207648_10778395 3300026089 Bacteria 890
254 Ga0207674_10039573 3300026116 Bacteria 4886
255 Ga0207675_100414974 3300026118 Unclassified 1329
256 Ga0207675_100515412 3300026118 Bacteria 1192
257 Ga0209588_1009313 3300027671 Bacteria 2933
258 Ga0209588_1134110 3300027671 Bacteria 789
259 Ga0209998_10061949 3300027717 Bacteria 882
260 Ga0207428_10002172 3300027907 Bacteria 19685
261 Ga0207428_10016399 3300027907 Bacteria 6373
262 Ga0207428_11303553 3300027907 Bacteria 503
263 Ga0268265_10014539 3300028380 Bacteria 5364
264 Ga0268265_10155388 3300028380 Bacteria 1935
265 Ga0268265_10160401 3300028380 Unclassified 1909
266 Ga0268265_10249438 3300028380 Bacteria 1571
267 Ga0268264_10113473 3300028381 Bacteria 2377
268 Ga0268264_10445288 3300028381 Bacteria 1254
269 Ga0268264_11231127 3300028381 Bacteria 758
270 Ga0307408_100629709 3300031548 Unclassified 957
271 Ga0307408_100850855 3300031548 Bacteria 831
272 Ga0307405_10969111 3300031731 Unclassified 724
273 Ga0307405_11267681 3300031731 Bacteria 640
274 Ga0307413_11166191 3300031824 Bacteria 668
275 Ga0307410_10148160 3300031852 Bacteria 1744
276 Ga0307406_10055900 3300031901 Bacteria 2525
277 Ga0307412_11326482 3300031911 Bacteria 649
278 Ga0307409_100341586 3300031995 Bacteria 1409
279 Ga0307409_102394919 3300031995 Bacteria 557
280 Ga0307416_100453118 3300032002 Unclassified 1336
281 Ga0307416_100671333 3300032002 Bacteria 1123
282 Ga0307416_100954742 3300032002 Bacteria 959
283 Ga0307411_11537939 3300032005 Bacteria 612
284 Ga0307415_100794862 3300032126 Bacteria 863
285 Ga0373950_0004807 3300034818 Bacteria 1992
286 Ga0373929_0044247 3300035085 Bacteria 999
287 Ga0373940_0015039 3300035088 Bacteria 1898
288 Ga0373940_0218173 3300035088 Bacteria 633
289 Ga0373949_0041569 3300035090 Bacteria 1132
290 Ga0373932_0051271 3300035112 Bacteria 1225
291 Ga0373932_0438589 3300035112 Bacteria 511
292 Ga0373939_0013762 3300035114 Unclassified 2088
293 Ga0373939_0495505 3300035114 Bacteria 521
294 Ga0373942_0234651 3300035207 Bacteria 619
295 Ga0373962_0023024 3300035242 Bacteria 1657
296 Ga0373931_0017697 3300035691 Bacteria 3530
297 Ga0373931_0256017 3300035691 Bacteria 1066
298 Ga0395900_1435257 3300037418 Bacteria 603
299 Ga0395901_1769401 3300038443 Bacteria 568
300 Ga0451577_1025454 3300042876 Bacteria 740
301 Ga0453683_0162938 3300044673 Bacteria 1411
302 Ga0453683_0250520 3300044673 Unclassified 1129
303 Ga0453683_0393399 3300044673 Unclassified 893
304 Ga0453684_0124236 3300044712 Bacteria 3109
305 Ga0453684_0297411 3300044712 Bacteria 1836
306 Ga0451576_0071857 3300045051 Bacteria 3601
307 Ga0451576_0290432 3300045051 Bacteria 1709
308 Ga0451576_0369656 3300045051 Bacteria 1502
309 Ga0451576_0891641 3300045051 Bacteria 933
310 Ga0495603_0080211 3300046455 Bacteria 1913
311 Ga0495580_0000654 3300046472 Bacteria 29425
312 Ga0495580_1060549 3300046472 Bacteria 514
313 Ga0495585_0264722 3300046492 Bacteria 854
314 Ga0495585_0279469 3300046492 Bacteria 826
315 Ga0495642_0018659 3300046528 Bacteria 2716
316 Ga0495642_0068512 3300046528 Bacteria 1481
317 Ga0495659_0016574 3300046664 Bacteria 2433
318 Ga0495659_0176283 3300046664 Unclassified 869
319 Ga0495659_0206543 3300046664 Bacteria 807
320 Ga0495669_0189619 3300046684 Unclassified 981
321 Ga0495670_0527633 3300046691 Unclassified 642
322 Ga0495670_0593465 3300046691 Bacteria 603
323 Ga0495670_0821726 3300046691 Unclassified 507
324 Ga0495636_0106351 3300047318 Bacteria 1231
325 Ga0496106_0969127 3300048909 Unclassified 670
326 Ga0501031_0238237 3300049568 Bacteria 1183
327 Ga0501031_0437171 3300049568 Bacteria 845
328 Ga0501032_0499365 3300049569 Bacteria 778
329 Ga0501036_0354741 3300049572 Bacteria 1225
330 Ga0501036_0490386 3300049572 Bacteria 1023
331 Ga0501037_0859922 3300049573 Bacteria 596
332 Ga0501039_0404462 3300049575 Bacteria 1072
333 Ga0501040_0065089 3300049576 Bacteria 2511
334 Ga0501040_0081887 3300049576 Bacteria 2237
335 Ga0501040_0129379 3300049576 Unclassified 1774
336 Ga0501040_0246095 3300049576 Bacteria 1275
337 Ga0501040_0261517 3300049576 Bacteria 1235
338 Ga0501041_0395090 3300049577 Bacteria 876
339 Ga0501041_0503141 3300049577 Bacteria 771
340 Ga0501042_0156662 3300049578 Bacteria 1643
341 Ga0501042_0190644 3300049578 Bacteria 1479
342 Ga0501043_0411044 3300049579 Bacteria 1021
343 Ga0501046_0162714 3300049580 Bacteria 1678
344 Ga0501046_0173094 3300049580 Bacteria 1619
345 Ga0501046_0230649 3300049580 Bacteria 1368
346 Ga0501046_0471878 3300049580 Unclassified 901
347 Ga0501046_0539190 3300049580 Bacteria 833
348 Ga0501046_0668772 3300049580 Bacteria 733
349 Ga0501048_0132086 3300049582 Bacteria 1765
350 Ga0501048_0166800 3300049582 Bacteria 1559
351 Ga0501068_0273396 3300049584 Bacteria 1079
352 Ga0501071_0272446 3300049587 Bacteria 1280
353 Ga0501071_1347910 3300049587 Bacteria 551
354 Ga0501072_0094523 3300049588 Bacteria 2375
355 Ga0501072_0483859 3300049588 Bacteria 979
356 Ga0501072_1402772 3300049588 Unclassified 540
357 Ga0501074_0354224 3300049590 Unclassified 1042
358 Ga0501075_0048564 3300049591 Bacteria 3189
359 Ga0501075_0073307 3300049591 Bacteria 2589
360 Ga0501075_0214152 3300049591 Bacteria 1469
361 Ga0501075_0367518 3300049591 Bacteria 1096
362 Ga0501075_0762121 3300049591 Bacteria 737
363 Ga0501075_1038745 3300049591 Bacteria 622
364 Ga0501075_1334261 3300049591 Bacteria 543
365 Ga0501076_0119496 3300049592 Bacteria 2134
366 Ga0501076_0252276 3300049592 Bacteria 1444
367 Ga0501076_0345086 3300049592 Unclassified 1222
368 Ga0501076_0543055 3300049592 Bacteria 958
369 Ga0501076_1070155 3300049592 Bacteria 664
370 Ga0501077_1000731 3300049593 Bacteria 538
371 Ga0501079_0253991 3300049741 Bacteria 1374
372 Ga0501079_0269637 3300049741 Unclassified 1331
373 Ga0501079_0380498 3300049741 Bacteria 1107
374 Ga0501079_0417109 3300049741 Bacteria 1053
375 Ga0501079_0805091 3300049741 Bacteria 740
376 Ga0501080_0099945 3300049742 Bacteria 2692
377 Ga0501080_0243971 3300049742 Bacteria 1639
378 Ga0501080_0350438 3300049742 Bacteria 1333
379 Ga0501081_0100734 3300049743 Bacteria 2042
380 Ga0501081_0762930 3300049743 Bacteria 727
381 Ga0501081_1429165 3300049743 Bacteria 525
382 Ga0501083_0129978 3300049744 Bacteria 1651
383 Ga0501035_0635521 3300049822 Unclassified 867
384 Ga0501035_1113940 3300049822 Unclassified 616
385 Ga0501045_0023782 3300049824 Bacteria 4396
386 Ga0501045_0098419 3300049824 Bacteria 2164
387 Ga0501045_0404748 3300049824 Bacteria 1015
388 Ga0501045_0585314 3300049824 Bacteria 827
389 Ga0501045_0909827 3300049824 Bacteria 646
390 nmdc:mga05p37_14140_c1 3300050507 Bacteria 9579
391 nmdc:mga05p37_25041_c1 3300050507 Bacteria 7255
392 nmdc:mga05p37_257257_c1 3300050507 Bacteria 2091
393 nmdc:mga05p37_329052_c1 3300050507 Bacteria 1806
394 nmdc:mga05p37_402851_c1 3300050507 Bacteria 1597
395 nmdc:mga05p37_575841_c1 3300050507 Bacteria 1276
396 nmdc:mga05p37_6445_c1 3300050507 Bacteria 13838
397 nmdc:mga05p37_961499_c1 3300050507 Bacteria 913
398 nmdc:mga09592_12224_c2 3300050508 Bacteria 6614
399 nmdc:mga09592_168283_c1 3300050508 Bacteria 1895
400 nmdc:mga09592_465445_c1 3300050508 Bacteria 1090
401 nmdc:mga09592_819779_c1 3300050508 Unclassified 786
402 nmdc:mga0qj67_1254653_c1 3300050509 Unclassified 575
403 nmdc:mga0qj67_705701_c1 3300050509 Bacteria 802
404 nmdc:mga06r32_284894_c2 3300050510 Unclassified 1333
405 nmdc:mga06r32_395423_c1 3300050510 Unclassified 1364
406 nmdc:mga06r32_42725_c1 3300050510 Bacteria 4311
407 nmdc:mga06r32_580064_c1 3300050510 Bacteria 1094
408 nmdc:mga06r32_80885_c1 3300050510 Bacteria 3163
409 nmdc:mga06r32_8753_c1 3300050510 Bacteria 9118
410 nmdc:mga08y16_11531_c1 3300050511 Bacteria 9289
411 nmdc:mga08y16_13499_c1 3300050511 Bacteria 8595
412 nmdc:mga08y16_590450_c1 3300050511 Unclassified 1120
413 nmdc:mga08y16_816765_c1 3300050511 Bacteria 924
414 nmdc:mga0n895_1084737_c1 3300050512 Bacteria 779
415 nmdc:mga0n895_116159_c1 3300050512 Bacteria 2695
416 nmdc:mga0n895_1564588_c1 3300050512 Bacteria 624
417 nmdc:mga0n895_32764_c1 3300050512 Bacteria 4989
418 nmdc:mga0n895_476_c1 3300050512 Bacteria 26971
419 nmdc:mga0n895_533748_c1 3300050512 Unclassified 1180
420 nmdc:mga0n895_58749_c1 3300050512 Bacteria 3793
421 nmdc:mga0n895_633950_c1 3300050512 Bacteria 1069
422 nmdc:mga0rr50_100614_c1 3300050513 Bacteria 2271
423 nmdc:mga0rr50_147676_c1 3300050513 Bacteria 1897
424 nmdc:mga0rr50_23824_c1 3300050513 Bacteria 4231
425 nmdc:mga0rr50_244061_c1 3300050513 Bacteria 1489
426 nmdc:mga0rr50_25036_c1 3300050513 Bacteria 4144
427 nmdc:mga0rr50_261546_c1 3300050513 Bacteria 1440
428 nmdc:mga0rr50_462542_c1 3300050513 Unclassified 1076
429 nmdc:mga0rr50_50181_c1 3300050513 Bacteria 3091
430 nmdc:mga0rr50_9260_c1 3300050513 Bacteria 6182
431 nmdc:mga08x19_1001149_c1 3300050514 Bacteria 594
432 nmdc:mga08x19_1177169_c1 3300050514 Unclassified 544
433 nmdc:mga0a205_1122912_c1 3300050515 Bacteria 633
434 nmdc:mga0a205_148_c1 3300050515 Bacteria 45499
435 nmdc:mga0a205_197036_c1 3300050515 Bacteria 1905
436 nmdc:mga0a205_228277_c1 3300050515 Bacteria 1746
437 nmdc:mga0a205_511233_c1 3300050515 Bacteria 1058
438 nmdc:mga0a205_64044_c1 3300050515 Bacteria 3551
439 nmdc:mga0a205_99277_c1 3300050515 Bacteria 2810
440 Ga0501084_0003561 3300054114 Bacteria 12642
441 Ga0501084_0018324 3300054114 Bacteria 5830
442 Ga0501084_0115949 3300054114 Bacteria 2251
443 Ga0501084_1006340 3300054114 Bacteria 700
444 Ga0501084_1115319 3300054114 Unclassified 662
445 Ga0501084_1141783 3300054114 Bacteria 654
446 Ga0501082_0015180 3300060353 Bacteria 6636
447 Ga0501082_0584563 3300060353 Unclassified 977
448 Ga0501082_1595405 3300060353 Unclassified 570
449 Ga0530510_0236794 3300061734 Bacteria 1359
450 Ga0530510_1017331 3300061734 Bacteria 634
451 Ga0530510_1253954 3300061734 Bacteria 568
452 Ga0111539_10946949
453 Ga0065704_10332876
454 Ga0065707_10194268
455 Ga0070676_10097464
456 Ga0070670_101762292
457 Ga0070677_10327936
458 Ga0068869_100023996
459 Ga0068869_100370591
460 Ga0068869_101737029
461 Ga0068868_100640968
462 Ga0070692_10185793
463 Ga0070668_100273066
464 Ga0070668_100919043
465 Ga0070669_100062749
466 Ga0070669_100161170
467 Ga0070669_101242193
468 Ga0070703_10020251
469 Ga0070703_10591875
470 Ga0070705_100017102
471 Ga0070705_100066937
472 Ga0070705_100123952
473 Ga0070705_100710354
474 Ga0070700_101054533
475 Ga0070700_101704125
476 Ga0070694_100022707
477 Ga0070694_100040693
478 Ga0070694_100747645
479 Ga0070708_100012156
480 Ga0070708_100014430
481 Ga0070708_100016300
482 Ga0070708_100125213
483 Ga0070708_100154326
484 Ga0070708_100176794
485 Ga0070708_100822260
486 Ga0070708_100906668
487 Ga0070708_101007257
488 Ga0070708_102148622
489 Ga0070662_100006539
490 Ga0070681_11846811
491 Ga0070706_100005873
492 Ga0070706_100007686
493 Ga0070706_100090027
494 Ga0070706_100188525
495 Ga0070706_100262753
496 Ga0070707_100037892
497 Ga0070707_100041567
498 Ga0070707_100054518
499 Ga0070707_100098485
500 Ga0070707_100374765
501 Ga0070707_100496705
502 Ga0070707_101095525
503 Ga0070698_100003188
504 Ga0070698_100024395
505 Ga0070698_100059128
506 Ga0070698_101801179
507 Ga0070699_100004718
508 Ga0070699_100012669
509 Ga0070699_100020289
510 Ga0070699_100293633
511 Ga0070699_100375424
512 Ga0070699_100764936
513 Ga0070699_101972349
514 Ga0070697_100001059
515 Ga0070697_100050748
516 Ga0070697_100409882
517 Ga0070697_100942243
518 Ga0070686_100084452
519 Ga0070686_100276444
520 Ga0070695_100019330
521 Ga0070696_100009902
522 Ga0070696_100626628
523 Ga0070696_100839310
524 Ga0070693_100106647
525 Ga0070693_100569973
526 Ga0070704_100023862
527 Ga0070704_100099903
528 Ga0070704_100185944
529 Ga0070704_100657071
530 Ga0070704_102193178
531 Ga0068857_100046327
532 Ga0068854_100386058
533 Ga0068859_100018441
534 Ga0068859_100045597
535 Ga0068859_101392800
536 Ga0068859_101788937
537 Ga0068864_100659088
538 Ga0068864_101195633
539 Ga0068864_102531072
540 Ga0068866_11228627
541 Ga0068861_100197796
542 Ga0068861_100632083
543 Ga0068861_101688449
544 Ga0068863_100680475
545 Ga0068858_101837961
546 Ga0068860_100064609
547 Ga0068860_100085565
548 Ga0068860_100264989
549 Ga0068860_100476824
550 Ga0068862_100010873
551 Ga0068862_100042798
552 Ga0068862_100594571
553 Ga0068862_100598506
554 Ga0068862_100639207
555 Ga0068862_101371822
556 Ga0081455_10260931
557 Ga0081455_10302626
558 Ga0075427_10053880
559 Ga0075428_100016010
560 Ga0075428_100034742
561 Ga0075428_100230011
562 Ga0075428_100593758
563 Ga0075428_100596649
564 Ga0075428_100781952
565 Ga0075428_102695598
566 Ga0075430_100092122
567 Ga0075431_100035328
568 Ga0075431_100070685
569 Ga0075431_100089800
570 Ga0075431_100166462
571 Ga0075431_100299997
572 Ga0075431_100508458
573 Ga0075431_100806350
574 Ga0075431_101066092
575 Ga0075431_101164349
576 Ga0075433_10026507
577 Ga0075433_10029675
578 Ga0075433_10056731
579 Ga0075433_10152591
580 Ga0075433_10244973
581 Ga0075434_100003456
582 Ga0075434_100025210
583 Ga0075434_100082438
584 Ga0075434_100085097
585 Ga0075434_100683529
586 Ga0075434_101206008
587 Ga0075434_101427549
588 Ga0075434_101497196
589 Ga0075429_100001836
590 Ga0075429_100051508
591 Ga0075429_100454366
592 Ga0075429_100479669
593 Ga0068865_100556178
594 Ga0068865_100657660
595 Ga0068865_101268924
596 Ga0075436_100266643
597 Ga0097620_100018442
598 Ga0097620_100045598
599 Ga0097620_101392411
600 Ga0097620_101788982
601 Ga0075435_100020529
602 Ga0075435_100031010
603 Ga0075435_100040992
604 Ga0075435_100045941
605 Ga0075435_100071124
606 Ga0075435_100146778
607 Ga0075435_100182778
608 Ga0099794_10004332
609 Ga0099794_10090967
610 Ga0099794_10766865
611 Ga0105250_10162079
612 Ga0111539_10001884
613 Ga0111539_10029726
614 Ga0111539_10298557
615 Ga0105245_10230224
616 Ga0105247_10050338
617 Ga0114129_10004059
618 Ga0114129_10057298
619 Ga0114129_10067412
620 Ga0114129_10093057
621 Ga0114129_10228467
622 Ga0114129_10571609
623 Ga0114129_11184216
624 Ga0114129_13199041
625 Ga0105243_10058538
626 Ga0105243_10094223
627 Ga0105243_10561613
628 Ga0105243_11110679
629 Ga0105243_11642944
630 Ga0105241_10035496
631 Ga0105242_10231795
632 Ga0105242_10754361
633 Ga0105242_11374570
634 Ga0105248_10188804
635 Ga0105248_10354916
636 Ga0105249_10027602
637 Ga0105249_10111878
638 Ga0105249_10115782
639 Ga0105249_10282154
640 Ga0105249_10940286
641 Ga0105249_12591251
642 Ga0157373_10354459
643 Ga0157378_12591139
644 Ga0163162_10873585
645 Ga0157380_10623031
646 Ga0157380_11388487
647 Ga0157380_12116391
648 Ga0157379_10917023
649 Ga0157379_11759742
650 Ga0207653_10018024
651 Ga0207653_10020088
652 Ga0207710_10046492
653 Ga0207645_10080310
654 Ga0207684_10011152
655 Ga0207684_10036096
656 Ga0207684_10049928
657 Ga0207684_10337988
658 Ga0207684_10654911
659 Ga0207684_10907862
660 Ga0207654_11381119
661 Ga0207660_10122339
662 Ga0207662_10867748
663 Ga0207646_10001645
664 Ga0207646_10034276
665 Ga0207646_10060321
666 Ga0207646_10064592
667 Ga0207646_10278704
668 Ga0207646_10285212
669 Ga0207646_10477163
670 Ga0207646_10510267
671 Ga0207681_10020853
672 Ga0207681_10084726
673 Ga0207681_10260600
674 Ga0207687_11723887
675 Ga0207706_10053786
676 Ga0207686_10193989
677 Ga0207709_10212918
678 Ga0207709_11553780
679 Ga0207704_10409454
680 Ga0207704_10731604
681 Ga0207691_10056295
682 Ga0207711_10287796
683 Ga0207711_10426811
684 Ga0207711_10734233
685 Ga0207689_10030696
686 Ga0207689_10249381
687 Ga0207689_10699920
688 Ga0207689_11050799
689 Ga0207712_10034726
690 Ga0207712_10142871
691 Ga0207712_10180080
692 Ga0207712_10385658
693 Ga0207712_10771538
694 Ga0207668_12023963
695 Ga0207640_10329676
696 Ga0207640_10400314
697 Ga0207677_10450325
698 Ga0207703_10903328
699 Ga0207703_11632982
700 Ga0207708_10483604
701 Ga0207708_11716178
702 Ga0207641_10090600
703 Ga0207648_10127865
704 Ga0207648_10778395
705 Ga0207674_10039573
706 Ga0207675_100414974
707 Ga0207675_100515412
708 Ga0209588_1009313
709 Ga0209588_1134110
710 Ga0209998_10061949
711 Ga0207428_10002172
712 Ga0207428_10016399
713 Ga0207428_11303553
714 Ga0268265_10014539
715 Ga0268265_10155388
716 Ga0268265_10160401
717 Ga0268265_10249438
718 Ga0268264_10113473
719 Ga0268264_10445288
720 Ga0268264_11231127
721 Ga0307408_100629709
722 Ga0307408_100850855
723 Ga0307405_10969111
724 Ga0307405_11267681
725 Ga0307413_11166191
726 Ga0307410_10148160
727 Ga0307406_10055900
728 Ga0307412_11326482
729 Ga0307409_100341586
730 Ga0307409_102394919
731 Ga0307416_100453118
732 Ga0307416_100671333
733 Ga0307416_100954742
734 Ga0307411_11537939
735 Ga0307415_100794862
736 Ga0373950_0004807
737 Ga0373929_0044247
738 Ga0373940_0015039
739 Ga0373940_0218173
740 Ga0373949_0041569
741 Ga0373932_0051271
742 Ga0373932_0438589
743 Ga0373939_0013762
744 Ga0373939_0495505
745 Ga0373942_0234651
746 Ga0373962_0023024
747 Ga0373931_0017697
748 Ga0373931_0256017
749 Ga0395900_1435257
750 Ga0395901_1769401
751 Ga0451577_1025454
752 Ga0453683_0162938
753 Ga0453683_0250520
754 Ga0453683_0393399
755 Ga0453684_0124236
756 Ga0453684_0297411
757 Ga0451576_0071857
758 Ga0451576_0290432
759 Ga0451576_0369656
760 Ga0451576_0891641
761 Ga0495603_0080211
762 Ga0495580_0000654
763 Ga0495580_1060549
764 Ga0495585_0264722
765 Ga0495585_0279469
766 Ga0495642_0018659
767 Ga0495642_0068512
768 Ga0495659_0016574
769 Ga0495659_0176283
770 Ga0495659_0206543
771 Ga0495669_0189619
772 Ga0495670_0527633
773 Ga0495670_0593465
774 Ga0495670_0821726
775 Ga0495636_0106351
776 Ga0496106_0969127
777 Ga0501031_0238237
778 Ga0501031_0437171
779 Ga0501032_0499365
780 Ga0501036_0354741
781 Ga0501036_0490386
782 Ga0501037_0859922
783 Ga0501039_0404462
784 Ga0501040_0065089
785 Ga0501040_0081887
786 Ga0501040_0129379
787 Ga0501040_0246095
788 Ga0501040_0261517
789 Ga0501041_0395090
790 Ga0501041_0503141
791 Ga0501042_0156662
792 Ga0501042_0190644
793 Ga0501043_0411044
794 Ga0501046_0162714
795 Ga0501046_0173094
796 Ga0501046_0230649
797 Ga0501046_0471878
798 Ga0501046_0539190
799 Ga0501046_0668772
800 Ga0501048_0132086
801 Ga0501048_0166800
802 Ga0501068_0273396
803 Ga0501071_0272446
804 Ga0501071_1347910
805 Ga0501072_0094523
806 Ga0501072_0483859
807 Ga0501072_1402772
808 Ga0501074_0354224
809 Ga0501075_0048564
810 Ga0501075_0073307
811 Ga0501075_0214152
812 Ga0501075_0367518
813 Ga0501075_0762121
814 Ga0501075_1038745
815 Ga0501075_1334261
816 Ga0501076_0119496
817 Ga0501076_0252276
818 Ga0501076_0345086
819 Ga0501076_0543055
820 Ga0501076_1070155
821 Ga0501077_1000731
822 Ga0501079_0253991
823 Ga0501079_0269637
824 Ga0501079_0380498
825 Ga0501079_0417109
826 Ga0501079_0805091
827 Ga0501080_0099945
828 Ga0501080_0243971
829 Ga0501080_0350438
830 Ga0501081_0100734
831 Ga0501081_0762930
832 Ga0501081_1429165
833 Ga0501083_0129978
834 Ga0501035_0635521
835 Ga0501035_1113940
836 Ga0501045_0023782
837 Ga0501045_0098419
838 Ga0501045_0404748
839 Ga0501045_0585314
840 Ga0501045_0909827
841 nmdc:mga05p37_14140_c1
842 nmdc:mga05p37_25041_c1
843 nmdc:mga05p37_257257_c1
844 nmdc:mga05p37_329052_c1
845 nmdc:mga05p37_402851_c1
846 nmdc:mga05p37_575841_c1
847 nmdc:mga05p37_6445_c1
848 nmdc:mga05p37_961499_c1
849 nmdc:mga09592_12224_c2
850 nmdc:mga09592_168283_c1
851 nmdc:mga09592_465445_c1
852 nmdc:mga09592_819779_c1
853 nmdc:mga0qj67_1254653_c1
854 nmdc:mga0qj67_705701_c1
855 nmdc:mga06r32_284894_c2
856 nmdc:mga06r32_395423_c1
857 nmdc:mga06r32_42725_c1
858 nmdc:mga06r32_580064_c1
859 nmdc:mga06r32_80885_c1
860 nmdc:mga06r32_8753_c1
861 nmdc:mga08y16_11531_c1
862 nmdc:mga08y16_13499_c1
863 nmdc:mga08y16_590450_c1
864 nmdc:mga08y16_816765_c1
865 nmdc:mga0n895_1084737_c1
866 nmdc:mga0n895_116159_c1
867 nmdc:mga0n895_1564588_c1
868 nmdc:mga0n895_32764_c1
869 nmdc:mga0n895_476_c1
870 nmdc:mga0n895_533748_c1
871 nmdc:mga0n895_58749_c1
872 nmdc:mga0n895_633950_c1
873 nmdc:mga0rr50_100614_c1
874 nmdc:mga0rr50_147676_c1
875 nmdc:mga0rr50_23824_c1
876 nmdc:mga0rr50_244061_c1
877 nmdc:mga0rr50_25036_c1
878 nmdc:mga0rr50_261546_c1
879 nmdc:mga0rr50_462542_c1
880 nmdc:mga0rr50_50181_c1
881 nmdc:mga0rr50_9260_c1
882 nmdc:mga08x19_1001149_c1
883 nmdc:mga08x19_1177169_c1
884 nmdc:mga0a205_1122912_c1
885 nmdc:mga0a205_148_c1
886 nmdc:mga0a205_197036_c1
887 nmdc:mga0a205_228277_c1
888 nmdc:mga0a205_511233_c1
889 nmdc:mga0a205_64044_c1
890 nmdc:mga0a205_99277_c1
891 Ga0501084_0003561
892 Ga0501084_0018324
893 Ga0501084_0115949
894 Ga0501084_1006340
895 Ga0501084_1115319
896 Ga0501084_1141783
897 Ga0501082_0015180
898 Ga0501082_0584563
899 Ga0501082_1595405
900 Ga0530510_0236794
901 Ga0530510_1017331
902 Ga0530510_1253954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map