F446685

General Info

Members Datasets Scaffolds Average Seq Length
450 212 900 132

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0230644|Ga0501074_0230644_644_1150
Length 158
Sequence MKAEAWIFAACTIFFVLVTPAYWIITDASDHGADWTGTSALTMTTLLALMVTIYLGFHASKMDPRPEDRKDAEIADGAGELGFFPPYSWWPMWTALALGTVVFGVAAALGALALVGWIFEYYRGEHAHRANLLTQATPCRGAPSQGACVVSWVRRPGP

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
109 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
110 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
111 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
114 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
115 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
116 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
117 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
118 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
119 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
120 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
121 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
129 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
132 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
146 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
152 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
178 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
187 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
188 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
192 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
193 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
197 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
198 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
203 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
204 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2643221615 Nocardioides sp. Root224 Isolate Unclassified
210 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
211 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
212 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98
Metatranscriptomes 1.11
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 17.33
Nodule 0
Rhizoplane 4.67
Rhizosphere 74
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0230644 3300049590 Bacteria 1318
2 LJQas_1032884 3300000549 Bacteria 608
3 JGI24743J22301_10041969 3300001991 Bacteria 920
4 JGI25405J52794_10058633 3300003911 Unclassified 831
5 Ga0070658_10216578 3300005327 Bacteria 1618
6 Ga0070658_10256218 3300005327 Bacteria 1485
7 Ga0070658_11176575 3300005327 Bacteria 667
8 Ga0070658_11456420 3300005327 Bacteria 594
9 Ga0070683_100379065 3300005329 Bacteria 1348
10 Ga0070683_100495551 3300005329 Bacteria 1167
11 Ga0070683_100707615 3300005329 Bacteria 965
12 Ga0070683_100710490 3300005329 Bacteria 963
13 Ga0070683_100979189 3300005329 Bacteria 812
14 Ga0070682_100575984 3300005337 Bacteria 885
15 Ga0068868_101206652 3300005338 Bacteria 700
16 Ga0070660_100390321 3300005339 Bacteria 1150
17 Ga0070660_101230644 3300005339 Bacteria 635
18 Ga0070660_101310082 3300005339 Bacteria 615
19 Ga0070687_100787908 3300005343 Bacteria 672
20 Ga0070692_10085180 3300005345 Bacteria 1709
21 Ga0070667_100333886 3300005367 Bacteria 1370
22 Ga0070714_100294012 3300005435 Bacteria 1512
23 Ga0070714_100294598 3300005435 Bacteria 1511
24 Ga0070701_10216628 3300005438 Bacteria 1140
25 Ga0070701_10780934 3300005438 Bacteria 650
26 Ga0070700_100083770 3300005441 Bacteria 2065
27 Ga0070700_100200845 3300005441 Bacteria 1400
28 Ga0070708_100152596 3300005445 Bacteria 2149
29 Ga0070708_100195609 3300005445 Bacteria 1892
30 Ga0070678_100497824 3300005456 Bacteria 1075
31 Ga0070678_100559721 3300005456 Bacteria 1016
32 Ga0070681_11357981 3300005458 Bacteria 634
33 Ga0068867_100764814 3300005459 Bacteria 858
34 Ga0070706_100789723 3300005467 Bacteria 879
35 Ga0070698_100010105 3300005471 Bacteria 10081
36 Ga0070698_101312703 3300005471 Bacteria 674
37 Ga0070699_100470512 3300005518 Bacteria 1140
38 Ga0070684_100660470 3300005535 Bacteria 973
39 Ga0068853_101673136 3300005539 Bacteria 617
40 Ga0068853_101887441 3300005539 Bacteria 579
41 Ga0068853_102172276 3300005539 Bacteria 538
42 Ga0070696_100378833 3300005546 Bacteria 1102
43 Ga0070665_101588925 3300005548 Bacteria 662
44 Ga0068854_101415824 3300005578 Bacteria 629
45 Ga0068856_100106979 3300005614 Bacteria 2792
46 Ga0068856_101174511 3300005614 Bacteria 784
47 Ga0070702_100241173 3300005615 Bacteria 1220
48 Ga0068852_101121979 3300005616 Bacteria 807
49 Ga0068852_101429065 3300005616 Bacteria 714
50 Ga0068864_101188094 3300005618 Bacteria 761
51 Ga0068861_100051254 3300005719 Bacteria 3133
52 Ga0068861_101150559 3300005719 Bacteria 748
53 Ga0068870_10571794 3300005840 Bacteria 764
54 Ga0068870_10846845 3300005840 Bacteria 642
55 Ga0081455_10000249 3300005937 Bacteria 70419
56 Ga0081455_10101409 3300005937 Bacteria 2310
57 Ga0081540_1025997 3300005983 Bacteria 3353
58 Ga0070717_11267427 3300006028 Bacteria 670
59 Ga0075365_10069863 3300006038 Bacteria 2361
60 Ga0075365_10077750 3300006038 Bacteria 2242
61 Ga0075365_10077762 3300006038 Bacteria 2242
62 Ga0075365_10168886 3300006038 Bacteria 1526
63 Ga0075365_10191166 3300006038 Bacteria 1433
64 Ga0075365_10230716 3300006038 Bacteria 1299
65 Ga0075365_10233910 3300006038 Bacteria 1290
66 Ga0075365_10348589 3300006038 Bacteria 1044
67 Ga0075365_10415462 3300006038 Bacteria 950
68 Ga0075365_10532715 3300006038 Bacteria 831
69 Ga0075365_10718694 3300006038 Bacteria 705
70 Ga0075368_10005928 3300006042 Bacteria 4233
71 Ga0075368_10115794 3300006042 Bacteria 1107
72 Ga0075368_10165582 3300006042 Bacteria 928
73 Ga0075368_10276953 3300006042 Bacteria 720
74 Ga0075368_10492181 3300006042 Bacteria 547
75 Ga0075363_100006603 3300006048 Bacteria 5285
76 Ga0075363_100007648 3300006048 Bacteria 4983
77 Ga0075363_100175321 3300006048 Bacteria 1218
78 Ga0075363_100226753 3300006048 Bacteria 1072
79 Ga0075363_100253149 3300006048 Bacteria 1014
80 Ga0075364_10005194 3300006051 Bacteria 7553
81 Ga0075364_10016934 3300006051 Bacteria 4542
82 Ga0075364_10055834 3300006051 Bacteria 2584
83 Ga0075364_10059407 3300006051 Bacteria 2506
84 Ga0075364_10069564 3300006051 Bacteria 2316
85 Ga0075364_10242728 3300006051 Bacteria 1224
86 Ga0075364_10890862 3300006051 Bacteria 606
87 Ga0075364_11087681 3300006051 Bacteria 543
88 Ga0075362_10053493 3300006177 Bacteria 1812
89 Ga0075362_10455614 3300006177 Bacteria 650
90 Ga0075367_10016363 3300006178 Bacteria 4050
91 Ga0075367_10056164 3300006178 Bacteria 2338
92 Ga0075367_10057852 3300006178 Bacteria 2306
93 Ga0075367_10208927 3300006178 Bacteria 1220
94 Ga0075370_10002627 3300006353 Bacteria 8385
95 Ga0075370_10086572 3300006353 Bacteria 1804
96 Ga0075370_10106015 3300006353 Bacteria 1629
97 Ga0075370_10256038 3300006353 Bacteria 1038
98 Ga0068871_101780073 3300006358 Bacteria 585
99 Ga0068865_101032602 3300006881 Bacteria 721
100 Ga0111539_11869799 3300009094 Bacteria 696
101 Ga0111539_12226495 3300009094 Bacteria 636
102 Ga0105245_11767850 3300009098 Bacteria 671
103 Ga0105245_12338600 3300009098 Bacteria 588
104 Ga0105243_10018667 3300009148 Bacteria 5255
105 Ga0105243_10417570 3300009148 Bacteria 1250
106 Ga0105243_12261259 3300009148 Bacteria 581
107 Ga0105241_10291671 3300009174 Bacteria 1397
108 Ga0105241_10514916 3300009174 Bacteria 1069
109 Ga0105242_11491993 3300009176 Bacteria 706
110 Ga0105248_10648484 3300009177 Bacteria 1191
111 Ga0105248_10894454 3300009177 Bacteria 1002
112 Ga0105248_11179295 3300009177 Bacteria 866
113 Ga0105238_10287525 3300009551 Bacteria 1626
114 Ga0105238_10439109 3300009551 Bacteria 1301
115 Ga0105249_10587048 3300009553 Bacteria 1168
116 Ga0105239_10752386 3300010375 Bacteria 1115
117 Ga0105246_10670987 3300011119 Bacteria 905
118 Ga0105246_10892512 3300011119 Bacteria 796
119 Ga0105246_10924176 3300011119 Bacteria 784
120 Ga0105246_10985906 3300011119 Bacteria 762
121 Ga0105246_12490362 3300011119 Bacteria 509
122 Ga0157371_10179745 3300013102 Bacteria 1513
123 Ga0157374_12213663 3300013296 Bacteria 577
124 Ga0163162_11471653 3300013306 Bacteria 775
125 Ga0163162_12019152 3300013306 Bacteria 661
126 Ga0157372_10446333 3300013307 Bacteria 1508
127 Ga0157372_10490641 3300013307 Bacteria 1432
128 Ga0157372_11143809 3300013307 Bacteria 900
129 Ga0157372_11171410 3300013307 Bacteria 888
130 Ga0157372_11575514 3300013307 Bacteria 756
131 Ga0157372_12023277 3300013307 Bacteria 662
132 Ga0157375_10019045 3300013308 Bacteria 6232
133 Ga0157375_10923076 3300013308 Bacteria 1016
134 Ga0163163_10185242 3300014325 Bacteria 2129
135 Ga0163163_10301390 3300014325 Bacteria 1655
136 Ga0163163_12843983 3300014325 Bacteria 540
137 Ga0163163_13239411 3300014325 Bacteria 508
138 Ga0157380_10797197 3300014326 Bacteria 961
139 Ga0157380_10935818 3300014326 Bacteria 895
140 Ga0157380_13066177 3300014326 Bacteria 533
141 Ga0182008_10181667 3300014497 Bacteria 1065
142 Ga0182008_10199171 3300014497 Bacteria 1018
143 Ga0157377_10889260 3300014745 Bacteria 665
144 Ga0157377_11554548 3300014745 Bacteria 528
145 Ga0157376_11056391 3300014969 Bacteria 837
146 Ga0157376_11915586 3300014969 Bacteria 630
147 Ga0206353_10039640 3300020082 Bacteria 2101
148 Ga0206353_10050572 3300020082 Bacteria 511
149 Ga0206353_10788604 3300020082 Bacteria 1722
150 Ga0154015_1532683 3300020610 Bacteria 673
151 Ga0207643_10464768 3300025908 Bacteria 806
152 Ga0207705_10884639 3300025909 Bacteria 692
153 Ga0207684_10924219 3300025910 Bacteria 732
154 Ga0207707_10306339 3300025912 Bacteria 1373
155 Ga0207660_10152561 3300025917 Bacteria 1776
156 Ga0207657_11127077 3300025919 Bacteria 599
157 Ga0207657_11173648 3300025919 Bacteria 584
158 Ga0207652_10137851 3300025921 Bacteria 2180
159 Ga0207694_11128675 3300025924 Bacteria 663
160 Ga0207687_10308777 3300025927 Bacteria 1276
161 Ga0207664_10124986 3300025929 Bacteria 2159
162 Ga0207690_10621835 3300025932 Bacteria 883
163 Ga0207709_10264216 3300025935 Bacteria 1263
164 Ga0207704_10646260 3300025938 Bacteria 871
165 Ga0207711_11307925 3300025941 Bacteria 667
166 Ga0207661_10269243 3300025944 Bacteria 1520
167 Ga0207661_10366926 3300025944 Bacteria 1301
168 Ga0207661_10402002 3300025944 Bacteria 1242
169 Ga0207661_10487049 3300025944 Bacteria 1126
170 Ga0207661_10634087 3300025944 Bacteria 982
171 Ga0207661_11216896 3300025944 Bacteria 693
172 Ga0207640_11383763 3300025981 Bacteria 630
173 Ga0207708_10005591 3300026075 Bacteria 9276
174 Ga0207702_10717692 3300026078 Bacteria 985
175 Ga0207702_10752454 3300026078 Bacteria 962
176 Ga0207675_100117000 3300026118 Bacteria 2519
177 Ga0207675_101764516 3300026118 Bacteria 638
178 Ga0207698_10516481 3300026142 Bacteria 1165
179 Ga0207698_11577509 3300026142 Bacteria 672
180 Ga0207698_11735211 3300026142 Bacteria 640
181 Ga0207698_11944269 3300026142 Bacteria 603
182 Ga0209813_10004738 3300027866 Bacteria 3263
183 Ga0268264_10000843 3300028381 Bacteria 32793
184 Ga0307408_101676037 3300031548 Bacteria 605
185 Ga0307405_10092796 3300031731 Bacteria 2004
186 Ga0307405_10454574 3300031731 Bacteria 1016
187 Ga0307410_10101722 3300031852 Bacteria 2061
188 Ga0307410_10376529 3300031852 Bacteria 1141
189 Ga0307410_10737101 3300031852 Bacteria 833
190 Ga0307407_10194723 3300031903 Bacteria 1354
191 Ga0307412_10237898 3300031911 Bacteria 1407
192 Ga0307412_11432997 3300031911 Bacteria 626
193 Ga0307409_100263175 3300031995 Bacteria 1584
194 Ga0307409_100522156 3300031995 Bacteria 1160
195 Ga0307409_100636072 3300031995 Bacteria 1059
196 Ga0307409_100748304 3300031995 Bacteria 981
197 Ga0307409_101207741 3300031995 Bacteria 780
198 Ga0307416_100472489 3300032002 Bacteria 1312
199 Ga0307416_100931284 3300032002 Bacteria 970
200 Ga0307416_101473642 3300032002 Bacteria 786
201 Ga0307416_101616668 3300032002 Bacteria 753
202 Ga0307414_10180564 3300032004 Bacteria 1697
203 Ga0307411_10063754 3300032005 Bacteria 2464
204 Ga0307415_100988489 3300032126 Bacteria 781
205 Ga0307415_101537982 3300032126 Bacteria 637
206 Ga0395899_0403227 3300037312 Bacteria 904
207 Ga0395900_0236620 3300037418 Bacteria 1834
208 Ga0395900_1019879 3300037418 Bacteria 747
209 Ga0395898_0210744 3300037466 Bacteria 1853
210 Ga0395898_0615540 3300037466 Bacteria 1029
211 Ga0395898_1009214 3300037466 Bacteria 768
212 Ga0395901_0654587 3300038443 Bacteria 1053
213 Ga0395901_1012988 3300038443 Bacteria 806
214 Ga0436363_0895607 3300039450 Bacteria 2648
215 Ga0439438_079074 3300041405 Bacteria 808
216 Ga0439461_0106956 3300041410 Bacteria 687
217 Ga0439465_0036483 3300041413 Bacteria 1579
218 Ga0439465_0235818 3300041413 Bacteria 674
219 Ga0439465_0247122 3300041413 Bacteria 659
220 Ga0451787_332920 3300041441 Bacteria 961
221 Ga0451798_0318357 3300041458 Bacteria 507
222 Ga0451807_1413274 3300041486 Bacteria 595
223 Ga0451807_2598059 3300041486 Bacteria 835
224 Ga0451833_0746942 3300041491 Bacteria 606
225 Ga0451837_1337585 3300041494 Bacteria 1536
226 Ga0451837_1345240 3300041494 Bacteria 908
227 Ga0451839_0866026 3300041496 Bacteria 583
228 Ga0451841_0261740 3300041498 Bacteria 913
229 Ga0451841_0566911 3300041498 Bacteria 611
230 Ga0451849_1063355 3300041505 Bacteria 505
231 Ga0451849_1223979 3300041505 Bacteria 998
232 Ga0451853_1957153 3300041512 Bacteria 992
233 Ga0451853_3455738 3300041512 Bacteria 519
234 Ga0451853_3989273 3300041512 Bacteria 650
235 Ga0439431_0003315 3300041997 Bacteria 3547
236 Ga0439448_0356081 3300042005 Bacteria 522
237 Ga0450906_032685 3300042145 Bacteria 920
238 Ga0439446_0005700 3300042156 Bacteria 3215
239 Ga0439446_0017193 3300042156 Bacteria 2019
240 Ga0439458_0138022 3300042157 Bacteria 649
241 Ga0439434_0102179 3300042435 Bacteria 924
242 Ga0439434_0146254 3300042435 Bacteria 781
243 Ga0466969_0128523 3300044656 Bacteria 1176
244 Ga0466972_0622277 3300044658 Bacteria 511
245 Ga0466965_0038965 3300044683 Bacteria 2335
246 Ga0466965_0058878 3300044683 Bacteria 1916
247 Ga0466965_0254122 3300044683 Bacteria 943
248 Ga0466965_0697216 3300044683 Bacteria 582
249 Ga0466965_0856316 3300044683 Bacteria 528
250 Ga0466966_0009724 3300044684 Bacteria 6369
251 Ga0466966_0026549 3300044684 Bacteria 3781
252 Ga0466966_0611213 3300044684 Bacteria 656
253 Ga0466961_0030924 3300044693 Bacteria 3440
254 Ga0466961_0145086 3300044693 Bacteria 1484
255 Ga0466961_0155642 3300044693 Bacteria 1426
256 Ga0466961_0373429 3300044693 Bacteria 866
257 Ga0466961_0617744 3300044693 Bacteria 651
258 Ga0466963_0043895 3300044694 Bacteria 2941
259 Ga0466963_0081677 3300044694 Bacteria 2190
260 Ga0466963_0087106 3300044694 Bacteria 2123
261 Ga0466963_0130218 3300044694 Bacteria 1737
262 Ga0466963_0607188 3300044694 Bacteria 772
263 Ga0466963_1090170 3300044694 Bacteria 562
264 Ga0466964_0120650 3300044706 Bacteria 1181
265 Ga0466971_0032969 3300044719 Bacteria 2321
266 Ga0466971_0495406 3300044719 Bacteria 603
267 Ga0466968_0177578 3300044735 Bacteria 989
268 Ga0466968_0209444 3300044735 Bacteria 915
269 Ga0466970_0148376 3300044765 Bacteria 1294
270 Ga0466970_0414532 3300044765 Bacteria 769
271 Ga0466957_0025562 3300044842 Bacteria 3500
272 Ga0466957_0038529 3300044842 Bacteria 2880
273 Ga0466957_0049776 3300044842 Bacteria 2548
274 Ga0466957_0217772 3300044842 Bacteria 1260
275 Ga0466957_0306503 3300044842 Bacteria 1068
276 Ga0466957_0683033 3300044842 Unclassified 724
277 Ga0466960_0169365 3300044901 Bacteria 1178
278 Ga0466960_0289960 3300044901 Bacteria 919
279 Ga0466960_0372693 3300044901 Bacteria 818
280 Ga0466960_0443586 3300044901 Bacteria 753
281 Ga0466959_0296129 3300045049 Bacteria 1108
282 Ga0466958_0061938 3300045836 Bacteria 2280
283 Ga0466958_0082300 3300045836 Bacteria 1982
284 Ga0466958_0152762 3300045836 Bacteria 1457
285 Ga0466958_0180569 3300045836 Bacteria 1339
286 Ga0466958_0739319 3300045836 Bacteria 641
287 Ga0466967_0029784 3300045976 Bacteria 4574
288 Ga0466967_0190459 3300045976 Bacteria 1938
289 Ga0466967_0212821 3300045976 Bacteria 1834
290 Ga0466967_0306393 3300045976 Bacteria 1529
291 Ga0466967_0313044 3300045976 Bacteria 1513
292 Ga0466967_0733337 3300045976 Bacteria 979
293 Ga0466967_0863167 3300045976 Bacteria 899
294 Ga0466967_1225760 3300045976 Bacteria 747
295 Ga0466967_1469026 3300045976 Bacteria 679
296 Ga0495603_0311129 3300046455 Bacteria 905
297 Ga0495629_0358735 3300046459 Bacteria 994
298 Ga0495664_0284031 3300046477 Bacteria 1000
299 Ga0495640_0799178 3300046533 Bacteria 562
300 Ga0495658_0378956 3300046683 Bacteria 901
301 Ga0496100_0424286 3300048903 Bacteria 1016
302 Ga0496104_1170356 3300048907 Bacteria 672
303 Ga0496108_0359516 3300048911 Bacteria 1271
304 Ga0496108_0447185 3300048911 Bacteria 1129
305 Ga0496109_0146991 3300048912 Bacteria 2206
306 Ga0496109_0437238 3300048912 Bacteria 1236
307 Ga0496109_0940065 3300048912 Bacteria 802
308 Ga0496110_0127901 3300048913 Bacteria 2293
309 Ga0496110_0398708 3300048913 Bacteria 1254
310 Ga0496110_0935611 3300048913 Bacteria 773
311 Ga0496110_1332021 3300048913 Bacteria 627
312 Ga0496111_0038025 3300048914 Bacteria 3447
313 Ga0496111_0916489 3300048914 Bacteria 631
314 Ga0496114_0184660 3300048917 Bacteria 1822
315 Ga0496114_0233060 3300048917 Bacteria 1618
316 Ga0496114_0426242 3300048917 Bacteria 1175
317 Ga0496115_0577139 3300048918 Bacteria 896
318 Ga0496124_0104171 3300048927 Bacteria 2294
319 Ga0496124_0760525 3300048927 Bacteria 606
320 Ga0501318_025642 3300049534 Bacteria 774
321 Ga0501031_0058218 3300049568 Bacteria 2518
322 Ga0501031_0098665 3300049568 Bacteria 1906
323 Ga0501031_0193024 3300049568 Bacteria 1330
324 Ga0501031_0445011 3300049568 Bacteria 837
325 Ga0501031_0516670 3300049568 Bacteria 770
326 Ga0501031_0612848 3300049568 Bacteria 700
327 Ga0501032_0571878 3300049569 Bacteria 720
328 Ga0501032_1016965 3300049569 Bacteria 520
329 Ga0501033_0525905 3300049570 Bacteria 817
330 Ga0501034_0023454 3300049571 Bacteria 6287
331 Ga0501034_1211004 3300049571 Bacteria 634
332 Ga0501034_1269910 3300049571 Bacteria 614
333 Ga0501036_0132823 3300049572 Bacteria 2101
334 Ga0501036_0832888 3300049572 Bacteria 759
335 Ga0501037_0112447 3300049573 Bacteria 1961
336 Ga0501038_0091803 3300049574 Bacteria 2543
337 Ga0501039_0069003 3300049575 Bacteria 2745
338 Ga0501039_0368360 3300049575 Bacteria 1129
339 Ga0501040_0148376 3300049576 Bacteria 1654
340 Ga0501040_0279781 3300049576 Bacteria 1192
341 Ga0501040_0298756 3300049576 Bacteria 1151
342 Ga0501040_0318865 3300049576 Bacteria 1112
343 Ga0501040_1309730 3300049576 Bacteria 526
344 Ga0501041_0410100 3300049577 Bacteria 859
345 Ga0501042_0197292 3300049578 Bacteria 1452
346 Ga0501042_0596991 3300049578 Bacteria 803
347 Ga0501042_0647120 3300049578 Bacteria 768
348 Ga0501046_0473297 3300049580 Bacteria 899
349 Ga0501046_1130795 3300049580 Bacteria 540
350 Ga0501047_0004414 3300049581 Bacteria 13248
351 Ga0501067_0168532 3300049583 Bacteria 1220
352 Ga0501067_0178133 3300049583 Bacteria 1184
353 Ga0501067_0312451 3300049583 Bacteria 875
354 Ga0501068_0214813 3300049584 Bacteria 1222
355 Ga0501069_0140785 3300049585 Bacteria 1384
356 Ga0501069_0243585 3300049585 Bacteria 1048
357 Ga0501069_0254668 3300049585 Bacteria 1024
358 Ga0501069_0594072 3300049585 Bacteria 664
359 Ga0501070_0053139 3300049586 Bacteria 3361
360 Ga0501070_0108880 3300049586 Bacteria 2289
361 Ga0501070_0256222 3300049586 Bacteria 1431
362 Ga0501070_0472329 3300049586 Bacteria 1009
363 Ga0501071_0183797 3300049587 Bacteria 1567
364 Ga0501071_0300021 3300049587 Bacteria 1218
365 Ga0501071_0415565 3300049587 Bacteria 1028
366 Ga0501071_0747918 3300049587 Bacteria 753
367 Ga0501071_0793132 3300049587 Bacteria 730
368 Ga0501071_0877410 3300049587 Bacteria 692
369 Ga0501072_0101098 3300049588 Bacteria 2291
370 Ga0501073_0272030 3300049589 Bacteria 1169
371 Ga0501073_0320591 3300049589 Bacteria 1070
372 Ga0501075_0757664 3300049591 Bacteria 739
373 Ga0501075_1067566 3300049591 Bacteria 613
374 Ga0501076_0405196 3300049592 Bacteria 1122
375 Ga0501076_1004219 3300049592 Bacteria 687
376 Ga0501076_1325246 3300049592 Bacteria 592
377 Ga0501077_0155996 3300049593 Bacteria 1449
378 Ga0501202_072351 3300049652 Bacteria 797
379 Ga0501202_200655 3300049652 Bacteria 546
380 Ga0501209_070458 3300049656 Bacteria 993
381 Ga0501235_164197 3300049669 Bacteria 583
382 Ga0501079_0541862 3300049741 Bacteria 915
383 Ga0501079_0736816 3300049741 Bacteria 776
384 Ga0501079_1333480 3300049741 Bacteria 565
385 Ga0501080_0222053 3300049742 Bacteria 1729
386 Ga0501080_0781363 3300049742 Bacteria 838
387 Ga0501081_0235084 3300049743 Bacteria 1336
388 Ga0501081_0578969 3300049743 Bacteria 840
389 Ga0501083_0279674 3300049744 Bacteria 1086
390 Ga0501035_0001212 3300049822 Bacteria 26882
391 Ga0501044_0129975 3300049823 Bacteria 2513
392 Ga0501044_1009393 3300049823 Bacteria 704
393 Ga0501045_0459816 3300049824 Bacteria 946
394 Ga0501045_0611897 3300049824 Bacteria 806
395 Ga0501045_0761035 3300049824 Bacteria 714
396 Ga0501212_052478 3300049851 Bacteria 693
397 nmdc:mga03n38_107006_c1 3300050490 Bacteria 1357
398 nmdc:mga03n38_17398_c1 3300050490 Bacteria 2815
399 nmdc:mga03n38_44299_c1 3300050490 Bacteria 1954
400 nmdc:mga03n38_510753_c1 3300050490 Bacteria 675
401 nmdc:mga00v17_11465_c1 3300050491 Bacteria 4871
402 nmdc:mga00v17_48411_c1 3300050491 Bacteria 2577
403 nmdc:mga00v17_61381_c1 3300050491 Bacteria 2311
404 nmdc:mga0yw44_145424_c1 3300050492 Bacteria 1543
405 nmdc:mga0yw44_199586_c1 3300050492 Bacteria 1321
406 nmdc:mga0yw44_207141_c1 3300050492 Bacteria 1297
407 nmdc:mga0yw44_213558_c1 3300050492 Bacteria 1277
408 nmdc:mga0yw44_246770_c1 3300050492 Bacteria 1188
409 nmdc:mga0yw44_47159_c1 3300050492 Bacteria 2592
410 nmdc:mga0yw44_49955_c1 3300050492 Bacteria 2527
411 nmdc:mga0yw44_628375_c1 3300050492 Bacteria 730
412 nmdc:mga0yw44_74273_c1 3300050492 Bacteria 2118
413 nmdc:mga0yw44_782379_c1 3300050492 Bacteria 648
414 nmdc:mga0k408_486850_c1 3300050493 Bacteria 731
415 nmdc:mga06z11_291523_c1 3300050494 Bacteria 968
416 nmdc:mga06z11_306983_c1 3300050494 Bacteria 944
417 nmdc:mga06z11_63487_c1 3300050494 Bacteria 1933
418 nmdc:mga06z11_654936_c1 3300050494 Bacteria 639
419 nmdc:mga04h51_104438_c1 3300050495 Bacteria 1037
420 nmdc:mga04h51_18714_c1 3300050495 Bacteria 2044
421 nmdc:mga04h51_257443_c1 3300050495 Bacteria 701
422 nmdc:mga07m45_10054_c1 3300050496 Bacteria 4927
423 nmdc:mga07m45_221996_c1 3300050496 Bacteria 1099
424 nmdc:mga07m45_711056_c1 3300050496 Bacteria 578
425 nmdc:mga08y16_924154_c1 3300050511 Bacteria 857
426 nmdc:mga0sz30_94842_c1 3300050516 Bacteria 1300
427 Ga0495601_0203578 3300053077 Bacteria 1293
428 Ga0495595_0645532 3300053084 Bacteria 542
429 Ga0500644_0000630 3300053088 Bacteria 13175
430 Ga0500644_0034448 3300053088 Bacteria 1634
431 Ga0500641_0105337 3300053096 Bacteria 1211
432 Ga0500554_223423 3300053102 Bacteria 626
433 Ga0500556_0001238 3300053104 Bacteria 11842
434 Ga0500593_000208 3300053117 Bacteria 24074
435 Ga0500628_107882 3300053129 Bacteria 744
436 Ga0500573_0020973 3300053140 Bacteria 3742
437 Ga0500573_0087497 3300053140 Bacteria 1764
438 Ga0501084_0268297 3300054114 Bacteria 1441
439 Ga0501082_0120243 3300060353 Bacteria 2277
440 Ga0501082_0348882 3300060353 Bacteria 1290
441 Ga0501082_0603170 3300060353 Bacteria 961
442 Ga0466962_0051913 3300061719 Bacteria 1961
443 Ga0466962_0101717 3300061719 Bacteria 1380
444 Ga0466962_0177777 3300061719 Bacteria 1037
445 Ga0466962_0247933 3300061719 Bacteria 875
446 Ga0530510_1047087 3300061734 Bacteria 625
447 2644089677 2643221615 Bacteria 5487866
448 2644319522 2643221657 Bacteria 5490246
449 2984576985 2984576629 Bacteria 4248407
450 2990258732 2990256926 Bacteria 4252839
451 Ga0501074_0230644
452 LJQas_1032884
453 JGI24743J22301_10041969
454 JGI25405J52794_10058633
455 Ga0070658_10216578
456 Ga0070658_10256218
457 Ga0070658_11176575
458 Ga0070658_11456420
459 Ga0070683_100379065
460 Ga0070683_100495551
461 Ga0070683_100707615
462 Ga0070683_100710490
463 Ga0070683_100979189
464 Ga0070682_100575984
465 Ga0068868_101206652
466 Ga0070660_100390321
467 Ga0070660_101230644
468 Ga0070660_101310082
469 Ga0070687_100787908
470 Ga0070692_10085180
471 Ga0070667_100333886
472 Ga0070714_100294012
473 Ga0070714_100294598
474 Ga0070701_10216628
475 Ga0070701_10780934
476 Ga0070700_100083770
477 Ga0070700_100200845
478 Ga0070708_100152596
479 Ga0070708_100195609
480 Ga0070678_100497824
481 Ga0070678_100559721
482 Ga0070681_11357981
483 Ga0068867_100764814
484 Ga0070706_100789723
485 Ga0070698_100010105
486 Ga0070698_101312703
487 Ga0070699_100470512
488 Ga0070684_100660470
489 Ga0068853_101673136
490 Ga0068853_101887441
491 Ga0068853_102172276
492 Ga0070696_100378833
493 Ga0070665_101588925
494 Ga0068854_101415824
495 Ga0068856_100106979
496 Ga0068856_101174511
497 Ga0070702_100241173
498 Ga0068852_101121979
499 Ga0068852_101429065
500 Ga0068864_101188094
501 Ga0068861_100051254
502 Ga0068861_101150559
503 Ga0068870_10571794
504 Ga0068870_10846845
505 Ga0081455_10000249
506 Ga0081455_10101409
507 Ga0081540_1025997
508 Ga0070717_11267427
509 Ga0075365_10069863
510 Ga0075365_10077750
511 Ga0075365_10077762
512 Ga0075365_10168886
513 Ga0075365_10191166
514 Ga0075365_10230716
515 Ga0075365_10233910
516 Ga0075365_10348589
517 Ga0075365_10415462
518 Ga0075365_10532715
519 Ga0075365_10718694
520 Ga0075368_10005928
521 Ga0075368_10115794
522 Ga0075368_10165582
523 Ga0075368_10276953
524 Ga0075368_10492181
525 Ga0075363_100006603
526 Ga0075363_100007648
527 Ga0075363_100175321
528 Ga0075363_100226753
529 Ga0075363_100253149
530 Ga0075364_10005194
531 Ga0075364_10016934
532 Ga0075364_10055834
533 Ga0075364_10059407
534 Ga0075364_10069564
535 Ga0075364_10242728
536 Ga0075364_10890862
537 Ga0075364_11087681
538 Ga0075362_10053493
539 Ga0075362_10455614
540 Ga0075367_10016363
541 Ga0075367_10056164
542 Ga0075367_10057852
543 Ga0075367_10208927
544 Ga0075370_10002627
545 Ga0075370_10086572
546 Ga0075370_10106015
547 Ga0075370_10256038
548 Ga0068871_101780073
549 Ga0068865_101032602
550 Ga0111539_11869799
551 Ga0111539_12226495
552 Ga0105245_11767850
553 Ga0105245_12338600
554 Ga0105243_10018667
555 Ga0105243_10417570
556 Ga0105243_12261259
557 Ga0105241_10291671
558 Ga0105241_10514916
559 Ga0105242_11491993
560 Ga0105248_10648484
561 Ga0105248_10894454
562 Ga0105248_11179295
563 Ga0105238_10287525
564 Ga0105238_10439109
565 Ga0105249_10587048
566 Ga0105239_10752386
567 Ga0105246_10670987
568 Ga0105246_10892512
569 Ga0105246_10924176
570 Ga0105246_10985906
571 Ga0105246_12490362
572 Ga0157371_10179745
573 Ga0157374_12213663
574 Ga0163162_11471653
575 Ga0163162_12019152
576 Ga0157372_10446333
577 Ga0157372_10490641
578 Ga0157372_11143809
579 Ga0157372_11171410
580 Ga0157372_11575514
581 Ga0157372_12023277
582 Ga0157375_10019045
583 Ga0157375_10923076
584 Ga0163163_10185242
585 Ga0163163_10301390
586 Ga0163163_12843983
587 Ga0163163_13239411
588 Ga0157380_10797197
589 Ga0157380_10935818
590 Ga0157380_13066177
591 Ga0182008_10181667
592 Ga0182008_10199171
593 Ga0157377_10889260
594 Ga0157377_11554548
595 Ga0157376_11056391
596 Ga0157376_11915586
597 Ga0206353_10039640
598 Ga0206353_10050572
599 Ga0206353_10788604
600 Ga0154015_1532683
601 Ga0207643_10464768
602 Ga0207705_10884639
603 Ga0207684_10924219
604 Ga0207707_10306339
605 Ga0207660_10152561
606 Ga0207657_11127077
607 Ga0207657_11173648
608 Ga0207652_10137851
609 Ga0207694_11128675
610 Ga0207687_10308777
611 Ga0207664_10124986
612 Ga0207690_10621835
613 Ga0207709_10264216
614 Ga0207704_10646260
615 Ga0207711_11307925
616 Ga0207661_10269243
617 Ga0207661_10366926
618 Ga0207661_10402002
619 Ga0207661_10487049
620 Ga0207661_10634087
621 Ga0207661_11216896
622 Ga0207640_11383763
623 Ga0207708_10005591
624 Ga0207702_10717692
625 Ga0207702_10752454
626 Ga0207675_100117000
627 Ga0207675_101764516
628 Ga0207698_10516481
629 Ga0207698_11577509
630 Ga0207698_11735211
631 Ga0207698_11944269
632 Ga0209813_10004738
633 Ga0268264_10000843
634 Ga0307408_101676037
635 Ga0307405_10092796
636 Ga0307405_10454574
637 Ga0307410_10101722
638 Ga0307410_10376529
639 Ga0307410_10737101
640 Ga0307407_10194723
641 Ga0307412_10237898
642 Ga0307412_11432997
643 Ga0307409_100263175
644 Ga0307409_100522156
645 Ga0307409_100636072
646 Ga0307409_100748304
647 Ga0307409_101207741
648 Ga0307416_100472489
649 Ga0307416_100931284
650 Ga0307416_101473642
651 Ga0307416_101616668
652 Ga0307414_10180564
653 Ga0307411_10063754
654 Ga0307415_100988489
655 Ga0307415_101537982
656 Ga0395899_0403227
657 Ga0395900_0236620
658 Ga0395900_1019879
659 Ga0395898_0210744
660 Ga0395898_0615540
661 Ga0395898_1009214
662 Ga0395901_0654587
663 Ga0395901_1012988
664 Ga0436363_0895607
665 Ga0439438_079074
666 Ga0439461_0106956
667 Ga0439465_0036483
668 Ga0439465_0235818
669 Ga0439465_0247122
670 Ga0451787_332920
671 Ga0451798_0318357
672 Ga0451807_1413274
673 Ga0451807_2598059
674 Ga0451833_0746942
675 Ga0451837_1337585
676 Ga0451837_1345240
677 Ga0451839_0866026
678 Ga0451841_0261740
679 Ga0451841_0566911
680 Ga0451849_1063355
681 Ga0451849_1223979
682 Ga0451853_1957153
683 Ga0451853_3455738
684 Ga0451853_3989273
685 Ga0439431_0003315
686 Ga0439448_0356081
687 Ga0450906_032685
688 Ga0439446_0005700
689 Ga0439446_0017193
690 Ga0439458_0138022
691 Ga0439434_0102179
692 Ga0439434_0146254
693 Ga0466969_0128523
694 Ga0466972_0622277
695 Ga0466965_0038965
696 Ga0466965_0058878
697 Ga0466965_0254122
698 Ga0466965_0697216
699 Ga0466965_0856316
700 Ga0466966_0009724
701 Ga0466966_0026549
702 Ga0466966_0611213
703 Ga0466961_0030924
704 Ga0466961_0145086
705 Ga0466961_0155642
706 Ga0466961_0373429
707 Ga0466961_0617744
708 Ga0466963_0043895
709 Ga0466963_0081677
710 Ga0466963_0087106
711 Ga0466963_0130218
712 Ga0466963_0607188
713 Ga0466963_1090170
714 Ga0466964_0120650
715 Ga0466971_0032969
716 Ga0466971_0495406
717 Ga0466968_0177578
718 Ga0466968_0209444
719 Ga0466970_0148376
720 Ga0466970_0414532
721 Ga0466957_0025562
722 Ga0466957_0038529
723 Ga0466957_0049776
724 Ga0466957_0217772
725 Ga0466957_0306503
726 Ga0466957_0683033
727 Ga0466960_0169365
728 Ga0466960_0289960
729 Ga0466960_0372693
730 Ga0466960_0443586
731 Ga0466959_0296129
732 Ga0466958_0061938
733 Ga0466958_0082300
734 Ga0466958_0152762
735 Ga0466958_0180569
736 Ga0466958_0739319
737 Ga0466967_0029784
738 Ga0466967_0190459
739 Ga0466967_0212821
740 Ga0466967_0306393
741 Ga0466967_0313044
742 Ga0466967_0733337
743 Ga0466967_0863167
744 Ga0466967_1225760
745 Ga0466967_1469026
746 Ga0495603_0311129
747 Ga0495629_0358735
748 Ga0495664_0284031
749 Ga0495640_0799178
750 Ga0495658_0378956
751 Ga0496100_0424286
752 Ga0496104_1170356
753 Ga0496108_0359516
754 Ga0496108_0447185
755 Ga0496109_0146991
756 Ga0496109_0437238
757 Ga0496109_0940065
758 Ga0496110_0127901
759 Ga0496110_0398708
760 Ga0496110_0935611
761 Ga0496110_1332021
762 Ga0496111_0038025
763 Ga0496111_0916489
764 Ga0496114_0184660
765 Ga0496114_0233060
766 Ga0496114_0426242
767 Ga0496115_0577139
768 Ga0496124_0104171
769 Ga0496124_0760525
770 Ga0501318_025642
771 Ga0501031_0058218
772 Ga0501031_0098665
773 Ga0501031_0193024
774 Ga0501031_0445011
775 Ga0501031_0516670
776 Ga0501031_0612848
777 Ga0501032_0571878
778 Ga0501032_1016965
779 Ga0501033_0525905
780 Ga0501034_0023454
781 Ga0501034_1211004
782 Ga0501034_1269910
783 Ga0501036_0132823
784 Ga0501036_0832888
785 Ga0501037_0112447
786 Ga0501038_0091803
787 Ga0501039_0069003
788 Ga0501039_0368360
789 Ga0501040_0148376
790 Ga0501040_0279781
791 Ga0501040_0298756
792 Ga0501040_0318865
793 Ga0501040_1309730
794 Ga0501041_0410100
795 Ga0501042_0197292
796 Ga0501042_0596991
797 Ga0501042_0647120
798 Ga0501046_0473297
799 Ga0501046_1130795
800 Ga0501047_0004414
801 Ga0501067_0168532
802 Ga0501067_0178133
803 Ga0501067_0312451
804 Ga0501068_0214813
805 Ga0501069_0140785
806 Ga0501069_0243585
807 Ga0501069_0254668
808 Ga0501069_0594072
809 Ga0501070_0053139
810 Ga0501070_0108880
811 Ga0501070_0256222
812 Ga0501070_0472329
813 Ga0501071_0183797
814 Ga0501071_0300021
815 Ga0501071_0415565
816 Ga0501071_0747918
817 Ga0501071_0793132
818 Ga0501071_0877410
819 Ga0501072_0101098
820 Ga0501073_0272030
821 Ga0501073_0320591
822 Ga0501075_0757664
823 Ga0501075_1067566
824 Ga0501076_0405196
825 Ga0501076_1004219
826 Ga0501076_1325246
827 Ga0501077_0155996
828 Ga0501202_072351
829 Ga0501202_200655
830 Ga0501209_070458
831 Ga0501235_164197
832 Ga0501079_0541862
833 Ga0501079_0736816
834 Ga0501079_1333480
835 Ga0501080_0222053
836 Ga0501080_0781363
837 Ga0501081_0235084
838 Ga0501081_0578969
839 Ga0501083_0279674
840 Ga0501035_0001212
841 Ga0501044_0129975
842 Ga0501044_1009393
843 Ga0501045_0459816
844 Ga0501045_0611897
845 Ga0501045_0761035
846 Ga0501212_052478
847 nmdc:mga03n38_107006_c1
848 nmdc:mga03n38_17398_c1
849 nmdc:mga03n38_44299_c1
850 nmdc:mga03n38_510753_c1
851 nmdc:mga00v17_11465_c1
852 nmdc:mga00v17_48411_c1
853 nmdc:mga00v17_61381_c1
854 nmdc:mga0yw44_145424_c1
855 nmdc:mga0yw44_199586_c1
856 nmdc:mga0yw44_207141_c1
857 nmdc:mga0yw44_213558_c1
858 nmdc:mga0yw44_246770_c1
859 nmdc:mga0yw44_47159_c1
860 nmdc:mga0yw44_49955_c1
861 nmdc:mga0yw44_628375_c1
862 nmdc:mga0yw44_74273_c1
863 nmdc:mga0yw44_782379_c1
864 nmdc:mga0k408_486850_c1
865 nmdc:mga06z11_291523_c1
866 nmdc:mga06z11_306983_c1
867 nmdc:mga06z11_63487_c1
868 nmdc:mga06z11_654936_c1
869 nmdc:mga04h51_104438_c1
870 nmdc:mga04h51_18714_c1
871 nmdc:mga04h51_257443_c1
872 nmdc:mga07m45_10054_c1
873 nmdc:mga07m45_221996_c1
874 nmdc:mga07m45_711056_c1
875 nmdc:mga08y16_924154_c1
876 nmdc:mga0sz30_94842_c1
877 Ga0495601_0203578
878 Ga0495595_0645532
879 Ga0500644_0000630
880 Ga0500644_0034448
881 Ga0500641_0105337
882 Ga0500554_223423
883 Ga0500556_0001238
884 Ga0500593_000208
885 Ga0500628_107882
886 Ga0500573_0020973
887 Ga0500573_0087497
888 Ga0501084_0268297
889 Ga0501082_0120243
890 Ga0501082_0348882
891 Ga0501082_0603170
892 Ga0466962_0051913
893 Ga0466962_0101717
894 Ga0466962_0177777
895 Ga0466962_0247933
896 Ga0530510_1047087
897 2644089677
898 2644319522
899 2984576985
900 2990258732

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12270

Cyt_c_ox_IV

Cytochrome c oxidase subunit IV

1

127

0.96

Map