F446634

General Info

Members Datasets Scaffolds Average Seq Length
450 243 449 157

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0936602|Ga0436365_0936602_3290_3760
Length 156
Sequence VFLSTFEKQLDAKRRIVVPLDFRAAVAGPFDGVFCFPSIEADCIEGGGKALFDQYKALIENDFEFGDPVRTALETSIYGGMNQLGFDTAGRITLPESLCEEFGLTDWVAVVGMGDRFQIWSRDAFRAHRASQRLVAREGLAALRSQQRLGRAGGGA

Samples

Sample ID Description Type Environment
1 2643221584 Caulobacter sp. Root656 Isolate Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
110 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
177 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
180 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
203 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
211 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
212 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
213 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
214 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
215 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
216 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
217 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
220 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
221 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
224 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
225 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
228 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
229 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
232 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
233 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
234 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
237 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
238 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
239 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
240 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
241 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
242 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
243 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.22
Nodule 0
Rhizoplane 4
Rhizosphere 76.44
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10074663 3300003215 Bacteria 865
2 Ga0055537_1006264 3300003773 Bacteria 3049
3 Ga0070658_10082556 3300005327 Bacteria 2641
4 Ga0070658_10225867 3300005327 Bacteria 1584
5 Ga0070670_100000065 3300005331 Bacteria 108496
6 Ga0070670_100028659 3300005331 Bacteria 4792
7 Ga0070670_100442034 3300005331 Bacteria 1152
8 Ga0070666_10073293 3300005335 Bacteria 2332
9 Ga0070666_10087654 3300005335 Bacteria 2134
10 Ga0070666_10170730 3300005335 Bacteria 1523
11 Ga0070666_10547807 3300005335 Bacteria 841
12 Ga0070680_100004706 3300005336 Bacteria 10268
13 Ga0070680_100539372 3300005336 Bacteria 999
14 Ga0070680_100586362 3300005336 Bacteria 957
15 Ga0070680_101154783 3300005336 Bacteria 669
16 Ga0070682_100685139 3300005337 Bacteria 820
17 Ga0068868_100052301 3300005338 Bacteria 3216
18 Ga0070660_100099349 3300005339 Bacteria 2304
19 Ga0070660_100187567 3300005339 Bacteria 1674
20 Ga0070660_100698053 3300005339 Bacteria 851
21 Ga0070691_10012498 3300005341 Bacteria 3888
22 Ga0070668_100001581 3300005347 Bacteria 16465
23 Ga0070668_100004340 3300005347 Bacteria 10514
24 Ga0070668_100015867 3300005347 Bacteria 5636
25 Ga0070668_100055330 3300005347 Bacteria 3062
26 Ga0070669_100249046 3300005353 Bacteria 1414
27 Ga0070671_100001428 3300005355 Bacteria 17826
28 Ga0070671_100059931 3300005355 Bacteria 3168
29 Ga0070671_100125290 3300005355 Bacteria 2163
30 Ga0070671_100671764 3300005355 Bacteria 898
31 Ga0070674_100156374 3300005356 Bacteria 1725
32 Ga0070659_100004390 3300005366 Bacteria 10071
33 Ga0070659_100024430 3300005366 Bacteria 4633
34 Ga0070667_100001118 3300005367 Bacteria 24484
35 Ga0070667_100004138 3300005367 Bacteria 12264
36 Ga0070667_100100460 3300005367 Bacteria 2499
37 Ga0070667_100137843 3300005367 Bacteria 2134
38 Ga0070667_101383106 3300005367 Bacteria 660
39 Ga0070663_100325640 3300005455 Bacteria 1237
40 Ga0070678_100315316 3300005456 Bacteria 1334
41 Ga0070662_100102056 3300005457 Bacteria 2172
42 Ga0070681_10019994 3300005458 Bacteria 6708
43 Ga0070681_10051878 3300005458 Bacteria 4091
44 Ga0070681_10098667 3300005458 Bacteria 2867
45 Ga0070679_100091378 3300005530 Bacteria 3032
46 Ga0070679_100282753 3300005530 Bacteria 1611
47 Ga0068853_100109632 3300005539 Bacteria 2450
48 Ga0068853_100188399 3300005539 Bacteria 1873
49 Ga0068853_100467519 3300005539 Bacteria 1188
50 Ga0070665_100000353 3300005548 Bacteria 69165
51 Ga0070665_100001877 3300005548 Bacteria 23874
52 Ga0070665_100003856 3300005548 Bacteria 15867
53 Ga0070665_100035721 3300005548 Bacteria 4998
54 Ga0070665_100335455 3300005548 Bacteria 1517
55 Ga0070665_100418884 3300005548 Bacteria 1348
56 Ga0068855_100050957 3300005563 Bacteria 4877
57 Ga0068855_100088255 3300005563 Bacteria 3582
58 Ga0068855_100107781 3300005563 Bacteria 3201
59 Ga0068855_100149046 3300005563 Bacteria 2661
60 Ga0068855_100754304 3300005563 Bacteria 1037
61 Ga0070664_100462441 3300005564 Bacteria 1166
62 Ga0070664_100496907 3300005564 Bacteria 1124
63 Ga0070664_100919274 3300005564 Bacteria 821
64 Ga0068857_100223469 3300005577 Bacteria 1721
65 Ga0068854_100233265 3300005578 Bacteria 1462
66 Ga0068856_100248251 3300005614 Bacteria 1795
67 Ga0068856_100344113 3300005614 Bacteria 1509
68 Ga0068852_100143536 3300005616 Bacteria 2212
69 Ga0068852_101002433 3300005616 Bacteria 854
70 Ga0068864_100000442 3300005618 Bacteria 35942
71 Ga0068864_100000690 3300005618 Bacteria 28244
72 Ga0068864_100008755 3300005618 Bacteria 8343
73 Ga0068864_100107745 3300005618 Bacteria 2479
74 Ga0068864_100191370 3300005618 Bacteria 1876
75 Ga0068861_100106104 3300005719 Bacteria 2243
76 Ga0068863_100000137 3300005841 Bacteria 77716
77 Ga0068863_100008314 3300005841 Bacteria 10140
78 Ga0068863_100048754 3300005841 Bacteria 4016
79 Ga0068863_100112763 3300005841 Bacteria 2589
80 Ga0068863_100699285 3300005841 Bacteria 1007
81 Ga0068858_100002755 3300005842 Bacteria 17660
82 Ga0068860_100000423 3300005843 Bacteria 54500
83 Ga0068860_100008846 3300005843 Bacteria 10030
84 Ga0068862_100001383 3300005844 Bacteria 22494
85 Ga0068862_100044213 3300005844 Bacteria 3798
86 Ga0068862_100095739 3300005844 Bacteria 2590
87 Ga0068862_100566328 3300005844 Bacteria 1087
88 Ga0070717_10125795 3300006028 Bacteria 2201
89 Ga0070717_10132356 3300006028 Bacteria 2146
90 Ga0075365_10622593 3300006038 Bacteria 763
91 Ga0075366_10268651 3300006195 Bacteria 1041
92 Ga0068865_100055458 3300006881 Bacteria 2757
93 Ga0068865_101366777 3300006881 Bacteria 631
94 Ga0105240_10009203 3300009093 Bacteria 14007
95 Ga0105240_10018606 3300009093 Bacteria 9316
96 Ga0105240_10027104 3300009093 Bacteria 7508
97 Ga0105240_10274043 3300009093 Bacteria 1941
98 Ga0105240_10443491 3300009093 Bacteria 1454
99 Ga0105247_10158957 3300009101 Bacteria 1495
100 Ga0105242_10060423 3300009176 Bacteria 3114
101 Ga0105248_10000708 3300009177 Bacteria 37708
102 Ga0105248_10091801 3300009177 Bacteria 3419
103 Ga0105248_10744814 3300009177 Bacteria 1106
104 Ga0105248_11034058 3300009177 Bacteria 928
105 Ga0105237_10731118 3300009545 Bacteria 996
106 Ga0105238_10017239 3300009551 Bacteria 7337
107 Ga0105238_10034273 3300009551 Bacteria 5166
108 Ga0105238_10120259 3300009551 Bacteria 2606
109 Ga0105238_11201608 3300009551 Bacteria 783
110 Ga0105238_11229367 3300009551 Bacteria 774
111 Ga0105249_10012058 3300009553 Bacteria 7608
112 Ga0105249_10295103 3300009553 Bacteria 1624
113 Ga0105249_10704156 3300009553 Bacteria 1070
114 Ga0105249_11865759 3300009553 Bacteria 674
115 Ga0105239_10444513 3300010375 Bacteria 1470
116 Ga0105239_10551304 3300010375 Bacteria 1313
117 Ga0105239_10596868 3300010375 Bacteria 1259
118 Ga0105246_10933333 3300011119 Bacteria 781
119 Ga0157370_10580542 3300013104 Bacteria 1027
120 Ga0157370_10655384 3300013104 Bacteria 959
121 Ga0157370_11251150 3300013104 Bacteria 669
122 Ga0157369_10533230 3300013105 Bacteria 1214
123 Ga0157369_10535459 3300013105 Bacteria 1211
124 Ga0157374_10106557 3300013296 Bacteria 2693
125 Ga0163162_10332385 3300013306 Bacteria 1652
126 Ga0163162_11207919 3300013306 Bacteria 858
127 Ga0157372_10028864 3300013307 Bacteria 6055
128 Ga0157375_10038365 3300013308 Bacteria 4600
129 Ga0157375_10679465 3300013308 Bacteria 1184
130 Ga0163163_10036810 3300014325 Bacteria 4755
131 Ga0163163_10311124 3300014325 Bacteria 1628
132 Ga0163163_10385358 3300014325 Bacteria 1459
133 Ga0163163_10562912 3300014325 Bacteria 1203
134 Ga0157379_10035070 3300014968 Bacteria 4472
135 Ga0157379_10060003 3300014968 Bacteria 3400
136 Ga0213876_10111744 3300021384 Bacteria 1450
137 Ga0213876_10160205 3300021384 Bacteria 1197
138 Ga0213875_10221905 3300021388 Bacteria 890
139 Ga0209148_1025182 3300025254 Bacteria 934
140 Ga0209565_1000118 3300025263 Bacteria 113196
141 Ga0209455_1027261 3300025272 Bacteria 1014
142 Ga0209673_1001492 3300025273 Bacteria 21772
143 Ga0209675_1004619 3300025291 Bacteria 6058
144 Ga0209758_1007780 3300025297 Bacteria 7171
145 Ga0209050_1039651 3300025298 Bacteria 1324
146 Ga0209256_1001982 3300025299 Bacteria 18440
147 Ga0209257_1000200 3300025304 Bacteria 147538
148 Ga0207710_10038309 3300025900 Bacteria 2119
149 Ga0207680_10123919 3300025903 Bacteria 1694
150 Ga0207680_10221273 3300025903 Bacteria 1298
151 Ga0207680_11162427 3300025903 Bacteria 551
152 Ga0207645_10457126 3300025907 Bacteria 862
153 Ga0207705_10013158 3300025909 Bacteria 5972
154 Ga0207705_10068757 3300025909 Bacteria 2565
155 Ga0207705_10075579 3300025909 Bacteria 2447
156 Ga0207705_10383314 3300025909 Bacteria 1086
157 Ga0207707_10026415 3300025912 Bacteria 5075
158 Ga0207707_10084121 3300025912 Bacteria 2778
159 Ga0207707_10189531 3300025912 Bacteria 1794
160 Ga0207695_10000922 3300025913 Bacteria 52650
161 Ga0207695_10254304 3300025913 Bacteria 1656
162 Ga0207695_10368158 3300025913 Bacteria 1323
163 Ga0207695_10427119 3300025913 Bacteria 1209
164 Ga0207671_10700611 3300025914 Bacteria 805
165 Ga0207660_10012622 3300025917 Bacteria 5533
166 Ga0207660_10129997 3300025917 Bacteria 1916
167 Ga0207660_10205666 3300025917 Bacteria 1539
168 Ga0207660_10282509 3300025917 Bacteria 1318
169 Ga0207660_10398582 3300025917 Bacteria 1108
170 Ga0207657_10009934 3300025919 Bacteria 9526
171 Ga0207657_10070916 3300025919 Bacteria 2952
172 Ga0207652_10005315 3300025921 Bacteria 10446
173 Ga0207652_10394679 3300025921 Bacteria 1248
174 Ga0207681_10190644 3300025923 Bacteria 1568
175 Ga0207681_10326394 3300025923 Bacteria 1222
176 Ga0207694_10103676 3300025924 Bacteria 2256
177 Ga0207694_10145088 3300025924 Bacteria 1910
178 Ga0207694_10443984 3300025924 Bacteria 1082
179 Ga0207650_10000031 3300025925 Bacteria 230128
180 Ga0207650_10014930 3300025925 Bacteria 5403
181 Ga0207644_10002775 3300025931 Bacteria 11276
182 Ga0207644_10102209 3300025931 Bacteria 2155
183 Ga0207690_10005646 3300025932 Bacteria 7393
184 Ga0207690_10625705 3300025932 Bacteria 880
185 Ga0207686_10077716 3300025934 Bacteria 2156
186 Ga0207704_10025881 3300025938 Bacteria 3209
187 Ga0207704_11808931 3300025938 Bacteria 525
188 Ga0207711_10000275 3300025941 Bacteria 55533
189 Ga0207711_10056942 3300025941 Bacteria 3360
190 Ga0207711_10283476 3300025941 Bacteria 1526
191 Ga0207679_10338462 3300025945 Bacteria 1308
192 Ga0207679_10507932 3300025945 Bacteria 1076
193 Ga0207667_10022948 3300025949 Bacteria 6879
194 Ga0207667_10044591 3300025949 Bacteria 4698
195 Ga0207667_10126573 3300025949 Bacteria 2631
196 Ga0207667_10747149 3300025949 Bacteria 978
197 Ga0207712_10002624 3300025961 Bacteria 11515
198 Ga0207712_10140084 3300025961 Bacteria 1855
199 Ga0207712_10469465 3300025961 Bacteria 1070
200 Ga0207668_10000018 3300025972 Bacteria 158577
201 Ga0207668_10000391 3300025972 Bacteria 27800
202 Ga0207668_10391570 3300025972 Bacteria 1172
203 Ga0207668_10407100 3300025972 Bacteria 1151
204 Ga0207658_10000491 3300025986 Bacteria 36300
205 Ga0207658_10005831 3300025986 Bacteria 8425
206 Ga0207658_10008193 3300025986 Bacteria 7118
207 Ga0207677_10099509 3300026023 Bacteria 2136
208 Ga0207677_11344081 3300026023 Bacteria 657
209 Ga0207703_10000146 3300026035 Bacteria 83180
210 Ga0207639_10246822 3300026041 Bacteria 1555
211 Ga0207678_10236916 3300026067 Bacteria 1563
212 Ga0207678_10381967 3300026067 Bacteria 1218
213 Ga0207702_10586691 3300026078 Bacteria 1093
214 Ga0207641_10000019 3300026088 Bacteria 295899
215 Ga0207641_10001433 3300026088 Bacteria 23426
216 Ga0207641_10012270 3300026088 Bacteria 7031
217 Ga0207641_10085773 3300026088 Bacteria 2744
218 Ga0207641_10234250 3300026088 Bacteria 1708
219 Ga0207641_10559266 3300026088 Bacteria 1116
220 Ga0207676_10000189 3300026095 Bacteria 54046
221 Ga0207676_10000310 3300026095 Bacteria 41722
222 Ga0207676_10013280 3300026095 Bacteria 5916
223 Ga0207676_10950039 3300026095 Bacteria 845
224 Ga0207674_10215333 3300026116 Bacteria 1869
225 Ga0207675_100055116 3300026118 Bacteria 3709
226 Ga0207683_10160754 3300026121 Bacteria 2030
227 Ga0207698_10224865 3300026142 Bacteria 1699
228 Ga0207698_10269693 3300026142 Bacteria 1568
229 Ga0207698_10453183 3300026142 Bacteria 1239
230 Ga0207698_11042198 3300026142 Bacteria 830
231 Ga0209981_1001677 3300027378 Bacteria 2801
232 Ga0268266_10000062 3300028379 Bacteria 253490
233 Ga0268266_10000816 3300028379 Bacteria 40977
234 Ga0268266_10004358 3300028379 Bacteria 13602
235 Ga0268266_10052550 3300028379 Bacteria 3499
236 Ga0268266_10100835 3300028379 Bacteria 2544
237 Ga0268265_10001051 3300028380 Bacteria 24779
238 Ga0268265_10013191 3300028380 Bacteria 5614
239 Ga0268265_10025173 3300028380 Bacteria 4220
240 Ga0268265_10055718 3300028380 Bacteria 3005
241 Ga0268265_10059947 3300028380 Bacteria 2914
242 Ga0268265_11869181 3300028380 Bacteria 607
243 Ga0268264_10000178 3300028381 Bacteria 134713
244 Ga0268264_10006276 3300028381 Bacteria 10022
245 Ga0265337_1009723 3300028556 Bacteria 3417
246 Ga0265326_10006016 3300028558 Bacteria 3794
247 Ga0265318_10035951 3300028577 Bacteria 1903
248 Ga0307517_10004291 3300028786 Bacteria 21975
249 Ga0307517_10158155 3300028786 Bacteria 1530
250 Ga0307517_10179177 3300028786 Bacteria 1372
251 Ga0265338_10064483 3300028800 Bacteria 3185
252 Ga0265330_10078042 3300031235 Bacteria 1429
253 Ga0265327_10000708 3300031251 Bacteria 52766
254 Ga0265327_10001672 3300031251 Bacteria 26634
255 Ga0265327_10048712 3300031251 Bacteria 2227
256 Ga0265316_10328057 3300031344 Bacteria 1111
257 Ga0307513_10001311 3300031456 Bacteria 35961
258 Ga0307513_10005084 3300031456 Bacteria 17406
259 Ga0307513_10012637 3300031456 Bacteria 10406
260 Ga0307509_10617640 3300031507 Bacteria 755
261 Ga0307508_10141749 3300031616 Bacteria 2008
262 Ga0265314_10113215 3300031711 Bacteria 1720
263 Ga0307516_10000010 3300031730 Bacteria 229720
264 Ga0307406_10303435 3300031901 Bacteria 1228
265 Ga0307407_10286367 3300031903 Bacteria 1143
266 Ga0307409_100005691 3300031995 Bacteria 7221
267 Ga0307409_101100715 3300031995 Bacteria 816
268 Ga0307416_100171210 3300032002 Bacteria 2022
269 Ga0307416_101308360 3300032002 Bacteria 831
270 Ga0307414_10209108 3300032004 Bacteria 1593
271 Ga0307411_10032951 3300032005 Bacteria 3208
272 Ga0373936_0009081 3300035113 Bacteria 3750
273 Ga0373946_0158318 3300035171 Bacteria 1061
274 Ga0373935_0064604 3300035692 Bacteria 2347
275 Ga0373927_0000348 3300035695 Bacteria 36186
276 Ga0373933_0260227 3300035724 Bacteria 1119
277 Ga0373937_0675769 3300036401 Bacteria 979
278 Ga0373937_1122601 3300036401 Bacteria 735
279 Ga0373925_0000222 3300037068 Bacteria 60920
280 Ga0395899_0000311 3300037312 Bacteria 62323
281 Ga0395899_0176374 3300037312 Bacteria 1502
282 Ga0395900_0000004 3300037418 Bacteria 564908
283 Ga0395900_0411695 3300037418 Bacteria 1314
284 Ga0395898_0017455 3300037466 Bacteria 7327
285 Ga0395898_0061986 3300037466 Bacteria 3633
286 Ga0395905_0005506 3300037471 Bacteria 12918
287 Ga0395905_0353476 3300037471 Bacteria 1362
288 Ga0436364_0468990 3300037853 Bacteria 1710
289 Ga0436364_0497339 3300037853 Bacteria 944
290 Ga0436364_0787749 3300037853 Bacteria 2077
291 Ga0395901_0000005 3300038443 Bacteria 544998
292 Ga0395901_0160139 3300038443 Bacteria 2364
293 Ga0395901_0602724 3300038443 Bacteria 1107
294 Ga0436365_0215846 3300039437 Bacteria 49725
295 Ga0436365_0464016 3300039437 Bacteria 1559
296 Ga0436365_0936602 3300039437 Bacteria 6401
297 Ga0436365_1265650 3300039437 Bacteria 2614
298 Ga0436365_1560458 3300039437 Bacteria 1893
299 Ga0436360_0214702 3300039438 Bacteria 1371
300 Ga0436360_0950112 3300039438 Bacteria 708
301 Ga0436363_1329887 3300039450 Bacteria 4359
302 Ga0436362_0505672 3300039453 Bacteria 1652
303 Ga0439435_0001527 3300042436 Bacteria 4317
304 Ga0466957_0213005 3300044842 Bacteria 1273
305 Ga0495629_0021932 3300046459 Bacteria 4557
306 Ga0495638_0005170 3300046460 Bacteria 9758
307 Ga0495650_0000237 3300046471 Bacteria 110872
308 Ga0495584_0099196 3300046491 Bacteria 1472
309 Ga0495583_0000001 3300046506 Bacteria 811973
310 Ga0495583_0087301 3300046506 Bacteria 1348
311 Ga0495606_0005022 3300046507 Bacteria 12894
312 Ga0495610_0002401 3300046512 Bacteria 15763
313 Ga0495610_0128303 3300046512 Bacteria 1104
314 Ga0495616_0137094 3300046513 Bacteria 1117
315 Ga0495620_0034656 3300046515 Bacteria 2278
316 Ga0495620_0035545 3300046515 Bacteria 2238
317 Ga0495630_0230971 3300046517 Bacteria 1413
318 Ga0495631_0315565 3300046518 Bacteria 665
319 Ga0495632_0019568 3300046519 Bacteria 3684
320 Ga0495632_0161370 3300046519 Bacteria 1032
321 Ga0495643_0009036 3300046522 Bacteria 6249
322 Ga0495648_0176691 3300046524 Bacteria 1089
323 Ga0495663_0209980 3300046525 Bacteria 682
324 Ga0495642_0006626 3300046528 Bacteria 4446
325 Ga0495642_0066751 3300046528 Bacteria 1499
326 Ga0495654_0000249 3300046530 Bacteria 49711
327 Ga0495654_0072634 3300046530 Bacteria 1628
328 Ga0495654_0141613 3300046530 Bacteria 1071
329 Ga0495609_0195078 3300046538 Bacteria 848
330 Ga0495621_0275559 3300046539 Bacteria 692
331 Ga0495597_0001524 3300046542 Bacteria 16474
332 Ga0495645_0071134 3300046543 Bacteria 2509
333 Ga0495622_0003827 3300046557 Bacteria 7030
334 Ga0495668_0064813 3300046616 Bacteria 2011
335 Ga0495625_0009397 3300046660 Bacteria 8184
336 Ga0495625_0032396 3300046660 Bacteria 3874
337 Ga0495625_0034286 3300046660 Bacteria 3747
338 Ga0495625_0055295 3300046660 Bacteria 2830
339 Ga0495625_0243460 3300046660 Bacteria 1170
340 Ga0495625_0591727 3300046660 Bacteria 667
341 Ga0495588_0216038 3300046674 Bacteria 1012
342 Ga0495669_0000004 3300046684 Bacteria 208878
343 Ga0495669_0046336 3300046684 Bacteria 1940
344 Ga0495669_0178348 3300046684 Bacteria 1012
345 Ga0495669_0319522 3300046684 Bacteria 749
346 Ga0495613_0000354 3300046689 Bacteria 40566
347 Ga0495624_0711404 3300046690 Bacteria 596
348 Ga0495670_0215410 3300046691 Bacteria 1019
349 Ga0495649_0389114 3300046694 Bacteria 701
350 Ga0495600_0430610 3300046809 Bacteria 818
351 Ga0495660_0010961 3300046810 Bacteria 5268
352 Ga0495636_0038829 3300047318 Bacteria 1971
353 Ga0495672_0024112 3300047320 Bacteria 3926
354 Ga0495677_0018034 3300047445 Bacteria 2559
355 Ga0495679_008801 3300047446 Bacteria 4078
356 Ga0495686_0144646 3300047472 Bacteria 1400
357 Ga0496100_1323260 3300048903 Bacteria 569
358 Ga0496101_0962209 3300048904 Bacteria 672
359 Ga0496101_0997394 3300048904 Bacteria 659
360 Ga0496102_0200461 3300048905 Bacteria 1881
361 Ga0496103_0162406 3300048906 Bacteria 1433
362 Ga0496103_0560083 3300048906 Bacteria 729
363 Ga0496106_0046394 3300048909 Bacteria 3266
364 Ga0496106_0216646 3300048909 Bacteria 1526
365 Ga0496107_0000914 3300048910 Bacteria 17392
366 Ga0496108_0052855 3300048911 Bacteria 3406
367 Ga0496109_0026771 3300048912 Bacteria 5143
368 Ga0496112_0027233 3300048915 Bacteria 5512
369 Ga0496112_0367897 3300048915 Bacteria 1379
370 Ga0496113_0128695 3300048916 Bacteria 1985
371 Ga0496115_0001410 3300048918 Bacteria 17190
372 Ga0496115_0001819 3300048918 Bacteria 15255
373 Ga0496115_0044494 3300048918 Bacteria 3541
374 Ga0496115_0442916 3300048918 Bacteria 1050
375 Ga0496121_0004530 3300048924 Bacteria 18596
376 Ga0496126_0542300 3300048929 Bacteria 924
377 Ga0501033_0004550 3300049570 Bacteria 11100
378 Ga0501033_0524707 3300049570 Bacteria 818
379 Ga0501033_0535649 3300049570 Bacteria 808
380 Ga0501033_0659752 3300049570 Bacteria 714
381 Ga0501034_0128572 3300049571 Bacteria 2517
382 Ga0501034_0536984 3300049571 Bacteria 1080
383 Ga0501037_0203501 3300049573 Bacteria 1398
384 Ga0501038_0123781 3300049574 Bacteria 2130
385 Ga0501043_0882060 3300049579 Bacteria 643
386 Ga0501043_1237551 3300049579 Bacteria 523
387 Ga0501047_0000478 3300049581 Bacteria 43581
388 Ga0501047_0086434 3300049581 Bacteria 3013
389 Ga0501047_0648112 3300049581 Bacteria 876
390 Ga0501047_1051902 3300049581 Bacteria 627
391 Ga0501048_0767869 3300049582 Bacteria 692
392 Ga0501238_001145 3300049671 Bacteria 3010
393 Ga0501257_013856 3300049686 Bacteria 1850
394 Ga0501083_0767623 3300049744 Bacteria 627
395 Ga0501035_0880527 3300049822 Bacteria 710
396 Ga0501044_0002069 3300049823 Bacteria 23130
397 Ga0501044_0116626 3300049823 Bacteria 2675
398 Ga0501044_0379016 3300049823 Bacteria 1330
399 nmdc:mga0k408_246143_c1 3300050493 Bacteria 1068
400 Ga0500635_0000020 3300053080 Bacteria 110196
401 Ga0500643_000992 3300053087 Bacteria 17440
402 Ga0500643_082757 3300053087 Bacteria 880
403 Ga0500647_0075649 3300053091 Bacteria 1616
404 Ga0500583_0135138 3300053092 Bacteria 1224
405 Ga0500651_0016638 3300053093 Bacteria 4528
406 Ga0500566_0023630 3300053094 Bacteria 3609
407 Ga0500641_0013091 3300053096 Bacteria 3044
408 Ga0500554_011335 3300053102 Bacteria 2205
409 Ga0500555_001171 3300053103 Bacteria 8595
410 Ga0500556_0041745 3300053104 Bacteria 1619
411 Ga0500562_000475 3300053108 Bacteria 9718
412 Ga0500562_010488 3300053108 Bacteria 2347
413 Ga0500569_006413 3300053109 Bacteria 2582
414 Ga0500572_000195 3300053111 Bacteria 21394
415 Ga0500572_130185 3300053111 Bacteria 817
416 Ga0500591_122183 3300053115 Bacteria 1067
417 Ga0500595_000693 3300053119 Bacteria 20109
418 Ga0500597_134166 3300053120 Bacteria 1069
419 Ga0500607_162316 3300053121 Bacteria 1019
420 Ga0500608_000608 3300053122 Bacteria 13180
421 Ga0500608_176282 3300053122 Bacteria 910
422 Ga0500608_310749 3300053122 Bacteria 579
423 Ga0500614_002165 3300053123 Bacteria 4474
424 Ga0500618_000123 3300053125 Bacteria 63600
425 Ga0500642_0029780 3300053130 Bacteria 2265
426 Ga0500642_0200812 3300053130 Bacteria 928
427 Ga0500658_0004677 3300053134 Bacteria 5107
428 Ga0500559_0000002 3300053136 Bacteria 262002
429 Ga0500559_0000307 3300053136 Bacteria 37126
430 Ga0500559_0030455 3300053136 Bacteria 2313
431 Ga0500559_0165953 3300053136 Bacteria 1038
432 Ga0500564_330629 3300053138 Bacteria 574
433 Ga0500577_0012824 3300053142 Bacteria 2544
434 Ga0500577_0115057 3300053142 Bacteria 1114
435 Ga0500590_030410 3300053148 Bacteria 2801
436 Ga0500604_0040890 3300053151 Bacteria 1400
437 Ga0500616_0036280 3300053153 Bacteria 2676
438 Ga0500616_0124502 3300053153 Bacteria 1226
439 Ga0500619_002355 3300053154 Bacteria 3621
440 Ga0500627_0004013 3300053158 Bacteria 4655
441 Ga0500638_055946 3300053162 Bacteria 1901
442 Ga0500638_064450 3300053162 Bacteria 1757
443 Ga0500639_105797 3300053163 Bacteria 1377
444 Ga0500639_139304 3300053163 Bacteria 1137
445 Ga0500637_0027176 3300053178 Bacteria 3157
446 Ga0500637_0082884 3300053178 Bacteria 1853
447 Ga0500576_159460 3300053725 Bacteria 830
448 Ga0500611_012231 3300053727 Bacteria 1443
449 Ga0500596_000539 3300053735 Bacteria 7175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_11808931 Ga0207704_118089311 141
2 3300049823 Ga0501044_0002069 Ga0501044_0002069_9566_10033 142
3 3300025254 Ga0209148_1025182 Ga0209148_10251821 143
4 3300025907 Ga0207645_10457126 Ga0207645_104571261 143
5 3300031456 Ga0307513_10001311 Ga0307513_1000131126 144
6 3300006038 Ga0075365_10622593 Ga0075365_106225931 145
7 3300049581 Ga0501047_1051902 Ga0501047_1051902_57_563 145
8 3300049582 Ga0501048_0767869 Ga0501048_0767869_126_632 145
9 3300037418 Ga0395900_0411695 Ga0395900_0411695_137_622 149
10 3300037466 Ga0395898_0061986 Ga0395898_0061986_694_1179 149
11 3300053108 Ga0500562_010488 Ga0500562_010488_677_1144 149
12 3300038443 Ga0395901_0602724 Ga0395901_0602724_99_605 150
13 3300053151 Ga0500604_0040890 Ga0500604_0040890_436_891 151
14 3300009093 Ga0105240_10018606 Ga0105240_100186063 152
15 3300009545 Ga0105237_10731118 Ga0105237_107311181 152
16 3300025913 Ga0207695_10368158 Ga0207695_103681581 152
17 3300025924 Ga0207694_10103676 Ga0207694_101036762 152
18 3300026142 Ga0207698_10453183 Ga0207698_104531832 152
19 3300028800 Ga0265338_10064483 Ga0265338_100644834 152
20 3300037853 Ga0436364_0468990 Ga0436364_0468990_54_530 152
21 3300039437 Ga0436365_0215846 Ga0436365_0215846_1369_1845 152
22 3300039450 Ga0436363_1329887 Ga0436363_1329887_584_1060 152
23 3300048918 Ga0496115_0442916 Ga0496115_0442916_101_565 152
24 3300053108 Ga0500562_000475 Ga0500562_000475_4783_5244 153
25 3300053153 Ga0500616_0036280 Ga0500616_0036280_18_488 153
26 3300005614 Ga0068856_100344113 Ga0068856_1003441132 154
27 3300025949 Ga0207667_10747149 Ga0207667_107471492 154
28 3300028558 Ga0265326_10006016 Ga0265326_100060165 154
29 3300031251 Ga0265327_10048712 Ga0265327_100487122 154
30 3300032002 Ga0307416_101308360 Ga0307416_1013083601 154
31 3300037853 Ga0436364_0787749 Ga0436364_0787749_105_581 154
32 3300046689 Ga0495613_0000354 Ga0495613_0000354_4581_5048 154
33 3300046809 Ga0495600_0430610 Ga0495600_0430610_20_487 154
34 3300053087 Ga0500643_000992 Ga0500643_000992_9773_10237 154
35 3300053111 Ga0500572_000195 Ga0500572_000195_6657_7124 154
36 3300053136 Ga0500559_0165953 Ga0500559_0165953_509_976 154
37 3300003215 JGI25153J46596_10074663 JGI25153J46596_100746631 155
38 3300003773 Ga0055537_1006264 Ga0055537_10062643 155
39 3300005327 Ga0070658_10082556 Ga0070658_100825563 155
40 3300005327 Ga0070658_10225867 Ga0070658_102258672 155
41 3300005331 Ga0070670_100000065 Ga0070670_10000006538 155
42 3300005331 Ga0070670_100028659 Ga0070670_1000286594 155
43 3300005331 Ga0070670_100442034 Ga0070670_1004420341 155
44 3300005335 Ga0070666_10073293 Ga0070666_100732934 155
45 3300005335 Ga0070666_10087654 Ga0070666_100876543 155
46 3300005335 Ga0070666_10170730 Ga0070666_101707303 155
47 3300005335 Ga0070666_10547807 Ga0070666_105478071 155
48 3300005336 Ga0070680_100004706 Ga0070680_1000047069 155
49 3300005336 Ga0070680_100539372 Ga0070680_1005393721 155
50 3300005336 Ga0070680_100586362 Ga0070680_1005863621 155
51 3300005336 Ga0070680_101154783 Ga0070680_1011547832 155
52 3300005337 Ga0070682_100685139 Ga0070682_1006851391 155
53 3300005338 Ga0068868_100052301 Ga0068868_1000523014 155
54 3300005339 Ga0070660_100099349 Ga0070660_1000993494 155
55 3300005339 Ga0070660_100187567 Ga0070660_1001875672 155
56 3300005339 Ga0070660_100698053 Ga0070660_1006980531 155
57 3300005341 Ga0070691_10012498 Ga0070691_100124984 155
58 3300005347 Ga0070668_100001581 Ga0070668_1000015812 155
59 3300005347 Ga0070668_100004340 Ga0070668_1000043409 155
60 3300005347 Ga0070668_100015867 Ga0070668_1000158675 155
61 3300005347 Ga0070668_100055330 Ga0070668_1000553302 155
62 3300005353 Ga0070669_100249046 Ga0070669_1002490462 155
63 3300005355 Ga0070671_100001428 Ga0070671_10000142810 155
64 3300005355 Ga0070671_100059931 Ga0070671_1000599314 155
65 3300005355 Ga0070671_100125290 Ga0070671_1001252902 155
66 3300005355 Ga0070671_100671764 Ga0070671_1006717641 155
67 3300005356 Ga0070674_100156374 Ga0070674_1001563741 155
68 3300005366 Ga0070659_100004390 Ga0070659_1000043904 155
69 3300005366 Ga0070659_100024430 Ga0070659_1000244301 155
70 3300005367 Ga0070667_100001118 Ga0070667_1000011181 155
71 3300005367 Ga0070667_100004138 Ga0070667_1000041384 155
72 3300005367 Ga0070667_100100460 Ga0070667_1001004602 155
73 3300005367 Ga0070667_100137843 Ga0070667_1001378432 155
74 3300005367 Ga0070667_101383106 Ga0070667_1013831061 155
75 3300005455 Ga0070663_100325640 Ga0070663_1003256401 155
76 3300005456 Ga0070678_100315316 Ga0070678_1003153162 155
77 3300005457 Ga0070662_100102056 Ga0070662_1001020562 155
78 3300005458 Ga0070681_10019994 Ga0070681_100199944 155
79 3300005458 Ga0070681_10051878 Ga0070681_100518784 155
80 3300005458 Ga0070681_10098667 Ga0070681_100986671 155
81 3300005530 Ga0070679_100091378 Ga0070679_1000913782 155
82 3300005530 Ga0070679_100282753 Ga0070679_1002827532 155
83 3300005539 Ga0068853_100109632 Ga0068853_1001096323 155
84 3300005539 Ga0068853_100188399 Ga0068853_1001883992 155
85 3300005539 Ga0068853_100467519 Ga0068853_1004675192 155
86 3300005548 Ga0070665_100000353 Ga0070665_10000035339 155
87 3300005548 Ga0070665_100001877 Ga0070665_1000018772 155
88 3300005548 Ga0070665_100003856 Ga0070665_1000038561 155
89 3300005548 Ga0070665_100035721 Ga0070665_1000357212 155
90 3300005548 Ga0070665_100335455 Ga0070665_1003354552 155
91 3300005548 Ga0070665_100418884 Ga0070665_1004188841 155
92 3300005563 Ga0068855_100050957 Ga0068855_1000509575 155
93 3300005563 Ga0068855_100088255 Ga0068855_1000882552 155
94 3300005563 Ga0068855_100107781 Ga0068855_1001077812 155
95 3300005563 Ga0068855_100149046 Ga0068855_1001490462 155
96 3300005563 Ga0068855_100754304 Ga0068855_1007543041 155
97 3300005564 Ga0070664_100462441 Ga0070664_1004624412 155
98 3300005564 Ga0070664_100496907 Ga0070664_1004969071 155
99 3300005564 Ga0070664_100919274 Ga0070664_1009192742 155
100 3300005577 Ga0068857_100223469 Ga0068857_1002234692 155
101 3300005578 Ga0068854_100233265 Ga0068854_1002332652 155
102 3300005614 Ga0068856_100248251 Ga0068856_1002482513 155
103 3300005616 Ga0068852_100143536 Ga0068852_1001435362 155
104 3300005616 Ga0068852_101002433 Ga0068852_1010024332 155
105 3300005618 Ga0068864_100000442 Ga0068864_10000044213 155
106 3300005618 Ga0068864_100000690 Ga0068864_10000069012 155
107 3300005618 Ga0068864_100008755 Ga0068864_1000087554 155
108 3300005618 Ga0068864_100107745 Ga0068864_1001077453 155
109 3300005618 Ga0068864_100191370 Ga0068864_1001913702 155
110 3300005719 Ga0068861_100106104 Ga0068861_1001061041 155
111 3300005841 Ga0068863_100000137 Ga0068863_10000013712 155
112 3300005841 Ga0068863_100008314 Ga0068863_1000083141 155
113 3300005841 Ga0068863_100048754 Ga0068863_1000487545 155
114 3300005841 Ga0068863_100112763 Ga0068863_1001127634 155
115 3300005841 Ga0068863_100699285 Ga0068863_1006992852 155
116 3300005842 Ga0068858_100002755 Ga0068858_1000027556 155
117 3300005843 Ga0068860_100000423 Ga0068860_10000042335 155
118 3300005843 Ga0068860_100008846 Ga0068860_1000088467 155
119 3300005844 Ga0068862_100001383 Ga0068862_10000138320 155
120 3300005844 Ga0068862_100044213 Ga0068862_1000442132 155
121 3300005844 Ga0068862_100095739 Ga0068862_1000957391 155
122 3300005844 Ga0068862_100566328 Ga0068862_1005663281 155
123 3300006028 Ga0070717_10125795 Ga0070717_101257951 155
124 3300006028 Ga0070717_10132356 Ga0070717_101323561 155
125 3300006195 Ga0075366_10268651 Ga0075366_102686512 155
126 3300006881 Ga0068865_100055458 Ga0068865_1000554584 155
127 3300006881 Ga0068865_101366777 Ga0068865_1013667772 155
128 3300009093 Ga0105240_10009203 Ga0105240_100092039 155
129 3300009093 Ga0105240_10027104 Ga0105240_100271041 155
130 3300009093 Ga0105240_10274043 Ga0105240_102740432 155
131 3300009093 Ga0105240_10443491 Ga0105240_104434911 155
132 3300009101 Ga0105247_10158957 Ga0105247_101589573 155
133 3300009176 Ga0105242_10060423 Ga0105242_100604232 155
134 3300009177 Ga0105248_10000708 Ga0105248_1000070816 155
135 3300009177 Ga0105248_10091801 Ga0105248_100918012 155
136 3300009177 Ga0105248_10744814 Ga0105248_107448141 155
137 3300009177 Ga0105248_11034058 Ga0105248_110340581 155
138 3300009551 Ga0105238_10017239 Ga0105238_100172393 155
139 3300009551 Ga0105238_10034273 Ga0105238_100342735 155
140 3300009551 Ga0105238_10120259 Ga0105238_101202594 155
141 3300009551 Ga0105238_11201608 Ga0105238_112016082 155
142 3300009551 Ga0105238_11229367 Ga0105238_112293671 155
143 3300009553 Ga0105249_10012058 Ga0105249_100120588 155
144 3300009553 Ga0105249_10295103 Ga0105249_102951032 155
145 3300009553 Ga0105249_10704156 Ga0105249_107041561 155
146 3300009553 Ga0105249_11865759 Ga0105249_118657591 155
147 3300010375 Ga0105239_10444513 Ga0105239_104445133 155
148 3300010375 Ga0105239_10551304 Ga0105239_105513041 155
149 3300010375 Ga0105239_10596868 Ga0105239_105968681 155
150 3300011119 Ga0105246_10933333 Ga0105246_109333331 155
151 3300013104 Ga0157370_10580542 Ga0157370_105805422 155
152 3300013104 Ga0157370_10655384 Ga0157370_106553842 155
153 3300013104 Ga0157370_11251150 Ga0157370_112511502 155
154 3300013105 Ga0157369_10533230 Ga0157369_105332302 155
155 3300013105 Ga0157369_10535459 Ga0157369_105354591 155
156 3300013296 Ga0157374_10106557 Ga0157374_101065572 155
157 3300013306 Ga0163162_10332385 Ga0163162_103323851 155
158 3300013306 Ga0163162_11207919 Ga0163162_112079191 155
159 3300013307 Ga0157372_10028864 Ga0157372_100288645 155
160 3300013308 Ga0157375_10038365 Ga0157375_100383651 155
161 3300013308 Ga0157375_10679465 Ga0157375_106794651 155
162 3300014325 Ga0163163_10036810 Ga0163163_100368103 155
163 3300014325 Ga0163163_10311124 Ga0163163_103111243 155
164 3300014325 Ga0163163_10385358 Ga0163163_103853581 155
165 3300014325 Ga0163163_10562912 Ga0163163_105629121 155
166 3300014968 Ga0157379_10035070 Ga0157379_100350703 155
167 3300014968 Ga0157379_10060003 Ga0157379_100600035 155
168 3300021384 Ga0213876_10111744 Ga0213876_101117441 155
169 3300021384 Ga0213876_10160205 Ga0213876_101602052 155
170 3300021388 Ga0213875_10221905 Ga0213875_102219052 155
171 3300025263 Ga0209565_1000118 Ga0209565_100011825 155
172 3300025272 Ga0209455_1027261 Ga0209455_10272611 155
173 3300025273 Ga0209673_1001492 Ga0209673_10014927 155
174 3300025291 Ga0209675_1004619 Ga0209675_10046194 155
175 3300025297 Ga0209758_1007780 Ga0209758_10077801 155
176 3300025298 Ga0209050_1039651 Ga0209050_10396511 155
177 3300025299 Ga0209256_1001982 Ga0209256_10019827 155
178 3300025304 Ga0209257_1000200 Ga0209257_100020031 155
179 3300025900 Ga0207710_10038309 Ga0207710_100383091 155
180 3300025903 Ga0207680_10123919 Ga0207680_101239191 155
181 3300025903 Ga0207680_10221273 Ga0207680_102212732 155
182 3300025903 Ga0207680_11162427 Ga0207680_111624271 155
183 3300025909 Ga0207705_10013158 Ga0207705_100131581 155
184 3300025909 Ga0207705_10068757 Ga0207705_100687574 155
185 3300025909 Ga0207705_10075579 Ga0207705_100755791 155
186 3300025909 Ga0207705_10383314 Ga0207705_103833142 155
187 3300025912 Ga0207707_10026415 Ga0207707_100264155 155
188 3300025912 Ga0207707_10084121 Ga0207707_100841212 155
189 3300025912 Ga0207707_10189531 Ga0207707_101895312 155
190 3300025913 Ga0207695_10000922 Ga0207695_1000092214 155
191 3300025913 Ga0207695_10254304 Ga0207695_102543041 155
192 3300025913 Ga0207695_10427119 Ga0207695_104271191 155
193 3300025914 Ga0207671_10700611 Ga0207671_107006111 155
194 3300025917 Ga0207660_10012622 Ga0207660_100126225 155
195 3300025917 Ga0207660_10129997 Ga0207660_101299973 155
196 3300025917 Ga0207660_10205666 Ga0207660_102056663 155
197 3300025917 Ga0207660_10282509 Ga0207660_102825091 155
198 3300025917 Ga0207660_10398582 Ga0207660_103985822 155
199 3300025919 Ga0207657_10009934 Ga0207657_100099341 155
200 3300025919 Ga0207657_10070916 Ga0207657_100709164 155
201 3300025921 Ga0207652_10005315 Ga0207652_100053159 155
202 3300025921 Ga0207652_10394679 Ga0207652_103946792 155
203 3300025923 Ga0207681_10190644 Ga0207681_101906441 155
204 3300025923 Ga0207681_10326394 Ga0207681_103263942 155
205 3300025924 Ga0207694_10145088 Ga0207694_101450882 155
206 3300025924 Ga0207694_10443984 Ga0207694_104439842 155
207 3300025925 Ga0207650_10000031 Ga0207650_10000031137 155
208 3300025925 Ga0207650_10014930 Ga0207650_100149304 155
209 3300025931 Ga0207644_10002775 Ga0207644_100027758 155
210 3300025931 Ga0207644_10102209 Ga0207644_101022092 155
211 3300025932 Ga0207690_10005646 Ga0207690_100056466 155
212 3300025932 Ga0207690_10625705 Ga0207690_106257052 155
213 3300025934 Ga0207686_10077716 Ga0207686_100777163 155
214 3300025938 Ga0207704_10025881 Ga0207704_100258814 155
215 3300025941 Ga0207711_10000275 Ga0207711_1000027516 155
216 3300025941 Ga0207711_10056942 Ga0207711_100569425 155
217 3300025941 Ga0207711_10283476 Ga0207711_102834761 155
218 3300025945 Ga0207679_10338462 Ga0207679_103384622 155
219 3300025945 Ga0207679_10507932 Ga0207679_105079321 155
220 3300025949 Ga0207667_10022948 Ga0207667_100229485 155
221 3300025949 Ga0207667_10044591 Ga0207667_100445915 155
222 3300025949 Ga0207667_10126573 Ga0207667_101265733 155
223 3300025961 Ga0207712_10002624 Ga0207712_100026241 155
224 3300025961 Ga0207712_10140084 Ga0207712_101400844 155
225 3300025961 Ga0207712_10469465 Ga0207712_104694653 155
226 3300025972 Ga0207668_10000018 Ga0207668_1000001819 155
227 3300025972 Ga0207668_10000391 Ga0207668_1000039117 155
228 3300025972 Ga0207668_10391570 Ga0207668_103915702 155
229 3300025972 Ga0207668_10407100 Ga0207668_104071002 155
230 3300025986 Ga0207658_10000491 Ga0207658_1000049122 155
231 3300025986 Ga0207658_10005831 Ga0207658_100058318 155
232 3300025986 Ga0207658_10008193 Ga0207658_100081934 155
233 3300026023 Ga0207677_10099509 Ga0207677_100995093 155
234 3300026023 Ga0207677_11344081 Ga0207677_113440811 155
235 3300026035 Ga0207703_10000146 Ga0207703_1000014622 155
236 3300026041 Ga0207639_10246822 Ga0207639_102468222 155
237 3300026067 Ga0207678_10236916 Ga0207678_102369162 155
238 3300026067 Ga0207678_10381967 Ga0207678_103819672 155
239 3300026078 Ga0207702_10586691 Ga0207702_105866911 155
240 3300026088 Ga0207641_10000019 Ga0207641_10000019113 155
241 3300026088 Ga0207641_10001433 Ga0207641_100014331 155
242 3300026088 Ga0207641_10012270 Ga0207641_100122705 155
243 3300026088 Ga0207641_10085773 Ga0207641_100857733 155
244 3300026088 Ga0207641_10234250 Ga0207641_102342501 155
245 3300026088 Ga0207641_10559266 Ga0207641_105592662 155
246 3300026095 Ga0207676_10000189 Ga0207676_100001891 155
247 3300026095 Ga0207676_10000310 Ga0207676_1000031012 155
248 3300026095 Ga0207676_10013280 Ga0207676_100132804 155
249 3300026095 Ga0207676_10950039 Ga0207676_109500392 155
250 3300026116 Ga0207674_10215333 Ga0207674_102153332 155
251 3300026118 Ga0207675_100055116 Ga0207675_1000551164 155
252 3300026121 Ga0207683_10160754 Ga0207683_101607542 155
253 3300026142 Ga0207698_10224865 Ga0207698_102248652 155
254 3300026142 Ga0207698_10269693 Ga0207698_102696932 155
255 3300026142 Ga0207698_11042198 Ga0207698_110421981 155
256 3300027378 Ga0209981_1001677 Ga0209981_10016773 155
257 3300028379 Ga0268266_10000062 Ga0268266_1000006231 155
258 3300028379 Ga0268266_10000816 Ga0268266_1000081623 155
259 3300028379 Ga0268266_10004358 Ga0268266_100043584 155
260 3300028379 Ga0268266_10052550 Ga0268266_100525504 155
261 3300028379 Ga0268266_10100835 Ga0268266_101008351 155
262 3300028380 Ga0268265_10001051 Ga0268265_1000105120 155
263 3300028380 Ga0268265_10013191 Ga0268265_100131916 155
264 3300028380 Ga0268265_10025173 Ga0268265_100251736 155
265 3300028380 Ga0268265_10055718 Ga0268265_100557182 155
266 3300028380 Ga0268265_10059947 Ga0268265_100599472 155
267 3300028380 Ga0268265_11869181 Ga0268265_118691811 155
268 3300028381 Ga0268264_10000178 Ga0268264_1000017823 155
269 3300028381 Ga0268264_10006276 Ga0268264_100062764 155
270 3300028556 Ga0265337_1009723 Ga0265337_10097232 155
271 3300028577 Ga0265318_10035951 Ga0265318_100359512 155
272 3300028786 Ga0307517_10004291 Ga0307517_100042918 155
273 3300028786 Ga0307517_10158155 Ga0307517_101581552 155
274 3300028786 Ga0307517_10179177 Ga0307517_101791771 155
275 3300031235 Ga0265330_10078042 Ga0265330_100780422 155
276 3300031251 Ga0265327_10000708 Ga0265327_1000070833 155
277 3300031251 Ga0265327_10001672 Ga0265327_1000167223 155
278 3300031344 Ga0265316_10328057 Ga0265316_103280572 155
279 3300031456 Ga0307513_10005084 Ga0307513_100050844 155
280 3300031456 Ga0307513_10012637 Ga0307513_100126372 155
281 3300031507 Ga0307509_10617640 Ga0307509_106176402 155
282 3300031616 Ga0307508_10141749 Ga0307508_101417492 155
283 3300031711 Ga0265314_10113215 Ga0265314_101132152 155
284 3300031730 Ga0307516_10000010 Ga0307516_10000010182 155
285 3300031901 Ga0307406_10303435 Ga0307406_103034352 155
286 3300031903 Ga0307407_10286367 Ga0307407_102863672 155
287 3300031995 Ga0307409_100005691 Ga0307409_1000056916 155
288 3300031995 Ga0307409_101100715 Ga0307409_1011007151 155
289 3300032002 Ga0307416_100171210 Ga0307416_1001712103 155
290 3300032004 Ga0307414_10209108 Ga0307414_102091081 155
291 3300032005 Ga0307411_10032951 Ga0307411_100329513 155
292 3300035113 Ga0373936_0009081 Ga0373936_0009081_2294_2782 155
293 3300035171 Ga0373946_0158318 Ga0373946_0158318_494_964 155
294 3300035692 Ga0373935_0064604 Ga0373935_0064604_880_1347 155
295 3300035695 Ga0373927_0000348 Ga0373927_0000348_14087_14557 155
296 3300035724 Ga0373933_0260227 Ga0373933_0260227_41_508 155
297 3300036401 Ga0373937_0675769 Ga0373937_0675769_189_656 155
298 3300036401 Ga0373937_1122601 Ga0373937_1122601_80_547 155
299 3300037068 Ga0373925_0000222 Ga0373925_0000222_22034_22504 155
300 3300037312 Ga0395899_0000311 Ga0395899_0000311_5337_5807 155
301 3300037312 Ga0395899_0176374 Ga0395899_0176374_872_1339 155
302 3300037418 Ga0395900_0000004 Ga0395900_0000004_287350_287820 155
303 3300037466 Ga0395898_0017455 Ga0395898_0017455_1440_1910 155
304 3300037471 Ga0395905_0005506 Ga0395905_0005506_3743_4213 155
305 3300037471 Ga0395905_0353476 Ga0395905_0353476_418_888 155
306 3300037853 Ga0436364_0497339 Ga0436364_0497339_301_768 155
307 3300038443 Ga0395901_0000005 Ga0395901_0000005_277746_278216 155
308 3300038443 Ga0395901_0160139 Ga0395901_0160139_133_603 155
309 3300039437 Ga0436365_0464016 Ga0436365_0464016_187_654 155
310 3300039437 Ga0436365_0936602 Ga0436365_0936602_3290_3760 155
311 3300039437 Ga0436365_1265650 Ga0436365_1265650_1702_2169 155
312 3300039437 Ga0436365_1560458 Ga0436365_1560458_914_1381 155
313 3300039438 Ga0436360_0214702 Ga0436360_0214702_702_1169 155
314 3300039438 Ga0436360_0950112 Ga0436360_0950112_170_637 155
315 3300039453 Ga0436362_0505672 Ga0436362_0505672_42_575 155
316 3300042436 Ga0439435_0001527 Ga0439435_0001527_3240_3707 155
317 3300044842 Ga0466957_0213005 Ga0466957_0213005_284_751 155
318 3300046459 Ga0495629_0021932 Ga0495629_0021932_736_1203 155
319 3300046460 Ga0495638_0005170 Ga0495638_0005170_9176_9643 155
320 3300046471 Ga0495650_0000237 Ga0495650_0000237_47224_47691 155
321 3300046491 Ga0495584_0099196 Ga0495584_0099196_297_764 155
322 3300046506 Ga0495583_0000001 Ga0495583_0000001_751850_752389 155
323 3300046506 Ga0495583_0087301 Ga0495583_0087301_702_1187 155
324 3300046507 Ga0495606_0005022 Ga0495606_0005022_6172_6639 155
325 3300046512 Ga0495610_0002401 Ga0495610_0002401_9232_9699 155
326 3300046512 Ga0495610_0128303 Ga0495610_0128303_111_578 155
327 3300046513 Ga0495616_0137094 Ga0495616_0137094_65_532 155
328 3300046515 Ga0495620_0034656 Ga0495620_0034656_961_1428 155
329 3300046515 Ga0495620_0035545 Ga0495620_0035545_1142_1609 155
330 3300046517 Ga0495630_0230971 Ga0495630_0230971_66_545 155
331 3300046518 Ga0495631_0315565 Ga0495631_0315565_151_618 155
332 3300046519 Ga0495632_0019568 Ga0495632_0019568_26_493 155
333 3300046519 Ga0495632_0161370 Ga0495632_0161370_74_541 155
334 3300046522 Ga0495643_0009036 Ga0495643_0009036_955_1422 155
335 3300046524 Ga0495648_0176691 Ga0495648_0176691_541_1008 155
336 3300046525 Ga0495663_0209980 Ga0495663_0209980_166_633 155
337 3300046528 Ga0495642_0006626 Ga0495642_0006626_1788_2273 155
338 3300046528 Ga0495642_0066751 Ga0495642_0066751_122_589 155
339 3300046530 Ga0495654_0000249 Ga0495654_0000249_573_1040 155
340 3300046530 Ga0495654_0072634 Ga0495654_0072634_284_751 155
341 3300046530 Ga0495654_0141613 Ga0495654_0141613_554_1021 155
342 3300046538 Ga0495609_0195078 Ga0495609_0195078_143_610 155
343 3300046539 Ga0495621_0275559 Ga0495621_0275559_92_559 155
344 3300046542 Ga0495597_0001524 Ga0495597_0001524_8815_9282 155
345 3300046543 Ga0495645_0071134 Ga0495645_0071134_1608_2165 155
346 3300046557 Ga0495622_0003827 Ga0495622_0003827_1560_2027 155
347 3300046616 Ga0495668_0064813 Ga0495668_0064813_1375_1875 155
348 3300046660 Ga0495625_0009397 Ga0495625_0009397_436_903 155
349 3300046660 Ga0495625_0032396 Ga0495625_0032396_614_1099 155
350 3300046660 Ga0495625_0034286 Ga0495625_0034286_635_1102 155
351 3300046660 Ga0495625_0055295 Ga0495625_0055295_1929_2396 155
352 3300046660 Ga0495625_0243460 Ga0495625_0243460_392_859 155
353 3300046660 Ga0495625_0591727 Ga0495625_0591727_140_607 155
354 3300046674 Ga0495588_0216038 Ga0495588_0216038_489_956 155
355 3300046684 Ga0495669_0000004 Ga0495669_0000004_83962_84429 155
356 3300046684 Ga0495669_0046336 Ga0495669_0046336_627_1094 155
357 3300046684 Ga0495669_0178348 Ga0495669_0178348_202_687 155
358 3300046684 Ga0495669_0319522 Ga0495669_0319522_46_513 155
359 3300046690 Ga0495624_0711404 Ga0495624_0711404_61_528 155
360 3300046691 Ga0495670_0215410 Ga0495670_0215410_492_959 155
361 3300046694 Ga0495649_0389114 Ga0495649_0389114_106_573 155
362 3300046810 Ga0495660_0010961 Ga0495660_0010961_570_1037 155
363 3300047318 Ga0495636_0038829 Ga0495636_0038829_741_1208 155
364 3300047320 Ga0495672_0024112 Ga0495672_0024112_3270_3737 155
365 3300047445 Ga0495677_0018034 Ga0495677_0018034_1322_1789 155
366 3300047446 Ga0495679_008801 Ga0495679_008801_776_1243 155
367 3300047472 Ga0495686_0144646 Ga0495686_0144646_484_951 155
368 3300048903 Ga0496100_1323260 Ga0496100_1323260_25_492 155
369 3300048904 Ga0496101_0962209 Ga0496101_0962209_142_615 155
370 3300048904 Ga0496101_0997394 Ga0496101_0997394_94_561 155
371 3300048905 Ga0496102_0200461 Ga0496102_0200461_834_1319 155
372 3300048906 Ga0496103_0162406 Ga0496103_0162406_941_1408 155
373 3300048906 Ga0496103_0560083 Ga0496103_0560083_213_698 155
374 3300048909 Ga0496106_0046394 Ga0496106_0046394_1217_1684 155
375 3300048909 Ga0496106_0216646 Ga0496106_0216646_329_814 155
376 3300048910 Ga0496107_0000914 Ga0496107_0000914_8992_9459 155
377 3300048911 Ga0496108_0052855 Ga0496108_0052855_1119_1604 155
378 3300048912 Ga0496109_0026771 Ga0496109_0026771_1001_1486 155
379 3300048915 Ga0496112_0027233 Ga0496112_0027233_1790_2275 155
380 3300048915 Ga0496112_0367897 Ga0496112_0367897_372_839 155
381 3300048916 Ga0496113_0128695 Ga0496113_0128695_34_519 155
382 3300048918 Ga0496115_0001410 Ga0496115_0001410_3492_3977 155
383 3300048918 Ga0496115_0001819 Ga0496115_0001819_192_674 155
384 3300048918 Ga0496115_0044494 Ga0496115_0044494_892_1365 155
385 3300048924 Ga0496121_0004530 Ga0496121_0004530_9887_10354 155
386 3300048929 Ga0496126_0542300 Ga0496126_0542300_272_739 155
387 3300049570 Ga0501033_0004550 Ga0501033_0004550_7539_8006 155
388 3300049570 Ga0501033_0524707 Ga0501033_0524707_192_659 155
389 3300049570 Ga0501033_0535649 Ga0501033_0535649_198_665 155
390 3300049570 Ga0501033_0659752 Ga0501033_0659752_161_628 155
391 3300049571 Ga0501034_0128572 Ga0501034_0128572_641_1123 155
392 3300049571 Ga0501034_0536984 Ga0501034_0536984_502_969 155
393 3300049573 Ga0501037_0203501 Ga0501037_0203501_607_1074 155
394 3300049574 Ga0501038_0123781 Ga0501038_0123781_1207_1674 155
395 3300049579 Ga0501043_0882060 Ga0501043_0882060_51_518 155
396 3300049579 Ga0501043_1237551 Ga0501043_1237551_19_486 155
397 3300049581 Ga0501047_0000478 Ga0501047_0000478_38648_39115 155
398 3300049581 Ga0501047_0086434 Ga0501047_0086434_1318_1785 155
399 3300049581 Ga0501047_0648112 Ga0501047_0648112_208_675 155
400 3300049671 Ga0501238_001145 Ga0501238_001145_2008_2475 155
401 3300049686 Ga0501257_013856 Ga0501257_013856_89_556 155
402 3300049744 Ga0501083_0767623 Ga0501083_0767623_10_477 155
403 3300049822 Ga0501035_0880527 Ga0501035_0880527_63_530 155
404 3300049823 Ga0501044_0116626 Ga0501044_0116626_1615_2082 155
405 3300049823 Ga0501044_0379016 Ga0501044_0379016_85_552 155
406 3300050493 nmdc:mga0k408_246143_c1 nmdc:mga0k408_246143_c1_149_616 155
407 3300053080 Ga0500635_0000020 Ga0500635_0000020_37410_37877 155
408 3300053087 Ga0500643_082757 Ga0500643_082757_341_808 155
409 3300053091 Ga0500647_0075649 Ga0500647_0075649_706_1173 155
410 3300053092 Ga0500583_0135138 Ga0500583_0135138_544_1011 155
411 3300053093 Ga0500651_0016638 Ga0500651_0016638_1596_2063 155
412 3300053094 Ga0500566_0023630 Ga0500566_0023630_2517_2984 155
413 3300053096 Ga0500641_0013091 Ga0500641_0013091_2100_2567 155
414 3300053102 Ga0500554_011335 Ga0500554_011335_651_1118 155
415 3300053103 Ga0500555_001171 Ga0500555_001171_7722_8189 155
416 3300053104 Ga0500556_0041745 Ga0500556_0041745_262_729 155
417 3300053109 Ga0500569_006413 Ga0500569_006413_2042_2509 155
418 3300053111 Ga0500572_130185 Ga0500572_130185_328_795 155
419 3300053115 Ga0500591_122183 Ga0500591_122183_17_484 155
420 3300053119 Ga0500595_000693 Ga0500595_000693_11080_11547 155
421 3300053120 Ga0500597_134166 Ga0500597_134166_294_764 155
422 3300053121 Ga0500607_162316 Ga0500607_162316_157_624 155
423 3300053122 Ga0500608_000608 Ga0500608_000608_1823_2290 155
424 3300053122 Ga0500608_176282 Ga0500608_176282_305_772 155
425 3300053122 Ga0500608_310749 Ga0500608_310749_43_510 155
426 3300053123 Ga0500614_002165 Ga0500614_002165_3468_3935 155
427 3300053125 Ga0500618_000123 Ga0500618_000123_12012_12479 155
428 3300053130 Ga0500642_0029780 Ga0500642_0029780_874_1341 155
429 3300053130 Ga0500642_0200812 Ga0500642_0200812_366_833 155
430 3300053134 Ga0500658_0004677 Ga0500658_0004677_3809_4276 155
431 3300053136 Ga0500559_0000002 Ga0500559_0000002_89016_89525 155
432 3300053136 Ga0500559_0000307 Ga0500559_0000307_36113_36580 155
433 3300053136 Ga0500559_0030455 Ga0500559_0030455_19_486 155
434 3300053138 Ga0500564_330629 Ga0500564_330629_40_507 155
435 3300053142 Ga0500577_0012824 Ga0500577_0012824_1771_2238 155
436 3300053142 Ga0500577_0115057 Ga0500577_0115057_130_597 155
437 3300053148 Ga0500590_030410 Ga0500590_030410_1000_1467 155
438 3300053153 Ga0500616_0124502 Ga0500616_0124502_73_540 155
439 3300053154 Ga0500619_002355 Ga0500619_002355_1482_1949 155
440 3300053158 Ga0500627_0004013 Ga0500627_0004013_836_1303 155
441 3300053162 Ga0500638_055946 Ga0500638_055946_1028_1495 155
442 3300053162 Ga0500638_064450 Ga0500638_064450_944_1411 155
443 3300053163 Ga0500639_105797 Ga0500639_105797_638_1105 155
444 3300053163 Ga0500639_139304 Ga0500639_139304_72_581 155
445 3300053178 Ga0500637_0027176 Ga0500637_0027176_2156_2623 155
446 3300053178 Ga0500637_0082884 Ga0500637_0082884_1166_1633 155
447 3300053725 Ga0500576_159460 Ga0500576_159460_152_619 155
448 3300053727 Ga0500611_012231 Ga0500611_012231_954_1421 155
449 3300053735 Ga0500596_000539 Ga0500596_000539_5164_5631 155
450 iso_pu_bacteria 2643221584 2643928298 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02381

MraZ

MraZ protein, putative antitoxin-like

77

144

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.8963 2 129
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.7905 2 129
5xep-assembly2.cif.gz_E crystal structure of brp39, a chitinase-like protein, at 2.6 angstorm resolution 0.5133 107 123
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.5131 1 118
5xep-assembly2.cif.gz_F crystal structure of brp39, a chitinase-like protein, at 2.6 angstorm resolution 0.508 107 123
ID Description Score Start End Superfamily
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8988 1 133 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.893 2 129 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8873 1 142 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8585 1 142 3.40.1550.20
af_P22186_1_143_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8462 1 139 3.40.1550.20
ID Description Score Start End GO Terms
AF-A0A521UPB5-F1-model_v4 Transcriptional regulator MraZ 0.9292 2 133 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A7C3GKK2-F1-model_v4 Transcriptional regulator MraZ 0.9279 2 130 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A3N5GDR6-F1-model_v4 Transcriptional regulator MraZ 0.9258 2 130 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2M6R9Q2-F1-model_v4 Transcriptional regulator MraZ 0.9256 2 130 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2E0GIA1-F1-model_v4 Transcriptional regulator MraZ 0.923 9 138 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143

Feature Viewer

pLDDT pTM Quality
90.79 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map