F446729

General Info

Members Datasets Scaffolds Average Seq Length
451 210 902 147

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100643929|Ga0070667_1006439292
Length 160
Sequence MRSTDPFDEIVSGAGSESRLWASALLPPGFRDAEPSFSPLAPPAFAVGLETVYEAYLVHYGRPRLFAPPNRDEAVLLGDYLYAHGLVRIAEAGGVPAVATMAELISRCASLRADGDRDGLAGDAPADGSAWVAAARSLGGEPADADIDSALARHSARVAP

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
66 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
122 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
123 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
135 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
136 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
142 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
143 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
158 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
176 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.78
Metatranscriptomes 2.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.98
Rhizosphere 89.58
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100643929 3300005367 Unclassified 978
2 rootH1_10164495 3300003323 Bacteria 1582
3 Ga0070658_10016246 3300005327 Bacteria 5956
4 Ga0070658_10103290 3300005327 Bacteria 2357
5 Ga0070658_10113981 3300005327 Bacteria 2241
6 Ga0070683_100008892 3300005329 Bacteria 8556
7 Ga0070683_100093476 3300005329 Bacteria 2825
8 Ga0070683_100231478 3300005329 Bacteria 1757
9 Ga0070683_100498249 3300005329 Bacteria 1163
10 Ga0070683_101269974 3300005329 Unclassified 708
11 Ga0070683_101290091 3300005329 Bacteria 702
12 Ga0070680_100008814 3300005336 Bacteria 7738
13 Ga0070680_100948161 3300005336 Bacteria 743
14 Ga0070682_100058730 3300005337 Bacteria 2426
15 Ga0068868_100382643 3300005338 Bacteria 1211
16 Ga0068868_100841041 3300005338 Bacteria 831
17 Ga0070660_100003246 3300005339 Bacteria 11161
18 Ga0070660_100062251 3300005339 Bacteria 2898
19 Ga0070660_100367138 3300005339 Bacteria 1187
20 Ga0070660_101152560 3300005339 Unclassified 657
21 Ga0070660_101274142 3300005339 Bacteria 624
22 Ga0070661_100068181 3300005344 Bacteria 2615
23 Ga0070661_100130042 3300005344 Bacteria 1890
24 Ga0070661_100177151 3300005344 Bacteria 1621
25 Ga0070661_100285289 3300005344 Bacteria 1282
26 Ga0070661_100332856 3300005344 Bacteria 1188
27 Ga0070661_101025439 3300005344 Bacteria 685
28 Ga0070671_100133123 3300005355 Bacteria 2095
29 Ga0070674_100199581 3300005356 Bacteria 1544
30 Ga0070659_100037732 3300005366 Bacteria 3767
31 Ga0070659_100508390 3300005366 Bacteria 1027
32 Ga0070714_100030773 3300005435 Bacteria 4471
33 Ga0070714_100151085 3300005435 Bacteria 2093
34 Ga0070714_100962717 3300005435 Bacteria 830
35 Ga0070714_101093045 3300005435 Unclassified 777
36 Ga0070710_10157156 3300005437 Bacteria 1407
37 Ga0070711_100191571 3300005439 Bacteria 1572
38 Ga0070694_101355981 3300005444 Unclassified 599
39 Ga0070708_101575093 3300005445 Bacteria 612
40 Ga0070663_100110829 3300005455 Bacteria 2062
41 Ga0070678_100440712 3300005456 Bacteria 1139
42 Ga0070678_100566696 3300005456 Bacteria 1010
43 Ga0070681_10001098 3300005458 Bacteria 23129
44 Ga0070681_10007083 3300005458 Bacteria 10917
45 Ga0070681_10054400 3300005458 Bacteria 3988
46 Ga0070681_10087993 3300005458 Bacteria 3058
47 Ga0070681_10092880 3300005458 Bacteria 2966
48 Ga0070681_10126624 3300005458 Bacteria 2487
49 Ga0070681_10272041 3300005458 Bacteria 1605
50 Ga0070698_100870652 3300005471 Bacteria 846
51 Ga0070699_100298943 3300005518 Bacteria 1444
52 Ga0070679_100010724 3300005530 Bacteria 8702
53 Ga0070679_100077982 3300005530 Bacteria 3302
54 Ga0070679_100188596 3300005530 Bacteria 2031
55 Ga0070679_100219104 3300005530 Bacteria 1864
56 Ga0070679_100582227 3300005530 Bacteria 1063
57 Ga0070679_100622282 3300005530 Bacteria 1023
58 Ga0070679_101136677 3300005530 Unclassified 726
59 Ga0070684_100061550 3300005535 Bacteria 3285
60 Ga0070684_100170743 3300005535 Bacteria 1975
61 Ga0070684_100249674 3300005535 Bacteria 1622
62 Ga0070684_100315957 3300005535 Bacteria 1434
63 Ga0070684_100341423 3300005535 Bacteria 1377
64 Ga0070684_100714129 3300005535 Bacteria 935
65 Ga0068853_100086654 3300005539 Bacteria 2747
66 Ga0070696_100694037 3300005546 Bacteria 829
67 Ga0070693_100434386 3300005547 Bacteria 918
68 Ga0070665_100022499 3300005548 Bacteria 6344
69 Ga0068855_100018814 3300005563 Bacteria 8302
70 Ga0068855_100021007 3300005563 Bacteria 7829
71 Ga0068855_100031621 3300005563 Bacteria 6320
72 Ga0068855_100036265 3300005563 Bacteria 5871
73 Ga0068855_100266945 3300005563 Bacteria 1904
74 Ga0068855_100338128 3300005563 Bacteria 1661
75 Ga0068855_100520471 3300005563 Unclassified 1290
76 Ga0068855_100725802 3300005563 Bacteria 1061
77 Ga0070664_100797781 3300005564 Bacteria 883
78 Ga0068857_100036813 3300005577 Bacteria 4335
79 Ga0068857_100120515 3300005577 Bacteria 2361
80 Ga0068856_100042686 3300005614 Bacteria 4461
81 Ga0068852_100068955 3300005616 Bacteria 3097
82 Ga0068852_100169282 3300005616 Bacteria 2046
83 Ga0068852_100174972 3300005616 Bacteria 2015
84 Ga0068852_101058613 3300005616 Unclassified 831
85 Ga0068851_10100235 3300005834 Bacteria 1536
86 Ga0068851_10360275 3300005834 Bacteria 848
87 Ga0068858_100229146 3300005842 Bacteria 1761
88 Ga0081455_10176789 3300005937 Bacteria 1620
89 Ga0070717_10307221 3300006028 Bacteria 1411
90 Ga0070717_10956767 3300006028 Bacteria 780
91 Ga0070715_10226532 3300006163 Bacteria 964
92 Ga0070715_10604986 3300006163 Unclassified 643
93 Ga0070716_100245287 3300006173 Unclassified 1217
94 Ga0070712_100114919 3300006175 Bacteria 2016
95 Ga0070712_100248109 3300006175 Bacteria 1421
96 Ga0070712_101282316 3300006175 Bacteria 638
97 Ga0097621_101703189 3300006237 Bacteria 600
98 Ga0075433_10679016 3300006852 Bacteria 903
99 Ga0075434_100043037 3300006871 Bacteria 4478
100 Ga0075435_100020215 3300007076 Bacteria 5097
101 Ga0105240_10051608 3300009093 Bacteria 5173
102 Ga0105240_10080832 3300009093 Bacteria 3996
103 Ga0105240_10494944 3300009093 Bacteria 1360
104 Ga0105240_10517392 3300009093 Bacteria 1325
105 Ga0105240_10820102 3300009093 Bacteria 1006
106 Ga0105240_11040022 3300009093 Bacteria 874
107 Ga0105245_10422810 3300009098 Unclassified 1336
108 Ga0105245_10712277 3300009098 Bacteria 1038
109 Ga0105245_11187801 3300009098 Unclassified 811
110 Ga0105245_11278844 3300009098 Bacteria 782
111 Ga0105245_12772033 3300009098 Unclassified 543
112 Ga0105247_11684091 3300009101 Bacteria 524
113 Ga0105243_10279295 3300009148 Bacteria 1504
114 Ga0105242_10098278 3300009176 Bacteria 2476
115 Ga0105237_10471004 3300009545 Bacteria 1262
116 Ga0105238_10113296 3300009551 Bacteria 2692
117 Ga0105238_10335188 3300009551 Bacteria 1500
118 Ga0105239_10449855 3300010375 Bacteria 1461
119 Ga0105246_10784105 3300011119 Bacteria 844
120 Ga0157370_10004749 3300013104 Bacteria 15468
121 Ga0157370_10023890 3300013104 Bacteria 6061
122 Ga0157370_10065874 3300013104 Bacteria 3427
123 Ga0157369_10010278 3300013105 Bacteria 10675
124 Ga0157369_10011499 3300013105 Bacteria 10052
125 Ga0157369_10031793 3300013105 Bacteria 5807
126 Ga0157369_10037081 3300013105 Bacteria 5339
127 Ga0157369_10242310 3300013105 Bacteria 1883
128 Ga0157369_10273423 3300013105 Bacteria 1760
129 Ga0157374_11254063 3300013296 Bacteria 763
130 Ga0157378_10295132 3300013297 Bacteria 1567
131 Ga0157372_10043587 3300013307 Bacteria 4968
132 Ga0157372_10110337 3300013307 Bacteria 3151
133 Ga0157372_10342642 3300013307 Bacteria 1741
134 Ga0157372_10742999 3300013307 Bacteria 1141
135 Ga0157375_10138806 3300013308 Bacteria 2556
136 Ga0157376_10330964 3300014969 Bacteria 1451
137 Ga0197907_10143724 3300020069 Bacteria 1587
138 Ga0206356_10070690 3300020070 Bacteria 1321
139 Ga0206356_11219724 3300020070 Bacteria 3958
140 Ga0206354_10074943 3300020081 Bacteria 2148
141 Ga0206354_10709584 3300020081 Bacteria 3323
142 Ga0206354_11065726 3300020081 Bacteria 2713
143 Ga0206353_10208536 3300020082 Bacteria 1729
144 Ga0206353_10410465 3300020082 Bacteria 3328
145 Ga0206353_11102611 3300020082 Bacteria 11098
146 Ga0206353_11784240 3300020082 Bacteria 1104
147 Ga0213871_10215169 3300021441 Unclassified 603
148 Ga0207656_10084993 3300025321 Unclassified 1428
149 Ga0207656_10328524 3300025321 Bacteria 760
150 Ga0207692_10236126 3300025898 Unclassified 1090
151 Ga0207685_10083485 3300025905 Bacteria 1328
152 Ga0207685_10407796 3300025905 Unclassified 698
153 Ga0207699_10407914 3300025906 Bacteria 969
154 Ga0207705_10088982 3300025909 Bacteria 2259
155 Ga0207705_10107406 3300025909 Bacteria 2059
156 Ga0207705_10247760 3300025909 Bacteria 1358
157 Ga0207654_10447896 3300025911 Unclassified 905
158 Ga0207707_10069159 3300025912 Bacteria 3077
159 Ga0207707_10088484 3300025912 Bacteria 2706
160 Ga0207707_10127988 3300025912 Bacteria 2221
161 Ga0207707_10201824 3300025912 Bacteria 1734
162 Ga0207695_10422635 3300025913 Bacteria 1217
163 Ga0207695_10440875 3300025913 Bacteria 1186
164 Ga0207695_10601562 3300025913 Bacteria 981
165 Ga0207695_10686213 3300025913 Bacteria 905
166 Ga0207693_10129929 3300025915 Bacteria 1980
167 Ga0207693_10192178 3300025915 Bacteria 1606
168 Ga0207693_11109307 3300025915 Bacteria 601
169 Ga0207663_10233959 3300025916 Bacteria 1344
170 Ga0207660_10265522 3300025917 Bacteria 1358
171 Ga0207660_10525267 3300025917 Bacteria 961
172 Ga0207657_10000902 3300025919 Bacteria 31364
173 Ga0207657_10001937 3300025919 Bacteria 22358
174 Ga0207657_10004242 3300025919 Bacteria 15190
175 Ga0207657_10146462 3300025919 Bacteria 1926
176 Ga0207657_10171445 3300025919 Bacteria 1758
177 Ga0207649_10164166 3300025920 Bacteria 1541
178 Ga0207649_10186933 3300025920 Bacteria 1454
179 Ga0207649_10302062 3300025920 Bacteria 1170
180 Ga0207652_10043049 3300025921 Bacteria 3844
181 Ga0207652_10146072 3300025921 Bacteria 2117
182 Ga0207652_10236745 3300025921 Bacteria 1645
183 Ga0207652_10243760 3300025921 Bacteria 1620
184 Ga0207652_10269645 3300025921 Bacteria 1535
185 Ga0207652_10329214 3300025921 Bacteria 1379
186 Ga0207652_10616933 3300025921 Unclassified 972
187 Ga0207646_10485615 3300025922 Bacteria 1113
188 Ga0207694_10059417 3300025924 Bacteria 2973
189 Ga0207694_10137179 3300025924 Bacteria 1965
190 Ga0207687_10853401 3300025927 Unclassified 778
191 Ga0207687_11063071 3300025927 Unclassified 695
192 Ga0207700_10042031 3300025928 Bacteria 3348
193 Ga0207700_10762911 3300025928 Bacteria 864
194 Ga0207700_11143423 3300025928 Bacteria 696
195 Ga0207664_10339995 3300025929 Unclassified 1327
196 Ga0207664_10374766 3300025929 Bacteria 1263
197 Ga0207664_10666804 3300025929 Bacteria 935
198 Ga0207644_10390945 3300025931 Bacteria 1135
199 Ga0207690_10018659 3300025932 Bacteria 4255
200 Ga0207690_10061412 3300025932 Bacteria 2555
201 Ga0207690_10263752 3300025932 Bacteria 1335
202 Ga0207669_10328685 3300025937 Unclassified 1173
203 Ga0207704_11252016 3300025938 Bacteria 633
204 Ga0207665_10072326 3300025939 Bacteria 2355
205 Ga0207711_10286254 3300025941 Unclassified 1518
206 Ga0207661_10126001 3300025944 Bacteria 2187
207 Ga0207661_10305999 3300025944 Unclassified 1426
208 Ga0207661_10409606 3300025944 Bacteria 1230
209 Ga0207661_10827326 3300025944 Bacteria 852
210 Ga0207661_10892568 3300025944 Unclassified 819
211 Ga0207661_10922253 3300025944 Unclassified 804
212 Ga0207667_10017232 3300025949 Bacteria 8139
213 Ga0207667_10281076 3300025949 Bacteria 1701
214 Ga0207667_10285244 3300025949 Bacteria 1687
215 Ga0207667_10286785 3300025949 Bacteria 1682
216 Ga0207667_10515050 3300025949 Bacteria 1212
217 Ga0207667_11223033 3300025949 Bacteria 730
218 Ga0207640_10504201 3300025981 Unclassified 1008
219 Ga0207640_10527418 3300025981 Unclassified 988
220 Ga0207658_10006792 3300025986 Bacteria 7793
221 Ga0207677_10087103 3300026023 Bacteria 2260
222 Ga0207677_10761641 3300026023 Bacteria 864
223 Ga0207639_10066923 3300026041 Bacteria 2794
224 Ga0207678_10500900 3300026067 Bacteria 1059
225 Ga0207702_10333090 3300026078 Bacteria 1448
226 Ga0207702_10371403 3300026078 Bacteria 1373
227 Ga0207641_11115442 3300026088 Bacteria 788
228 Ga0207674_10010323 3300026116 Bacteria 10587
229 Ga0207674_11302032 3300026116 Unclassified 696
230 Ga0207683_10126964 3300026121 Bacteria 2292
231 Ga0207698_10431298 3300026142 Bacteria 1267
232 Ga0268266_11029145 3300028379 Bacteria 797
233 Ga0265319_1012491 3300028563 Bacteria 3431
234 Ga0265334_10354364 3300028573 Bacteria 502
235 Ga0265318_10016131 3300028577 Bacteria 3091
236 Ga0265338_10277511 3300028800 Bacteria 1226
237 Ga0265330_10172904 3300031235 Bacteria 916
238 Ga0265320_10307023 3300031240 Bacteria 701
239 Ga0265320_10383483 3300031240 Unclassified 621
240 Ga0265339_10151793 3300031249 Bacteria 1171
241 Ga0265316_10932810 3300031344 Bacteria 606
242 Ga0265313_10142252 3300031595 Bacteria 1031
243 Ga0265314_10385718 3300031711 Bacteria 761
244 Ga0307405_10471353 3300031731 Bacteria 1000
245 Ga0307407_11400811 3300031903 Bacteria 551
246 Ga0307412_10129636 3300031911 Bacteria 1830
247 Ga0307409_100030930 3300031995 Bacteria 3855
248 Ga0307416_100600220 3300032002 Bacteria 1180
249 Ga0307416_101623849 3300032002 Bacteria 752
250 Ga0373944_0017954 3300035089 Bacteria 2015
251 Ga0373936_0024665 3300035113 Bacteria 2349
252 Ga0373936_0041507 3300035113 Bacteria 1846
253 Ga0373945_0001158 3300035116 Bacteria 8000
254 Ga0373945_0315075 3300035116 Bacteria 672
255 Ga0373943_0000172 3300035170 Bacteria 25393
256 Ga0373943_0150558 3300035170 Bacteria 1260
257 Ga0373946_0003452 3300035171 Bacteria 5608
258 Ga0373946_0129012 3300035171 Bacteria 1162
259 Ga0373935_0118050 3300035692 Bacteria 1769
260 Ga0373935_0174339 3300035692 Bacteria 1473
261 Ga0373927_0022446 3300035695 Bacteria 4135
262 Ga0373927_0056139 3300035695 Bacteria 2546
263 Ga0373947_0002521 3300035725 Bacteria 11006
264 Ga0373947_1109220 3300035725 Unclassified 539
265 Ga0373925_0002552 3300037068 Bacteria 14498
266 Ga0373925_0003477 3300037068 Bacteria 12188
267 Ga0373925_0078846 3300037068 Bacteria 2501
268 Ga0395899_0163052 3300037312 Bacteria 1574
269 Ga0395900_0002867 3300037418 Bacteria 18800
270 Ga0395900_0269144 3300037418 Bacteria 1699
271 Ga0395898_0132930 3300037466 Bacteria 2382
272 Ga0395898_0177110 3300037466 Bacteria 2038
273 Ga0395898_0233305 3300037466 Unclassified 1755
274 Ga0395898_0737113 3300037466 Bacteria 927
275 Ga0395898_1551520 3300037466 Unclassified 587
276 Ga0395905_0465821 3300037471 Unclassified 1162
277 Ga0395905_0926675 3300037471 Unclassified 774
278 Ga0395901_0010876 3300038443 Bacteria 9222
279 Ga0395901_0209130 3300038443 Bacteria 2043
280 Ga0395901_0403591 3300038443 Bacteria 1404
281 Ga0395901_0492996 3300038443 Bacteria 1248
282 Ga0395901_0510426 3300038443 Bacteria 1223
283 Ga0395901_1777270 3300038443 Unclassified 566
284 Ga0436365_1174058 3300039437 Bacteria 867
285 Ga0436360_0948298 3300039438 Bacteria 4231
286 Ga0436361_1034858 3300039447 Unclassified 923
287 Ga0439448_0277960 3300042005 Bacteria 593
288 Ga0466969_0026027 3300044656 Bacteria 3003
289 Ga0466966_0007485 3300044684 Bacteria 7234
290 Ga0466966_0046749 3300044684 Bacteria 2762
291 Ga0466966_0305929 3300044684 Bacteria 955
292 Ga0466961_0002730 3300044693 Bacteria 10974
293 Ga0466961_0030303 3300044693 Bacteria 3477
294 Ga0466963_0002477 3300044694 Bacteria 10328
295 Ga0466963_0013825 3300044694 Bacteria 4969
296 Ga0466963_0015115 3300044694 Bacteria 4773
297 Ga0466963_0044315 3300044694 Bacteria 2928
298 Ga0466963_0052721 3300044694 Bacteria 2700
299 Ga0466963_0222323 3300044694 Bacteria 1322
300 Ga0466963_0331849 3300044694 Bacteria 1071
301 Ga0466963_0382206 3300044694 Bacteria 992
302 Ga0466963_0511169 3300044694 Unclassified 848
303 Ga0466964_0003267 3300044706 Bacteria 5900
304 Ga0466964_0118204 3300044706 Bacteria 1191
305 Ga0466964_0180488 3300044706 Bacteria 1001
306 Ga0466971_0000790 3300044719 Bacteria 12772
307 Ga0466971_0033880 3300044719 Bacteria 2288
308 Ga0466968_0068545 3300044735 Bacteria 1540
309 Ga0466957_0003657 3300044842 Bacteria 8484
310 Ga0466957_0149697 3300044842 Bacteria 1508
311 Ga0466957_0162680 3300044842 Bacteria 1450
312 Ga0466957_0800058 3300044842 Bacteria 670
313 Ga0466959_0118398 3300045049 Bacteria 1885
314 Ga0466959_0241600 3300045049 Bacteria 1247
315 Ga0466959_0268040 3300045049 Bacteria 1174
316 Ga0466959_1046495 3300045049 Bacteria 543
317 Ga0451576_0030583 3300045051 Bacteria 5754
318 Ga0466958_0006115 3300045836 Bacteria 6526
319 Ga0466958_0024002 3300045836 Bacteria 3585
320 Ga0466967_0000583 3300045976 Bacteria 18018
321 Ga0466967_0001971 3300045976 Bacteria 12441
322 Ga0466967_0003133 3300045976 Bacteria 10650
323 Ga0466967_0009932 3300045976 Bacteria 7104
324 Ga0466967_0013472 3300045976 Bacteria 6321
325 Ga0466967_0046661 3300045976 Bacteria 3773
326 Ga0466967_0087575 3300045976 Bacteria 2823
327 Ga0466967_0279013 3300045976 Bacteria 1603
328 Ga0466967_0279807 3300045976 Bacteria 1600
329 Ga0466967_0418060 3300045976 Bacteria 1306
330 Ga0466967_0448117 3300045976 Bacteria 1261
331 Ga0466967_0461209 3300045976 Bacteria 1243
332 Ga0466967_0512160 3300045976 Bacteria 1178
333 Ga0466967_0562742 3300045976 Unclassified 1123
334 Ga0466967_0749493 3300045976 Bacteria 968
335 Ga0495592_0272122 3300046454 Bacteria 1111
336 Ga0495603_0117428 3300046455 Bacteria 1551
337 Ga0495629_0001412 3300046459 Bacteria 18944
338 Ga0495629_0423374 3300046459 Bacteria 903
339 Ga0495641_0000472 3300046461 Bacteria 33428
340 Ga0495641_0015504 3300046461 Bacteria 4064
341 Ga0495641_0227887 3300046461 Unclassified 836
342 Ga0495641_0507595 3300046461 Bacteria 550
343 Ga0495651_0123087 3300046462 Bacteria 1903
344 Ga0495653_0339663 3300046463 Bacteria 968
345 Ga0495582_0000188 3300046473 Bacteria 33908
346 Ga0495639_0104208 3300046475 Bacteria 1341
347 Ga0495662_0005553 3300046476 Bacteria 6307
348 Ga0495664_0106232 3300046477 Bacteria 1693
349 Ga0495608_0266476 3300046511 Bacteria 1065
350 Ga0495618_0784751 3300046514 Bacteria 556
351 Ga0495628_0130929 3300046516 Bacteria 1919
352 Ga0495630_0008605 3300046517 Bacteria 7325
353 Ga0495630_0054300 3300046517 Bacteria 3001
354 Ga0495630_0093324 3300046517 Bacteria 2275
355 Ga0495666_0016698 3300046526 Bacteria 3654
356 Ga0495652_0600241 3300046529 Bacteria 751
357 Ga0495665_0001483 3300046531 Bacteria 12571
358 Ga0495665_0095986 3300046531 Bacteria 1557
359 Ga0495665_0350580 3300046531 Bacteria 752
360 Ga0495640_0020688 3300046533 Bacteria 4840
361 Ga0495667_0230538 3300046559 Unclassified 1181
362 Ga0495667_0342926 3300046559 Unclassified 944
363 Ga0495634_0025931 3300046642 Bacteria 4094
364 Ga0495635_0022623 3300046663 Bacteria 4380
365 Ga0495635_0099380 3300046663 Bacteria 1989
366 Ga0495588_0209978 3300046674 Bacteria 1028
367 Ga0495588_0235121 3300046674 Bacteria 967
368 Ga0495657_0128958 3300046675 Bacteria 1586
369 Ga0495658_0000431 3300046683 Bacteria 23437
370 Ga0495658_0022874 3300046683 Bacteria 3311
371 Ga0495613_0009352 3300046689 Bacteria 7270
372 Ga0495613_1006471 3300046689 Bacteria 535
373 Ga0495624_0006161 3300046690 Bacteria 8537
374 Ga0495624_0366002 3300046690 Bacteria 867
375 Ga0495581_0016563 3300047315 Bacteria 4283
376 Ga0495581_0334588 3300047315 Bacteria 884
377 Ga0495604_0628741 3300047317 Unclassified 686
378 Ga0495674_0044639 3300047319 Bacteria 3939
379 Ga0495674_0118066 3300047319 Bacteria 2243
380 Ga0495676_0131836 3300047321 Bacteria 1803
381 Ga0495676_0248313 3300047321 Bacteria 1215
382 Ga0495680_0048878 3300047322 Bacteria 3318
383 Ga0495684_0377602 3300047471 Bacteria 1000
384 Ga0495593_0009451 3300047673 Bacteria 5657
385 Ga0495593_0124661 3300047673 Bacteria 1309
386 Ga0495614_0020848 3300048089 Bacteria 2832
387 Ga0495614_0575388 3300048089 Unclassified 540
388 Ga0496100_0000446 3300048903 Bacteria 19967
389 Ga0496100_0008333 3300048903 Bacteria 5778
390 Ga0496100_0067177 3300048903 Bacteria 2380
391 Ga0496101_0002420 3300048904 Bacteria 11463
392 Ga0496101_0017280 3300048904 Bacteria 4891
393 Ga0496101_0032476 3300048904 Bacteria 3675
394 Ga0496101_0097127 3300048904 Bacteria 2199
395 Ga0496101_0553594 3300048904 Unclassified 909
396 Ga0496102_0016175 3300048905 Bacteria 6517
397 Ga0496102_0021124 3300048905 Bacteria 5755
398 Ga0496102_0144992 3300048905 Bacteria 2228
399 Ga0496102_1169675 3300048905 Bacteria 689
400 Ga0496103_0084619 3300048906 Bacteria 1998
401 Ga0496104_0000610 3300048907 Bacteria 30613
402 Ga0496104_0052441 3300048907 Bacteria 3853
403 Ga0496105_0000258 3300048908 Bacteria 35685
404 Ga0496105_0231035 3300048908 Unclassified 1503
405 Ga0496105_0320611 3300048908 Unclassified 1242
406 Ga0496106_0000449 3300048909 Bacteria 29371
407 Ga0496106_0044270 3300048909 Bacteria 3341
408 Ga0496106_0493661 3300048909 Bacteria 983
409 Ga0496107_0005810 3300048910 Bacteria 8446
410 Ga0496107_0006830 3300048910 Bacteria 7862
411 Ga0496107_0108766 3300048910 Bacteria 2036
412 Ga0496108_0010252 3300048911 Bacteria 7607
413 Ga0496108_0347903 3300048911 Bacteria 1293
414 Ga0496109_0001531 3300048912 Bacteria 19233
415 Ga0496109_0029452 3300048912 Bacteria 4917
416 Ga0496109_0245214 3300048912 Bacteria 1687
417 Ga0496109_0531162 3300048912 Bacteria 1110
418 Ga0496110_0020923 3300048913 Bacteria 5527
419 Ga0496111_0016250 3300048914 Bacteria 5127
420 Ga0496111_0173144 3300048914 Bacteria 1604
421 Ga0496112_0115467 3300048915 Bacteria 2655
422 Ga0496112_0194454 3300048915 Bacteria 1990
423 Ga0496112_0229890 3300048915 Bacteria 1809
424 Ga0496114_0000526 3300048917 Bacteria 28186
425 Ga0496114_0016440 3300048917 Bacteria 5963
426 Ga0496114_0021407 3300048917 Bacteria 5261
427 Ga0496114_0033994 3300048917 Bacteria 4204
428 Ga0496114_0369425 3300048917 Bacteria 1269
429 Ga0496114_0691294 3300048917 Unclassified 895
430 Ga0496114_1703192 3300048917 Bacteria 519
431 Ga0496115_0000671 3300048918 Bacteria 25284
432 Ga0496115_0004179 3300048918 Bacteria 10432
433 Ga0501067_0001412 3300049583 Bacteria 13020
434 Ga0501067_0010473 3300049583 Bacteria 5132
435 Ga0501067_0014957 3300049583 Bacteria 4294
436 Ga0501069_0020453 3300049585 Bacteria 3586
437 Ga0501069_0105012 3300049585 Bacteria 1605
438 Ga0501069_0185129 3300049585 Bacteria 1204
439 Ga0501070_0048000 3300049586 Bacteria 3547
440 Ga0501073_0333149 3300049589 Bacteria 1048
441 Ga0501074_0013310 3300049590 Bacteria 5982
442 Ga0501074_0183031 3300049590 Bacteria 1494
443 Ga0501074_0625004 3300049590 Bacteria 761
444 Ga0501079_0446506 3300049741 Bacteria 1016
445 Ga0501080_0300766 3300049742 Bacteria 1455
446 nmdc:mga0n895_233022_c1 3300050512 Bacteria 1869
447 nmdc:mga0rr50_20643_c1 3300050513 Bacteria 4480
448 Ga0495655_0021545 3300053083 Bacteria 1460
449 Ga0495619_0335444 3300053085 Bacteria 1046
450 Ga0466962_0012196 3300061719 Bacteria 4131
451 Ga0530510_0008860 3300061734 Bacteria 7041
452 Ga0070667_100643929
453 rootH1_10164495
454 Ga0070658_10016246
455 Ga0070658_10103290
456 Ga0070658_10113981
457 Ga0070683_100008892
458 Ga0070683_100093476
459 Ga0070683_100231478
460 Ga0070683_100498249
461 Ga0070683_101269974
462 Ga0070683_101290091
463 Ga0070680_100008814
464 Ga0070680_100948161
465 Ga0070682_100058730
466 Ga0068868_100382643
467 Ga0068868_100841041
468 Ga0070660_100003246
469 Ga0070660_100062251
470 Ga0070660_100367138
471 Ga0070660_101152560
472 Ga0070660_101274142
473 Ga0070661_100068181
474 Ga0070661_100130042
475 Ga0070661_100177151
476 Ga0070661_100285289
477 Ga0070661_100332856
478 Ga0070661_101025439
479 Ga0070671_100133123
480 Ga0070674_100199581
481 Ga0070659_100037732
482 Ga0070659_100508390
483 Ga0070714_100030773
484 Ga0070714_100151085
485 Ga0070714_100962717
486 Ga0070714_101093045
487 Ga0070710_10157156
488 Ga0070711_100191571
489 Ga0070694_101355981
490 Ga0070708_101575093
491 Ga0070663_100110829
492 Ga0070678_100440712
493 Ga0070678_100566696
494 Ga0070681_10001098
495 Ga0070681_10007083
496 Ga0070681_10054400
497 Ga0070681_10087993
498 Ga0070681_10092880
499 Ga0070681_10126624
500 Ga0070681_10272041
501 Ga0070698_100870652
502 Ga0070699_100298943
503 Ga0070679_100010724
504 Ga0070679_100077982
505 Ga0070679_100188596
506 Ga0070679_100219104
507 Ga0070679_100582227
508 Ga0070679_100622282
509 Ga0070679_101136677
510 Ga0070684_100061550
511 Ga0070684_100170743
512 Ga0070684_100249674
513 Ga0070684_100315957
514 Ga0070684_100341423
515 Ga0070684_100714129
516 Ga0068853_100086654
517 Ga0070696_100694037
518 Ga0070693_100434386
519 Ga0070665_100022499
520 Ga0068855_100018814
521 Ga0068855_100021007
522 Ga0068855_100031621
523 Ga0068855_100036265
524 Ga0068855_100266945
525 Ga0068855_100338128
526 Ga0068855_100520471
527 Ga0068855_100725802
528 Ga0070664_100797781
529 Ga0068857_100036813
530 Ga0068857_100120515
531 Ga0068856_100042686
532 Ga0068852_100068955
533 Ga0068852_100169282
534 Ga0068852_100174972
535 Ga0068852_101058613
536 Ga0068851_10100235
537 Ga0068851_10360275
538 Ga0068858_100229146
539 Ga0081455_10176789
540 Ga0070717_10307221
541 Ga0070717_10956767
542 Ga0070715_10226532
543 Ga0070715_10604986
544 Ga0070716_100245287
545 Ga0070712_100114919
546 Ga0070712_100248109
547 Ga0070712_101282316
548 Ga0097621_101703189
549 Ga0075433_10679016
550 Ga0075434_100043037
551 Ga0075435_100020215
552 Ga0105240_10051608
553 Ga0105240_10080832
554 Ga0105240_10494944
555 Ga0105240_10517392
556 Ga0105240_10820102
557 Ga0105240_11040022
558 Ga0105245_10422810
559 Ga0105245_10712277
560 Ga0105245_11187801
561 Ga0105245_11278844
562 Ga0105245_12772033
563 Ga0105247_11684091
564 Ga0105243_10279295
565 Ga0105242_10098278
566 Ga0105237_10471004
567 Ga0105238_10113296
568 Ga0105238_10335188
569 Ga0105239_10449855
570 Ga0105246_10784105
571 Ga0157370_10004749
572 Ga0157370_10023890
573 Ga0157370_10065874
574 Ga0157369_10010278
575 Ga0157369_10011499
576 Ga0157369_10031793
577 Ga0157369_10037081
578 Ga0157369_10242310
579 Ga0157369_10273423
580 Ga0157374_11254063
581 Ga0157378_10295132
582 Ga0157372_10043587
583 Ga0157372_10110337
584 Ga0157372_10342642
585 Ga0157372_10742999
586 Ga0157375_10138806
587 Ga0157376_10330964
588 Ga0197907_10143724
589 Ga0206356_10070690
590 Ga0206356_11219724
591 Ga0206354_10074943
592 Ga0206354_10709584
593 Ga0206354_11065726
594 Ga0206353_10208536
595 Ga0206353_10410465
596 Ga0206353_11102611
597 Ga0206353_11784240
598 Ga0213871_10215169
599 Ga0207656_10084993
600 Ga0207656_10328524
601 Ga0207692_10236126
602 Ga0207685_10083485
603 Ga0207685_10407796
604 Ga0207699_10407914
605 Ga0207705_10088982
606 Ga0207705_10107406
607 Ga0207705_10247760
608 Ga0207654_10447896
609 Ga0207707_10069159
610 Ga0207707_10088484
611 Ga0207707_10127988
612 Ga0207707_10201824
613 Ga0207695_10422635
614 Ga0207695_10440875
615 Ga0207695_10601562
616 Ga0207695_10686213
617 Ga0207693_10129929
618 Ga0207693_10192178
619 Ga0207693_11109307
620 Ga0207663_10233959
621 Ga0207660_10265522
622 Ga0207660_10525267
623 Ga0207657_10000902
624 Ga0207657_10001937
625 Ga0207657_10004242
626 Ga0207657_10146462
627 Ga0207657_10171445
628 Ga0207649_10164166
629 Ga0207649_10186933
630 Ga0207649_10302062
631 Ga0207652_10043049
632 Ga0207652_10146072
633 Ga0207652_10236745
634 Ga0207652_10243760
635 Ga0207652_10269645
636 Ga0207652_10329214
637 Ga0207652_10616933
638 Ga0207646_10485615
639 Ga0207694_10059417
640 Ga0207694_10137179
641 Ga0207687_10853401
642 Ga0207687_11063071
643 Ga0207700_10042031
644 Ga0207700_10762911
645 Ga0207700_11143423
646 Ga0207664_10339995
647 Ga0207664_10374766
648 Ga0207664_10666804
649 Ga0207644_10390945
650 Ga0207690_10018659
651 Ga0207690_10061412
652 Ga0207690_10263752
653 Ga0207669_10328685
654 Ga0207704_11252016
655 Ga0207665_10072326
656 Ga0207711_10286254
657 Ga0207661_10126001
658 Ga0207661_10305999
659 Ga0207661_10409606
660 Ga0207661_10827326
661 Ga0207661_10892568
662 Ga0207661_10922253
663 Ga0207667_10017232
664 Ga0207667_10281076
665 Ga0207667_10285244
666 Ga0207667_10286785
667 Ga0207667_10515050
668 Ga0207667_11223033
669 Ga0207640_10504201
670 Ga0207640_10527418
671 Ga0207658_10006792
672 Ga0207677_10087103
673 Ga0207677_10761641
674 Ga0207639_10066923
675 Ga0207678_10500900
676 Ga0207702_10333090
677 Ga0207702_10371403
678 Ga0207641_11115442
679 Ga0207674_10010323
680 Ga0207674_11302032
681 Ga0207683_10126964
682 Ga0207698_10431298
683 Ga0268266_11029145
684 Ga0265319_1012491
685 Ga0265334_10354364
686 Ga0265318_10016131
687 Ga0265338_10277511
688 Ga0265330_10172904
689 Ga0265320_10307023
690 Ga0265320_10383483
691 Ga0265339_10151793
692 Ga0265316_10932810
693 Ga0265313_10142252
694 Ga0265314_10385718
695 Ga0307405_10471353
696 Ga0307407_11400811
697 Ga0307412_10129636
698 Ga0307409_100030930
699 Ga0307416_100600220
700 Ga0307416_101623849
701 Ga0373944_0017954
702 Ga0373936_0024665
703 Ga0373936_0041507
704 Ga0373945_0001158
705 Ga0373945_0315075
706 Ga0373943_0000172
707 Ga0373943_0150558
708 Ga0373946_0003452
709 Ga0373946_0129012
710 Ga0373935_0118050
711 Ga0373935_0174339
712 Ga0373927_0022446
713 Ga0373927_0056139
714 Ga0373947_0002521
715 Ga0373947_1109220
716 Ga0373925_0002552
717 Ga0373925_0003477
718 Ga0373925_0078846
719 Ga0395899_0163052
720 Ga0395900_0002867
721 Ga0395900_0269144
722 Ga0395898_0132930
723 Ga0395898_0177110
724 Ga0395898_0233305
725 Ga0395898_0737113
726 Ga0395898_1551520
727 Ga0395905_0465821
728 Ga0395905_0926675
729 Ga0395901_0010876
730 Ga0395901_0209130
731 Ga0395901_0403591
732 Ga0395901_0492996
733 Ga0395901_0510426
734 Ga0395901_1777270
735 Ga0436365_1174058
736 Ga0436360_0948298
737 Ga0436361_1034858
738 Ga0439448_0277960
739 Ga0466969_0026027
740 Ga0466966_0007485
741 Ga0466966_0046749
742 Ga0466966_0305929
743 Ga0466961_0002730
744 Ga0466961_0030303
745 Ga0466963_0002477
746 Ga0466963_0013825
747 Ga0466963_0015115
748 Ga0466963_0044315
749 Ga0466963_0052721
750 Ga0466963_0222323
751 Ga0466963_0331849
752 Ga0466963_0382206
753 Ga0466963_0511169
754 Ga0466964_0003267
755 Ga0466964_0118204
756 Ga0466964_0180488
757 Ga0466971_0000790
758 Ga0466971_0033880
759 Ga0466968_0068545
760 Ga0466957_0003657
761 Ga0466957_0149697
762 Ga0466957_0162680
763 Ga0466957_0800058
764 Ga0466959_0118398
765 Ga0466959_0241600
766 Ga0466959_0268040
767 Ga0466959_1046495
768 Ga0451576_0030583
769 Ga0466958_0006115
770 Ga0466958_0024002
771 Ga0466967_0000583
772 Ga0466967_0001971
773 Ga0466967_0003133
774 Ga0466967_0009932
775 Ga0466967_0013472
776 Ga0466967_0046661
777 Ga0466967_0087575
778 Ga0466967_0279013
779 Ga0466967_0279807
780 Ga0466967_0418060
781 Ga0466967_0448117
782 Ga0466967_0461209
783 Ga0466967_0512160
784 Ga0466967_0562742
785 Ga0466967_0749493
786 Ga0495592_0272122
787 Ga0495603_0117428
788 Ga0495629_0001412
789 Ga0495629_0423374
790 Ga0495641_0000472
791 Ga0495641_0015504
792 Ga0495641_0227887
793 Ga0495641_0507595
794 Ga0495651_0123087
795 Ga0495653_0339663
796 Ga0495582_0000188
797 Ga0495639_0104208
798 Ga0495662_0005553
799 Ga0495664_0106232
800 Ga0495608_0266476
801 Ga0495618_0784751
802 Ga0495628_0130929
803 Ga0495630_0008605
804 Ga0495630_0054300
805 Ga0495630_0093324
806 Ga0495666_0016698
807 Ga0495652_0600241
808 Ga0495665_0001483
809 Ga0495665_0095986
810 Ga0495665_0350580
811 Ga0495640_0020688
812 Ga0495667_0230538
813 Ga0495667_0342926
814 Ga0495634_0025931
815 Ga0495635_0022623
816 Ga0495635_0099380
817 Ga0495588_0209978
818 Ga0495588_0235121
819 Ga0495657_0128958
820 Ga0495658_0000431
821 Ga0495658_0022874
822 Ga0495613_0009352
823 Ga0495613_1006471
824 Ga0495624_0006161
825 Ga0495624_0366002
826 Ga0495581_0016563
827 Ga0495581_0334588
828 Ga0495604_0628741
829 Ga0495674_0044639
830 Ga0495674_0118066
831 Ga0495676_0131836
832 Ga0495676_0248313
833 Ga0495680_0048878
834 Ga0495684_0377602
835 Ga0495593_0009451
836 Ga0495593_0124661
837 Ga0495614_0020848
838 Ga0495614_0575388
839 Ga0496100_0000446
840 Ga0496100_0008333
841 Ga0496100_0067177
842 Ga0496101_0002420
843 Ga0496101_0017280
844 Ga0496101_0032476
845 Ga0496101_0097127
846 Ga0496101_0553594
847 Ga0496102_0016175
848 Ga0496102_0021124
849 Ga0496102_0144992
850 Ga0496102_1169675
851 Ga0496103_0084619
852 Ga0496104_0000610
853 Ga0496104_0052441
854 Ga0496105_0000258
855 Ga0496105_0231035
856 Ga0496105_0320611
857 Ga0496106_0000449
858 Ga0496106_0044270
859 Ga0496106_0493661
860 Ga0496107_0005810
861 Ga0496107_0006830
862 Ga0496107_0108766
863 Ga0496108_0010252
864 Ga0496108_0347903
865 Ga0496109_0001531
866 Ga0496109_0029452
867 Ga0496109_0245214
868 Ga0496109_0531162
869 Ga0496110_0020923
870 Ga0496111_0016250
871 Ga0496111_0173144
872 Ga0496112_0115467
873 Ga0496112_0194454
874 Ga0496112_0229890
875 Ga0496114_0000526
876 Ga0496114_0016440
877 Ga0496114_0021407
878 Ga0496114_0033994
879 Ga0496114_0369425
880 Ga0496114_0691294
881 Ga0496114_1703192
882 Ga0496115_0000671
883 Ga0496115_0004179
884 Ga0501067_0001412
885 Ga0501067_0010473
886 Ga0501067_0014957
887 Ga0501069_0020453
888 Ga0501069_0105012
889 Ga0501069_0185129
890 Ga0501070_0048000
891 Ga0501073_0333149
892 Ga0501074_0013310
893 Ga0501074_0183031
894 Ga0501074_0625004
895 Ga0501079_0446506
896 Ga0501080_0300766
897 nmdc:mga0n895_233022_c1
898 nmdc:mga0rr50_20643_c1
899 Ga0495655_0021545
900 Ga0495619_0335444
901 Ga0466962_0012196
902 Ga0530510_0008860

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hn8-assembly1.cif.gz_A crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1182 0.7186 38 118
2ftz-assembly1.cif.gz_A-2 crystal structure of geranyltranstransferase (ec 2.5.1.10) (tm0161) from thermotoga maritima at 1.90 a resolution 0.6971 10 115
2azj-assembly1.cif.gz_B crystal structure for the mutant d81c of sulfolobus solfataricus hexaprenyl pyrophosphate synthase 0.6748 46 132
4jyx-assembly6.cif.gz_C crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.6734 10 123
3aqc-assembly2.cif.gz_C error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.6599 7 128
ID Description Score Start End Superfamily
2azjB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.6748 46 132 1.10.600.10
3aqbC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6495 7 128 1.20.120.1450
1v4eA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.6069 10 148 1.10.600.10
3aqbC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5949 7 128 1.20.120.1450
af_O50410_18_349_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.581 46 149 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A7V9JII3-F1-model_v4 Uncharacterized protein 0.9722 10 153
AF-A0A7W1RVL9-F1-model_v4 Uncharacterized protein 0.9604 7 127
AF-A0A538GED8-F1-model_v4 Uncharacterized protein 0.9596 30 154
AF-A0A7W1RVL9-F1-model_v4 Uncharacterized protein 0.9452 7 127
AF-A0A7V9JII3-F1-model_v4 Uncharacterized protein 0.9341 10 153

Map