F446672

General Info

Members Datasets Scaffolds Average Seq Length
450 289 900 245

Family's Representative Sequence

Representative Sequence 3300048917|Ga0496114_0075499|Ga0496114_0075499_1031_1879
Length 268
Sequence MTVSPRDIGDRDAPDDGAAHTHGSFFGRRKGHKLRIHQADLIENLLPHLAIDIGSPAPPALADLFDVPPDDVRLEIGFGGGEHLIAEARAYPNLGFIGCEPYVNGMAKILTQIEAHNIGNIRLFAGDAAELLAWAPPRSMARIDLIHPDPWPKRRHWKRRFVQDTTVAAMARLLKPGCEFRFVCDIDDYVAWTLTHLMRSPDFLWTAERAADWQQPWDGYTMTRYGRKAEREGRKAAYLVSKDGPRALMVRPAMRSIVRRRRKCASSP

Samples

Sample ID Description Type Environment
1 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
127 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
135 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
136 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
137 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
157 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
158 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
159 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
179 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
196 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
200 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
204 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
205 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
245 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
246 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
253 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
254 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
255 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
256 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
257 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
258 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
259 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
260 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
261 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
262 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
263 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
264 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
265 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
266 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
267 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
268 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
269 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
270 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
271 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
272 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
273 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
275 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
276 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
279 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
280 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
281 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
282 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
283 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
284 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
285 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
286 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
287 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
288 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
289 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 0.22
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.44
Nodule 1.56
Rhizoplane 8.44
Rhizosphere 74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496114_0075499 3300048917 Bacteria 2839
2 JGI25406J46586_10000015 3300003203 Bacteria 91406
3 JGI25406J46586_10004850 3300003203 Bacteria 6253
4 JGI25153J46596_10008408 3300003215 Bacteria 4936
5 Ga0070676_10413625 3300005328 Bacteria 941
6 Ga0070683_100110717 3300005329 Bacteria 2590
7 Ga0070690_100182735 3300005330 Bacteria 1450
8 Ga0070670_100297108 3300005331 Bacteria 1412
9 Ga0070670_100487880 3300005331 Bacteria 1095
10 Ga0068869_100038114 3300005334 Bacteria 3422
11 Ga0068869_100568466 3300005334 Bacteria 954
12 Ga0070680_100020647 3300005336 Bacteria 5229
13 Ga0070680_100268357 3300005336 Bacteria 1445
14 Ga0070680_100332796 3300005336 Bacteria 1290
15 Ga0070680_100448701 3300005336 Bacteria 1101
16 Ga0070682_100353993 3300005337 Bacteria 1096
17 Ga0068868_100110617 3300005338 Bacteria 2232
18 Ga0068868_100579549 3300005338 Bacteria 992
19 Ga0070687_100290767 3300005343 Bacteria 1033
20 Ga0070668_100089734 3300005347 Bacteria 2421
21 Ga0070675_100615280 3300005354 Bacteria 986
22 Ga0070675_100654285 3300005354 Bacteria 955
23 Ga0070673_100127675 3300005364 Bacteria 2129
24 Ga0070659_100135651 3300005366 Bacteria 2001
25 Ga0070659_100168753 3300005366 Bacteria 1792
26 Ga0070667_100031389 3300005367 Bacteria 4430
27 Ga0070709_10097838 3300005434 Bacteria 1949
28 Ga0070714_100148232 3300005435 Bacteria 2112
29 Ga0070713_100105791 3300005436 Bacteria 2445
30 Ga0070710_10040247 3300005437 Bacteria 2576
31 Ga0070711_100112696 3300005439 Bacteria 1999
32 Ga0070711_100623362 3300005439 Bacteria 902
33 Ga0070663_100021711 3300005455 Bacteria 4276
34 Ga0070663_100034451 3300005455 Bacteria 3507
35 Ga0070663_100241233 3300005455 Bacteria 1427
36 Ga0070663_100331545 3300005455 Bacteria 1227
37 Ga0070663_100418391 3300005455 Bacteria 1099
38 Ga0070663_100505047 3300005455 Bacteria 1005
39 Ga0070678_100031245 3300005456 Bacteria 3671
40 Ga0070678_100353856 3300005456 Bacteria 1263
41 Ga0070662_100163431 3300005457 Bacteria 1743
42 Ga0070662_100322139 3300005457 Bacteria 1260
43 Ga0070681_10005165 3300005458 Bacteria 12597
44 Ga0070681_10009102 3300005458 Bacteria 9759
45 Ga0070681_10032182 3300005458 Bacteria 5263
46 Ga0070685_10228705 3300005466 Bacteria 1222
47 Ga0070685_10372518 3300005466 Bacteria 982
48 Ga0070698_100399884 3300005471 Bacteria 1307
49 Ga0070699_100562262 3300005518 Bacteria 1039
50 Ga0070679_100004924 3300005530 Bacteria 12322
51 Ga0070679_100030347 3300005530 Bacteria 5338
52 Ga0070679_100051522 3300005530 Bacteria 4100
53 Ga0070679_100060957 3300005530 Bacteria 3760
54 Ga0070679_100096356 3300005530 Bacteria 2946
55 Ga0070684_100010656 3300005535 Bacteria 7291
56 Ga0070684_100014186 3300005535 Bacteria 6445
57 Ga0070697_100104995 3300005536 Bacteria 2350
58 Ga0068853_100039766 3300005539 Bacteria 4012
59 Ga0068853_100522156 3300005539 Bacteria 1123
60 Ga0070672_100047299 3300005543 Bacteria 3338
61 Ga0070672_100388568 3300005543 Bacteria 1195
62 Ga0070693_100471898 3300005547 Bacteria 885
63 Ga0070665_100026554 3300005548 Bacteria 5830
64 Ga0070665_100062195 3300005548 Bacteria 3743
65 Ga0070665_100106882 3300005548 Bacteria 2800
66 Ga0070665_100273346 3300005548 Bacteria 1691
67 Ga0070665_100405439 3300005548 Bacteria 1371
68 Ga0068855_100006677 3300005563 Bacteria 14009
69 Ga0068855_100183614 3300005563 Bacteria 2364
70 Ga0068855_100205371 3300005563 Bacteria 2216
71 Ga0068855_100411953 3300005563 Bacteria 1479
72 Ga0068857_100104618 3300005577 Bacteria 2541
73 Ga0068856_100048020 3300005614 Bacteria 4206
74 Ga0070702_100351279 3300005615 Bacteria 1038
75 Ga0068852_100114433 3300005616 Bacteria 2458
76 Ga0068864_100039228 3300005618 Bacteria 4047
77 Ga0068864_100357790 3300005618 Bacteria 1379
78 Ga0068866_10367619 3300005718 Bacteria 919
79 Ga0068861_100631977 3300005719 Bacteria 987
80 Ga0068851_10101550 3300005834 Bacteria 1527
81 Ga0068858_100371055 3300005842 Bacteria 1372
82 Ga0068858_100403541 3300005842 Bacteria 1313
83 Ga0068858_100778982 3300005842 Bacteria 933
84 Ga0068860_100636939 3300005843 Bacteria 1073
85 Ga0081455_10026966 3300005937 Bacteria 5272
86 Ga0081455_10039128 3300005937 Bacteria 4194
87 Ga0081455_10054026 3300005937 Bacteria 3427
88 Ga0081540_1001820 3300005983 Bacteria 17900
89 Ga0081540_1004466 3300005983 Bacteria 10651
90 Ga0081540_1009980 3300005983 Bacteria 6470
91 Ga0081540_1010279 3300005983 Bacteria 6350
92 Ga0081540_1026571 3300005983 Bacteria 3301
93 Ga0081539_10000064 3300005985 Bacteria 247020
94 Ga0081539_10001272 3300005985 Bacteria 44446
95 Ga0081539_10008661 3300005985 Bacteria 8764
96 Ga0070717_10002143 3300006028 Bacteria 13844
97 Ga0070717_10039701 3300006028 Bacteria 3830
98 Ga0075365_10348047 3300006038 Bacteria 1044
99 Ga0075363_100192673 3300006048 Bacteria 1163
100 Ga0070716_100411825 3300006173 Bacteria 975
101 Ga0070712_100003603 3300006175 Bacteria 9545
102 Ga0075367_10008330 3300006178 Bacteria 5370
103 Ga0075367_10029556 3300006178 Bacteria 3136
104 Ga0075367_10193077 3300006178 Bacteria 1271
105 Ga0075370_10123257 3300006353 Bacteria 1510
106 Ga0068871_100713222 3300006358 Bacteria 920
107 Ga0068865_100495717 3300006881 Bacteria 1017
108 Ga0105240_10044620 3300009093 Bacteria 5631
109 Ga0105240_10177091 3300009093 Bacteria 2520
110 Ga0105240_10606906 3300009093 Bacteria 1204
111 Ga0105245_10491621 3300009098 Bacteria 1242
112 Ga0105241_10180922 3300009174 Bacteria 1749
113 Ga0105242_10141914 3300009176 Bacteria 2085
114 Ga0105237_10156955 3300009545 Bacteria 2272
115 Ga0105237_10217488 3300009545 Bacteria 1911
116 Ga0105237_10416953 3300009545 Bacteria 1348
117 Ga0105237_10445436 3300009545 Bacteria 1301
118 Ga0105237_10743564 3300009545 Bacteria 987
119 Ga0105238_10019074 3300009551 Bacteria 6987
120 Ga0105239_10038355 3300010375 Bacteria 5250
121 Ga0105239_10111952 3300010375 Bacteria 3026
122 Ga0157370_10033938 3300013104 Bacteria 4972
123 Ga0157369_10048066 3300013105 Bacteria 4631
124 Ga0157369_10052475 3300013105 Bacteria 4411
125 Ga0157378_10027929 3300013297 Bacteria 4975
126 Ga0157378_10383797 3300013297 Bacteria 1380
127 Ga0163162_10035654 3300013306 Bacteria 4956
128 Ga0157372_10192471 3300013307 Bacteria 2362
129 Ga0157372_10618815 3300013307 Bacteria 1262
130 Ga0157375_10014249 3300013308 Bacteria 7086
131 Ga0163163_10003634 3300014325 Bacteria 13115
132 Ga0157377_10167775 3300014745 Bacteria 1370
133 Ga0157379_10057940 3300014968 Bacteria 3462
134 Ga0157379_10156814 3300014968 Bacteria 2054
135 Ga0157376_10006916 3300014969 Bacteria 8039
136 Ga0213876_10130204 3300021384 Bacteria 1337
137 Ga0209758_1003947 3300025297 Bacteria 12884
138 Ga0209758_1012996 3300025297 Bacteria 4592
139 Ga0209758_1040267 3300025297 Bacteria 1765
140 Ga0207656_10008804 3300025321 Bacteria 3732
141 Ga0207642_10038001 3300025899 Bacteria 2079
142 Ga0207642_10302546 3300025899 Bacteria 928
143 Ga0207647_10067033 3300025904 Bacteria 2176
144 Ga0207699_10018668 3300025906 Bacteria 3680
145 Ga0207645_10307245 3300025907 Bacteria 1056
146 Ga0207705_10094355 3300025909 Bacteria 2194
147 Ga0207684_10249669 3300025910 Bacteria 1531
148 Ga0207707_10007093 3300025912 Bacteria 9764
149 Ga0207707_10010782 3300025912 Bacteria 7940
150 Ga0207707_10022687 3300025912 Bacteria 5489
151 Ga0207707_10035119 3300025912 Bacteria 4384
152 Ga0207707_10084130 3300025912 Bacteria 2778
153 Ga0207707_10118136 3300025912 Bacteria 2318
154 Ga0207695_10462291 3300025913 Bacteria 1152
155 Ga0207671_10150226 3300025914 Bacteria 1799
156 Ga0207671_10262225 3300025914 Bacteria 1360
157 Ga0207671_10283675 3300025914 Bacteria 1306
158 Ga0207671_10428025 3300025914 Bacteria 1053
159 Ga0207693_10002499 3300025915 Bacteria 16002
160 Ga0207660_10268613 3300025917 Bacteria 1351
161 Ga0207660_10553002 3300025917 Bacteria 936
162 Ga0207657_10002575 3300025919 Bacteria 19610
163 Ga0207657_10165287 3300025919 Bacteria 1795
164 Ga0207652_10040229 3300025921 Bacteria 3969
165 Ga0207652_10060549 3300025921 Bacteria 3266
166 Ga0207652_10077576 3300025921 Bacteria 2899
167 Ga0207650_10148405 3300025925 Bacteria 1849
168 Ga0207659_10156474 3300025926 Bacteria 1785
169 Ga0207687_10022926 3300025927 Bacteria 4157
170 Ga0207690_10095119 3300025932 Bacteria 2116
171 Ga0207706_10212014 3300025933 Bacteria 1697
172 Ga0207706_10434034 3300025933 Bacteria 1137
173 Ga0207665_10251838 3300025939 Bacteria 1305
174 Ga0207691_10103717 3300025940 Bacteria 2535
175 Ga0207691_10129164 3300025940 Bacteria 2233
176 Ga0207689_10037912 3300025942 Bacteria 3995
177 Ga0207661_10000223 3300025944 Bacteria 36971
178 Ga0207661_10075339 3300025944 Bacteria 2768
179 Ga0207661_10307376 3300025944 Bacteria 1423
180 Ga0207679_10169437 3300025945 Bacteria 1796
181 Ga0207667_10018044 3300025949 Bacteria 7926
182 Ga0207651_10091053 3300025960 Bacteria 2232
183 Ga0207712_10181848 3300025961 Bacteria 1652
184 Ga0207668_10144866 3300025972 Bacteria 1831
185 Ga0207640_10104481 3300025981 Bacteria 1994
186 Ga0207658_10085486 3300025986 Bacteria 2430
187 Ga0207677_10048159 3300026023 Bacteria 2868
188 Ga0207677_10169393 3300026023 Bacteria 1706
189 Ga0207677_10292257 3300026023 Bacteria 1343
190 Ga0207703_10087057 3300026035 Bacteria 2618
191 Ga0207703_10586571 3300026035 Bacteria 1053
192 Ga0207703_10617970 3300026035 Bacteria 1026
193 Ga0207703_10683577 3300026035 Bacteria 975
194 Ga0207639_10297968 3300026041 Bacteria 1424
195 Ga0207678_10015039 3300026067 Bacteria 6809
196 Ga0207678_10027700 3300026067 Bacteria 4946
197 Ga0207678_10041437 3300026067 Bacteria 3993
198 Ga0207678_10050523 3300026067 Bacteria 3592
199 Ga0207678_10119486 3300026067 Bacteria 2249
200 Ga0207678_10242912 3300026067 Bacteria 1542
201 Ga0207708_10317402 3300026075 Bacteria 1271
202 Ga0207702_10040665 3300026078 Bacteria 3897
203 Ga0207648_10111411 3300026089 Bacteria 2403
204 Ga0207648_10688953 3300026089 Bacteria 946
205 Ga0207676_10434156 3300026095 Bacteria 1235
206 Ga0207676_10528164 3300026095 Bacteria 1124
207 Ga0207674_10025390 3300026116 Bacteria 6319
208 Ga0207675_100312921 3300026118 Bacteria 1532
209 Ga0207683_10021159 3300026121 Bacteria 5567
210 Ga0207683_10056164 3300026121 Bacteria 3453
211 Ga0207683_10114515 3300026121 Bacteria 2416
212 Ga0207698_10069662 3300026142 Bacteria 2783
213 Ga0268266_10005359 3300028379 Bacteria 11987
214 Ga0268266_10238806 3300028379 Bacteria 1676
215 Ga0268266_10448566 3300028379 Bacteria 1226
216 Ga0268266_10453368 3300028379 Bacteria 1219
217 Ga0268265_10636460 3300028380 Bacteria 1023
218 Ga0268264_10842057 3300028381 Bacteria 918
219 Ga0265323_10005497 3300028653 Bacteria 5382
220 Ga0265322_10015093 3300028654 Bacteria 2233
221 Ga0265336_10000410 3300028666 Bacteria 26721
222 Ga0307517_10135620 3300028786 Bacteria 1752
223 Ga0265338_10000277 3300028800 Bacteria 93095
224 Ga0265324_10012797 3300029957 Bacteria 3151
225 Ga0307509_10430404 3300031507 Bacteria 1018
226 Ga0307516_10035222 3300031730 Bacteria 5024
227 Ga0307412_10265207 3300031911 Bacteria 1341
228 Ga0307414_10450195 3300032004 Bacteria 1129
229 Ga0307510_10042392 3300033180 Bacteria 4960
230 Ga0307510_10054668 3300033180 Bacteria 4178
231 Ga0373930_0031345 3300034816 Bacteria 1095
232 Ga0373926_0053656 3300035083 Bacteria 1459
233 Ga0373929_0019016 3300035085 Bacteria 1371
234 Ga0373934_0085662 3300035086 Bacteria 1268
235 Ga0373940_0018924 3300035088 Bacteria 1734
236 Ga0373944_0034317 3300035089 Bacteria 1542
237 Ga0373936_0005785 3300035113 Bacteria 4657
238 Ga0373936_0213486 3300035113 Bacteria 854
239 Ga0373946_0194429 3300035171 Bacteria 969
240 Ga0373924_0092002 3300035410 Bacteria 1298
241 Ga0373931_0101539 3300035691 Bacteria 1618
242 Ga0373931_0146394 3300035691 Bacteria 1373
243 Ga0373935_0273558 3300035692 Bacteria 1187
244 Ga0373927_0105723 3300035695 Bacteria 1833
245 Ga0373933_0001712 3300035724 Bacteria 12728
246 Ga0373947_0041096 3300035725 Bacteria 2756
247 Ga0372808_005273 3300036459 Bacteria 1697
248 Ga0373925_0136825 3300037068 Bacteria 1915
249 Ga0373925_0439068 3300037068 Bacteria 1068
250 Ga0395900_0043097 3300037418 Bacteria 4650
251 Ga0395898_0064149 3300037466 Bacteria 3563
252 Ga0395898_0553293 3300037466 Bacteria 1093
253 Ga0395905_0036983 3300037471 Bacteria 4586
254 Ga0395905_0101227 3300037471 Bacteria 2705
255 Ga0395901_0033827 3300038443 Bacteria 5278
256 Ga0395901_1032148 3300038443 Bacteria 796
257 Ga0436365_0625429 3300039437 Bacteria 1399
258 Ga0436365_1395206 3300039437 Bacteria 1138
259 Ga0436363_0187522 3300039450 Bacteria 7155
260 Ga0451798_0485914 3300041458 Bacteria 884
261 Ga0451807_1881488 3300041486 Bacteria 1559
262 Ga0439459_0026874 3300042438 Bacteria 1146
263 Ga0439464_0072740 3300042439 Bacteria 1019
264 Ga0466967_0061036 3300045976 Bacteria 3344
265 Ga0466967_0099371 3300045976 Bacteria 2658
266 Ga0495617_101407 3300046452 Bacteria 935
267 Ga0495592_0098956 3300046454 Bacteria 2081
268 Ga0495603_0004647 3300046455 Bacteria 8207
269 Ga0495603_0020760 3300046455 Bacteria 3977
270 Ga0495603_0091942 3300046455 Bacteria 1773
271 Ga0495603_0215698 3300046455 Bacteria 1107
272 Ga0495629_0101177 3300046459 Bacteria 2011
273 Ga0495629_0137637 3300046459 Bacteria 1700
274 Ga0495641_0047135 3300046461 Bacteria 1979
275 Ga0495641_0111274 3300046461 Bacteria 1222
276 Ga0495580_0046038 3300046472 Bacteria 3097
277 Ga0495580_0411040 3300046472 Bacteria 911
278 Ga0495582_0041158 3300046473 Bacteria 2546
279 Ga0495639_0150508 3300046475 Bacteria 1122
280 Ga0495639_0226569 3300046475 Bacteria 920
281 Ga0495664_0019182 3300046477 Bacteria 3929
282 Ga0495585_0178124 3300046492 Bacteria 1094
283 Ga0495594_0031212 3300046499 Bacteria 2888
284 Ga0495594_0044956 3300046499 Bacteria 2423
285 Ga0495596_0069549 3300046500 Bacteria 1368
286 Ga0495596_0086672 3300046500 Bacteria 1215
287 Ga0495606_0001109 3300046507 Bacteria 38467
288 Ga0495606_0130410 3300046507 Bacteria 1495
289 Ga0495616_0040010 3300046513 Bacteria 2398
290 Ga0495616_0090929 3300046513 Bacteria 1445
291 Ga0495618_0010284 3300046514 Bacteria 5661
292 Ga0495620_0044220 3300046515 Bacteria 1936
293 Ga0495630_0100233 3300046517 Bacteria 2191
294 Ga0495632_0085834 3300046519 Bacteria 1497
295 Ga0495663_0090647 3300046525 Bacteria 996
296 Ga0495652_0094322 3300046529 Bacteria 2441
297 Ga0495652_0517730 3300046529 Bacteria 825
298 Ga0495665_0229976 3300046531 Bacteria 957
299 Ga0495587_0259596 3300046536 Bacteria 976
300 Ga0495598_0011916 3300046537 Bacteria 2119
301 Ga0495598_0015565 3300046537 Bacteria 1923
302 Ga0495621_0088835 3300046539 Bacteria 1162
303 Ga0495645_0024919 3300046543 Bacteria 4341
304 Ga0495622_0104227 3300046557 Bacteria 1299
305 Ga0495667_0116160 3300046559 Bacteria 1729
306 Ga0495656_0001761 3300046615 Bacteria 7104
307 Ga0495656_0089166 3300046615 Bacteria 1407
308 Ga0495656_0147271 3300046615 Bacteria 1134
309 Ga0495668_0064571 3300046616 Bacteria 2015
310 Ga0495668_0114252 3300046616 Bacteria 1476
311 Ga0495634_0023512 3300046642 Bacteria 4330
312 Ga0495611_0158425 3300046648 Bacteria 1057
313 Ga0495625_0340031 3300046660 Bacteria 951
314 Ga0495625_0378052 3300046660 Bacteria 889
315 Ga0495588_0004575 3300046674 Bacteria 6116
316 Ga0495588_0208994 3300046674 Bacteria 1031
317 Ga0495669_0001472 3300046684 Bacteria 9710
318 Ga0495669_0021724 3300046684 Bacteria 2788
319 Ga0495670_0042217 3300046691 Bacteria 2276
320 Ga0495581_0228243 3300047315 Bacteria 1089
321 Ga0495604_0185407 3300047317 Bacteria 1453
322 Ga0495672_0042501 3300047320 Bacteria 2741
323 Ga0495676_0162591 3300047321 Bacteria 1578
324 Ga0495680_0092501 3300047322 Bacteria 2265
325 Ga0495677_0065387 3300047445 Bacteria 1352
326 Ga0495685_034835 3300047447 Bacteria 1730
327 Ga0495684_0028721 3300047471 Bacteria 4270
328 Ga0495686_0102956 3300047472 Bacteria 1720
329 Ga0495593_0109720 3300047673 Bacteria 1409
330 Ga0496100_0003396 3300048903 Bacteria 8298
331 Ga0496100_0049420 3300048903 Bacteria 2720
332 Ga0496101_0017416 3300048904 Bacteria 4873
333 Ga0496101_0337119 3300048904 Bacteria 1184
334 Ga0496102_0005210 3300048905 Bacteria 11036
335 Ga0496102_0106344 3300048905 Bacteria 2611
336 Ga0496102_0195532 3300048905 Bacteria 1906
337 Ga0496103_0037232 3300048906 Bacteria 2980
338 Ga0496103_0064019 3300048906 Bacteria 2291
339 Ga0496104_0095717 3300048907 Bacteria 2840
340 Ga0496104_0239262 3300048907 Bacteria 1727
341 Ga0496105_0068647 3300048908 Bacteria 2928
342 Ga0496106_0003998 3300048909 Bacteria 11019
343 Ga0496106_0033825 3300048909 Bacteria 3816
344 Ga0496107_0004390 3300048910 Bacteria 9552
345 Ga0496107_0040473 3300048910 Bacteria 3345
346 Ga0496107_0175264 3300048910 Bacteria 1592
347 Ga0496108_0029256 3300048911 Bacteria 4560
348 Ga0496108_0040900 3300048911 Bacteria 3867
349 Ga0496109_0003994 3300048912 Bacteria 12319
350 Ga0496109_0066272 3300048912 Bacteria 3306
351 Ga0496109_0319098 3300048912 Bacteria 1466
352 Ga0496110_0012419 3300048913 Bacteria 7003
353 Ga0496111_0033798 3300048914 Bacteria 3648
354 Ga0496111_0161199 3300048914 Bacteria 1665
355 Ga0496112_0000015 3300048915 Bacteria 206423
356 Ga0496112_0005462 3300048915 Bacteria 11002
357 Ga0496112_0226318 3300048915 Bacteria 1825
358 Ga0496112_0323010 3300048915 Bacteria 1488
359 Ga0496113_0014665 3300048916 Bacteria 5356
360 Ga0496113_0021944 3300048916 Bacteria 4509
361 Ga0496114_0108562 3300048917 Bacteria 2375
362 Ga0496115_0001535 3300048918 Bacteria 16565
363 Ga0496115_0015495 3300048918 Bacteria 5784
364 Ga0496115_0064547 3300048918 Bacteria 2956
365 Ga0496121_0000865 3300048924 Bacteria 54663
366 Ga0496121_0138177 3300048924 Bacteria 1812
367 Ga0496125_0184185 3300048928 Bacteria 1387
368 Ga0496126_0009641 3300048929 Bacteria 10232
369 Ga0496126_0016935 3300048929 Bacteria 7273
370 Ga0496126_0022424 3300048929 Bacteria 6146
371 Ga0496126_0026545 3300048929 Bacteria 5550
372 Ga0496126_0077490 3300048929 Bacteria 2947
373 Ga0496126_0100257 3300048929 Bacteria 2535
374 Ga0496126_0255645 3300048929 Bacteria 1458
375 Ga0496126_0608072 3300048929 Bacteria 860
376 Ga0495678_133390 3300049459 Bacteria 821
377 Ga0501031_0141718 3300049568 Bacteria 1571
378 Ga0501038_0131078 3300049574 Bacteria 2058
379 Ga0501039_0264591 3300049575 Bacteria 1351
380 Ga0501039_0279146 3300049575 Bacteria 1313
381 Ga0501043_0153953 3300049579 Bacteria 1798
382 Ga0501046_0066214 3300049580 Bacteria 2816
383 Ga0501046_0179610 3300049580 Bacteria 1583
384 Ga0501047_0121952 3300049581 Bacteria 2488
385 Ga0501048_0072399 3300049582 Bacteria 2433
386 Ga0501067_0236043 3300049583 Bacteria 1017
387 Ga0501068_0402604 3300049584 Bacteria 882
388 Ga0501070_0081568 3300049586 Bacteria 2676
389 Ga0501070_0117323 3300049586 Bacteria 2198
390 Ga0501073_0210720 3300049589 Bacteria 1343
391 Ga0501076_0057170 3300049592 Bacteria 3097
392 Ga0501080_0003367 3300049742 Bacteria 14112
393 Ga0501035_0159872 3300049822 Bacteria 1951
394 Ga0501044_0057310 3300049823 Bacteria 3998
395 Ga0501044_0168977 3300049823 Bacteria 2159
396 Ga0501045_0403087 3300049824 Bacteria 1018
397 nmdc:mga03683_202586_c1 3300050489 Bacteria 911
398 nmdc:mga03n38_66555_c1 3300050490 Bacteria 1655
399 nmdc:mga0k408_193020_c1 3300050493 Bacteria 1215
400 nmdc:mga06z11_208451_c1 3300050494 Bacteria 1138
401 nmdc:mga06z11_31152_c1 3300050494 Bacteria 2588
402 nmdc:mga04h51_89094_c1 3300050495 Bacteria 1107
403 nmdc:mga07m45_44718_c1 3300050496 Bacteria 2485
404 nmdc:mga05p37_451453_c1 3300050507 Bacteria 1488
405 nmdc:mga08x19_117458_c1 3300050514 Bacteria 1779
406 Ga0495601_0035765 3300053077 Bacteria 3101
407 Ga0495612_0005033 3300053078 Bacteria 5474
408 Ga0495612_0085791 3300053078 Bacteria 1327
409 Ga0500610_0071730 3300053079 Bacteria 1806
410 Ga0500643_017766 3300053087 Bacteria 2375
411 Ga0500643_017902 3300053087 Bacteria 2362
412 Ga0500647_0011078 3300053091 Bacteria 4013
413 Ga0500583_0106575 3300053092 Bacteria 1377
414 Ga0500651_0300902 3300053093 Bacteria 920
415 Ga0500566_0000054 3300053094 Bacteria 54975
416 Ga0500640_096908 3300053095 Bacteria 1225
417 Ga0500641_0022394 3300053096 Bacteria 2419
418 Ga0500650_0081985 3300053098 Bacteria 1509
419 Ga0500554_010812 3300053102 Bacteria 2239
420 Ga0500572_002108 3300053111 Bacteria 4923
421 Ga0500591_065436 3300053115 Bacteria 1663
422 Ga0500593_105835 3300053117 Bacteria 1165
423 Ga0500595_000122 3300053119 Bacteria 51231
424 Ga0500595_021675 3300053119 Bacteria 2289
425 Ga0500608_092389 3300053122 Bacteria 1412
426 Ga0500568_0025018 3300053139 Bacteria 2523
427 Ga0500590_107957 3300053148 Bacteria 1326
428 Ga0500603_003425 3300053150 Bacteria 3403
429 Ga0500634_0059763 3300053161 Bacteria 2026
430 Ga0500638_003346 3300053162 Bacteria 5918
431 Ga0500639_011185 3300053163 Bacteria 4705
432 Ga0500637_0016773 3300053178 Bacteria 3911
433 Ga0500637_0017008 3300053178 Bacteria 3887
434 Ga0500637_0293958 3300053178 Bacteria 888
435 Ga0500645_047566 3300053730 Bacteria 1257
436 Ga0500609_010259 3300053731 Bacteria 1262
437 Ga0500596_003497 3300053735 Bacteria 2976
438 Ga0501084_0156682 3300054114 Bacteria 1921
439 Ga0500661_009098 3300055283 Bacteria 1823
440 2513623266 2513237092 Bacteria 8341956
441 2513694227 2513237101 Bacteria 7952346
442 2874608236 2874604998 Bacteria 7834745
443 2876811312 2876808645 Bacteria 8824342
444 2879113002 2879110137 Bacteria 8907982
445 2889035682 2889033259 Bacteria 9099371
446 2922364161 2922361189 Bacteria 7436256
447 8006932854 8006926726 Bacteria 6749210
448 8006990752 8006984368 Bacteria 9651211
449 8006996764 8006994254 Bacteria 8309700
450 8056675560 8056673599 Bacteria 7871253
451 Ga0496114_0075499
452 JGI25406J46586_10000015
453 JGI25406J46586_10004850
454 JGI25153J46596_10008408
455 Ga0070676_10413625
456 Ga0070683_100110717
457 Ga0070690_100182735
458 Ga0070670_100297108
459 Ga0070670_100487880
460 Ga0068869_100038114
461 Ga0068869_100568466
462 Ga0070680_100020647
463 Ga0070680_100268357
464 Ga0070680_100332796
465 Ga0070680_100448701
466 Ga0070682_100353993
467 Ga0068868_100110617
468 Ga0068868_100579549
469 Ga0070687_100290767
470 Ga0070668_100089734
471 Ga0070675_100615280
472 Ga0070675_100654285
473 Ga0070673_100127675
474 Ga0070659_100135651
475 Ga0070659_100168753
476 Ga0070667_100031389
477 Ga0070709_10097838
478 Ga0070714_100148232
479 Ga0070713_100105791
480 Ga0070710_10040247
481 Ga0070711_100112696
482 Ga0070711_100623362
483 Ga0070663_100021711
484 Ga0070663_100034451
485 Ga0070663_100241233
486 Ga0070663_100331545
487 Ga0070663_100418391
488 Ga0070663_100505047
489 Ga0070678_100031245
490 Ga0070678_100353856
491 Ga0070662_100163431
492 Ga0070662_100322139
493 Ga0070681_10005165
494 Ga0070681_10009102
495 Ga0070681_10032182
496 Ga0070685_10228705
497 Ga0070685_10372518
498 Ga0070698_100399884
499 Ga0070699_100562262
500 Ga0070679_100004924
501 Ga0070679_100030347
502 Ga0070679_100051522
503 Ga0070679_100060957
504 Ga0070679_100096356
505 Ga0070684_100010656
506 Ga0070684_100014186
507 Ga0070697_100104995
508 Ga0068853_100039766
509 Ga0068853_100522156
510 Ga0070672_100047299
511 Ga0070672_100388568
512 Ga0070693_100471898
513 Ga0070665_100026554
514 Ga0070665_100062195
515 Ga0070665_100106882
516 Ga0070665_100273346
517 Ga0070665_100405439
518 Ga0068855_100006677
519 Ga0068855_100183614
520 Ga0068855_100205371
521 Ga0068855_100411953
522 Ga0068857_100104618
523 Ga0068856_100048020
524 Ga0070702_100351279
525 Ga0068852_100114433
526 Ga0068864_100039228
527 Ga0068864_100357790
528 Ga0068866_10367619
529 Ga0068861_100631977
530 Ga0068851_10101550
531 Ga0068858_100371055
532 Ga0068858_100403541
533 Ga0068858_100778982
534 Ga0068860_100636939
535 Ga0081455_10026966
536 Ga0081455_10039128
537 Ga0081455_10054026
538 Ga0081540_1001820
539 Ga0081540_1004466
540 Ga0081540_1009980
541 Ga0081540_1010279
542 Ga0081540_1026571
543 Ga0081539_10000064
544 Ga0081539_10001272
545 Ga0081539_10008661
546 Ga0070717_10002143
547 Ga0070717_10039701
548 Ga0075365_10348047
549 Ga0075363_100192673
550 Ga0070716_100411825
551 Ga0070712_100003603
552 Ga0075367_10008330
553 Ga0075367_10029556
554 Ga0075367_10193077
555 Ga0075370_10123257
556 Ga0068871_100713222
557 Ga0068865_100495717
558 Ga0105240_10044620
559 Ga0105240_10177091
560 Ga0105240_10606906
561 Ga0105245_10491621
562 Ga0105241_10180922
563 Ga0105242_10141914
564 Ga0105237_10156955
565 Ga0105237_10217488
566 Ga0105237_10416953
567 Ga0105237_10445436
568 Ga0105237_10743564
569 Ga0105238_10019074
570 Ga0105239_10038355
571 Ga0105239_10111952
572 Ga0157370_10033938
573 Ga0157369_10048066
574 Ga0157369_10052475
575 Ga0157378_10027929
576 Ga0157378_10383797
577 Ga0163162_10035654
578 Ga0157372_10192471
579 Ga0157372_10618815
580 Ga0157375_10014249
581 Ga0163163_10003634
582 Ga0157377_10167775
583 Ga0157379_10057940
584 Ga0157379_10156814
585 Ga0157376_10006916
586 Ga0213876_10130204
587 Ga0209758_1003947
588 Ga0209758_1012996
589 Ga0209758_1040267
590 Ga0207656_10008804
591 Ga0207642_10038001
592 Ga0207642_10302546
593 Ga0207647_10067033
594 Ga0207699_10018668
595 Ga0207645_10307245
596 Ga0207705_10094355
597 Ga0207684_10249669
598 Ga0207707_10007093
599 Ga0207707_10010782
600 Ga0207707_10022687
601 Ga0207707_10035119
602 Ga0207707_10084130
603 Ga0207707_10118136
604 Ga0207695_10462291
605 Ga0207671_10150226
606 Ga0207671_10262225
607 Ga0207671_10283675
608 Ga0207671_10428025
609 Ga0207693_10002499
610 Ga0207660_10268613
611 Ga0207660_10553002
612 Ga0207657_10002575
613 Ga0207657_10165287
614 Ga0207652_10040229
615 Ga0207652_10060549
616 Ga0207652_10077576
617 Ga0207650_10148405
618 Ga0207659_10156474
619 Ga0207687_10022926
620 Ga0207690_10095119
621 Ga0207706_10212014
622 Ga0207706_10434034
623 Ga0207665_10251838
624 Ga0207691_10103717
625 Ga0207691_10129164
626 Ga0207689_10037912
627 Ga0207661_10000223
628 Ga0207661_10075339
629 Ga0207661_10307376
630 Ga0207679_10169437
631 Ga0207667_10018044
632 Ga0207651_10091053
633 Ga0207712_10181848
634 Ga0207668_10144866
635 Ga0207640_10104481
636 Ga0207658_10085486
637 Ga0207677_10048159
638 Ga0207677_10169393
639 Ga0207677_10292257
640 Ga0207703_10087057
641 Ga0207703_10586571
642 Ga0207703_10617970
643 Ga0207703_10683577
644 Ga0207639_10297968
645 Ga0207678_10015039
646 Ga0207678_10027700
647 Ga0207678_10041437
648 Ga0207678_10050523
649 Ga0207678_10119486
650 Ga0207678_10242912
651 Ga0207708_10317402
652 Ga0207702_10040665
653 Ga0207648_10111411
654 Ga0207648_10688953
655 Ga0207676_10434156
656 Ga0207676_10528164
657 Ga0207674_10025390
658 Ga0207675_100312921
659 Ga0207683_10021159
660 Ga0207683_10056164
661 Ga0207683_10114515
662 Ga0207698_10069662
663 Ga0268266_10005359
664 Ga0268266_10238806
665 Ga0268266_10448566
666 Ga0268266_10453368
667 Ga0268265_10636460
668 Ga0268264_10842057
669 Ga0265323_10005497
670 Ga0265322_10015093
671 Ga0265336_10000410
672 Ga0307517_10135620
673 Ga0265338_10000277
674 Ga0265324_10012797
675 Ga0307509_10430404
676 Ga0307516_10035222
677 Ga0307412_10265207
678 Ga0307414_10450195
679 Ga0307510_10042392
680 Ga0307510_10054668
681 Ga0373930_0031345
682 Ga0373926_0053656
683 Ga0373929_0019016
684 Ga0373934_0085662
685 Ga0373940_0018924
686 Ga0373944_0034317
687 Ga0373936_0005785
688 Ga0373936_0213486
689 Ga0373946_0194429
690 Ga0373924_0092002
691 Ga0373931_0101539
692 Ga0373931_0146394
693 Ga0373935_0273558
694 Ga0373927_0105723
695 Ga0373933_0001712
696 Ga0373947_0041096
697 Ga0372808_005273
698 Ga0373925_0136825
699 Ga0373925_0439068
700 Ga0395900_0043097
701 Ga0395898_0064149
702 Ga0395898_0553293
703 Ga0395905_0036983
704 Ga0395905_0101227
705 Ga0395901_0033827
706 Ga0395901_1032148
707 Ga0436365_0625429
708 Ga0436365_1395206
709 Ga0436363_0187522
710 Ga0451798_0485914
711 Ga0451807_1881488
712 Ga0439459_0026874
713 Ga0439464_0072740
714 Ga0466967_0061036
715 Ga0466967_0099371
716 Ga0495617_101407
717 Ga0495592_0098956
718 Ga0495603_0004647
719 Ga0495603_0020760
720 Ga0495603_0091942
721 Ga0495603_0215698
722 Ga0495629_0101177
723 Ga0495629_0137637
724 Ga0495641_0047135
725 Ga0495641_0111274
726 Ga0495580_0046038
727 Ga0495580_0411040
728 Ga0495582_0041158
729 Ga0495639_0150508
730 Ga0495639_0226569
731 Ga0495664_0019182
732 Ga0495585_0178124
733 Ga0495594_0031212
734 Ga0495594_0044956
735 Ga0495596_0069549
736 Ga0495596_0086672
737 Ga0495606_0001109
738 Ga0495606_0130410
739 Ga0495616_0040010
740 Ga0495616_0090929
741 Ga0495618_0010284
742 Ga0495620_0044220
743 Ga0495630_0100233
744 Ga0495632_0085834
745 Ga0495663_0090647
746 Ga0495652_0094322
747 Ga0495652_0517730
748 Ga0495665_0229976
749 Ga0495587_0259596
750 Ga0495598_0011916
751 Ga0495598_0015565
752 Ga0495621_0088835
753 Ga0495645_0024919
754 Ga0495622_0104227
755 Ga0495667_0116160
756 Ga0495656_0001761
757 Ga0495656_0089166
758 Ga0495656_0147271
759 Ga0495668_0064571
760 Ga0495668_0114252
761 Ga0495634_0023512
762 Ga0495611_0158425
763 Ga0495625_0340031
764 Ga0495625_0378052
765 Ga0495588_0004575
766 Ga0495588_0208994
767 Ga0495669_0001472
768 Ga0495669_0021724
769 Ga0495670_0042217
770 Ga0495581_0228243
771 Ga0495604_0185407
772 Ga0495672_0042501
773 Ga0495676_0162591
774 Ga0495680_0092501
775 Ga0495677_0065387
776 Ga0495685_034835
777 Ga0495684_0028721
778 Ga0495686_0102956
779 Ga0495593_0109720
780 Ga0496100_0003396
781 Ga0496100_0049420
782 Ga0496101_0017416
783 Ga0496101_0337119
784 Ga0496102_0005210
785 Ga0496102_0106344
786 Ga0496102_0195532
787 Ga0496103_0037232
788 Ga0496103_0064019
789 Ga0496104_0095717
790 Ga0496104_0239262
791 Ga0496105_0068647
792 Ga0496106_0003998
793 Ga0496106_0033825
794 Ga0496107_0004390
795 Ga0496107_0040473
796 Ga0496107_0175264
797 Ga0496108_0029256
798 Ga0496108_0040900
799 Ga0496109_0003994
800 Ga0496109_0066272
801 Ga0496109_0319098
802 Ga0496110_0012419
803 Ga0496111_0033798
804 Ga0496111_0161199
805 Ga0496112_0000015
806 Ga0496112_0005462
807 Ga0496112_0226318
808 Ga0496112_0323010
809 Ga0496113_0014665
810 Ga0496113_0021944
811 Ga0496114_0108562
812 Ga0496115_0001535
813 Ga0496115_0015495
814 Ga0496115_0064547
815 Ga0496121_0000865
816 Ga0496121_0138177
817 Ga0496125_0184185
818 Ga0496126_0009641
819 Ga0496126_0016935
820 Ga0496126_0022424
821 Ga0496126_0026545
822 Ga0496126_0077490
823 Ga0496126_0100257
824 Ga0496126_0255645
825 Ga0496126_0608072
826 Ga0495678_133390
827 Ga0501031_0141718
828 Ga0501038_0131078
829 Ga0501039_0264591
830 Ga0501039_0279146
831 Ga0501043_0153953
832 Ga0501046_0066214
833 Ga0501046_0179610
834 Ga0501047_0121952
835 Ga0501048_0072399
836 Ga0501067_0236043
837 Ga0501068_0402604
838 Ga0501070_0081568
839 Ga0501070_0117323
840 Ga0501073_0210720
841 Ga0501076_0057170
842 Ga0501080_0003367
843 Ga0501035_0159872
844 Ga0501044_0057310
845 Ga0501044_0168977
846 Ga0501045_0403087
847 nmdc:mga03683_202586_c1
848 nmdc:mga03n38_66555_c1
849 nmdc:mga0k408_193020_c1
850 nmdc:mga06z11_208451_c1
851 nmdc:mga06z11_31152_c1
852 nmdc:mga04h51_89094_c1
853 nmdc:mga07m45_44718_c1
854 nmdc:mga05p37_451453_c1
855 nmdc:mga08x19_117458_c1
856 Ga0495601_0035765
857 Ga0495612_0005033
858 Ga0495612_0085791
859 Ga0500610_0071730
860 Ga0500643_017766
861 Ga0500643_017902
862 Ga0500647_0011078
863 Ga0500583_0106575
864 Ga0500651_0300902
865 Ga0500566_0000054
866 Ga0500640_096908
867 Ga0500641_0022394
868 Ga0500650_0081985
869 Ga0500554_010812
870 Ga0500572_002108
871 Ga0500591_065436
872 Ga0500593_105835
873 Ga0500595_000122
874 Ga0500595_021675
875 Ga0500608_092389
876 Ga0500568_0025018
877 Ga0500590_107957
878 Ga0500603_003425
879 Ga0500634_0059763
880 Ga0500638_003346
881 Ga0500639_011185
882 Ga0500637_0016773
883 Ga0500637_0017008
884 Ga0500637_0293958
885 Ga0500645_047566
886 Ga0500609_010259
887 Ga0500596_003497
888 Ga0501084_0156682
889 Ga0500661_009098
890 2513623266
891 2513694227
892 2874608236
893 2876811312
894 2879113002
895 2889035682
896 2922364161
897 8006932854
898 8006990752
899 8006996764
900 8056675560

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02390

Methyltransf_4

Putative methyltransferase

70

239

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8965 44 247
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8853 44 247
3dxz-assembly1.cif.gz_A crystal structure of ectrmb in complex with sah 0.8757 44 247
7nzj-assembly3.cif.gz_E structure of bstrmb apo 0.8612 43 247
3dxy-assembly1.cif.gz_A crystal structure of ectrmb in complex with sam 0.8611 44 247
ID Description Score Start End Superfamily
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8965 44 247 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8811 71 149 3.40.50.150
af_Q55EX4_556_743_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8782 73 244 3.40.50.150
3dxzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8757 44 247 3.40.50.150
af_C0H5A2_481_622_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8715 74 129 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2E5V788-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.962 33 247 GO:0008176
GO:0043527
AF-A0A3C0PNF7-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9595 85 246 GO:0008176
GO:0043527
AF-A0A527GHS0-F1-model_v4 tRNA (guanine(46)-N(7))-methyltransferase (EC 2.1.1.33) 0.9586 97 245 GO:0008176
GO:0043527
AF-A0A0F2RIE8-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9569 36 247 GO:0008176
GO:0043527
AF-A0A2S6QWI2-F1-model_v4 tRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.33) (tRNA (guanine(46)-N(7))-methyltransferase) (tRNA(m7G46)-methyltransferase) 0.9561 36 249 GO:0008176
GO:0043527

Map