F446629

General Info

Members Datasets Scaffolds Average Seq Length
450 248 428 259

Family's Representative Sequence

Representative Sequence 3300035171|Ga0373946_0060297|Ga0373946_0060297_667_1548
Length 293
Sequence MAGRTDTQAAPKVTLWTNPAAPRPFRLWRGEGCGKGLKMSGHAAAIFRHPIKGFTPEALTSVRLAPGEGFPHDRIWAVENGPSGFDPAHPAFVPKQKFTVLALIAQVARIATRYDAATGVLRASAPGADDLLADLMQEAGRDAFAAWLTEQLGEDVRGTLKVVAAPGQHRFTDHPQGQVSIINLASVADLGRRMGAELDPRRFRANVYVEGWPAWAENQWTGQRLMLGSAQAQVFKSIVRCAATHVDPATAERDLDVTKALFDNFGHMFCGVYAQVTKPGALSLGDAVTRAPA

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221583 Caulobacter sp. Root655 Isolate Unclassified
9 2643221584 Caulobacter sp. Root656 Isolate Unclassified
10 2643221640 Caulobacter sp. Root342 Isolate Unclassified
11 2643221642 Caulobacter sp. Root343 Isolate Unclassified
12 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
13 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
14 2818991435 Caulobacter henricii 536 Isolate Unclassified
15 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
16 2849560528 Caulobacter zeae 410 Isolate Unclassified
17 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
18 2851153111 Caulobacter radicis 736 Isolate Unclassified
19 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
20 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
21 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
22 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
80 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
132 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
175 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
176 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
197 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
205 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
211 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
217 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
218 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
219 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
220 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
221 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
222 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
223 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
228 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
229 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
230 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
231 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
232 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
233 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
234 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
235 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
236 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
237 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
238 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
239 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
242 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0
Isolates 4.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22
Nodule 0
Rhizoplane 2.89
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 8.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10140596 3300003322 Bacteria 1320
2 Ga0055537_1001546 3300003773 Bacteria 8804
3 Ga0055536_1000911 3300003781 Bacteria 19115
4 Ga0055536_1001435 3300003781 Bacteria 14368
5 Ga0055530_10001800 3300003791 Bacteria 14862
6 Ga0055530_10007239 3300003791 Bacteria 4723
7 Ga0055530_10008847 3300003791 Bacteria 3963
8 Ga0055531_10001288 3300003794 Bacteria 18893
9 Ga0055531_10003395 3300003794 Bacteria 10179
10 Ga0055531_10009045 3300003794 Bacteria 5146
11 Ga0065165_1000413 3300005262 Bacteria 67911
12 Ga0065165_1000731 3300005262 Bacteria 45776
13 Ga0065165_1051739 3300005262 Bacteria 1163
14 Ga0070658_10301601 3300005327 Bacteria 1366
15 Ga0070670_100000020 3300005331 Bacteria 215458
16 Ga0070670_100016359 3300005331 Bacteria 6370
17 Ga0070670_100123994 3300005331 Bacteria 2229
18 Ga0070680_100023268 3300005336 Bacteria 4940
19 Ga0070680_100297814 3300005336 Bacteria 1367
20 Ga0068868_100102934 3300005338 Bacteria 2313
21 Ga0070668_100000108 3300005347 Bacteria 50828
22 Ga0070668_100001618 3300005347 Bacteria 16282
23 Ga0070668_100004507 3300005347 Bacteria 10328
24 Ga0070669_100008310 3300005353 Bacteria 7412
25 Ga0070669_100440131 3300005353 Unclassified 1073
26 Ga0070671_100022027 3300005355 Bacteria 5205
27 Ga0070671_100046265 3300005355 Bacteria 3618
28 Ga0070671_100065165 3300005355 Bacteria 3034
29 Ga0070659_100002556 3300005366 Bacteria 12935
30 Ga0070659_100031441 3300005366 Bacteria 4111
31 Ga0070667_100000163 3300005367 Bacteria 83059
32 Ga0070667_100004064 3300005367 Bacteria 12375
33 Ga0070667_100015105 3300005367 Bacteria 6378
34 Ga0070667_100138431 3300005367 Bacteria 2130
35 Ga0070667_100194123 3300005367 Bacteria 1800
36 Ga0070663_100101532 3300005455 Bacteria 2147
37 Ga0070678_100533362 3300005456 Bacteria 1040
38 Ga0070681_10022275 3300005458 Bacteria 6360
39 Ga0070679_100883726 3300005530 Bacteria 837
40 Ga0068853_100157667 3300005539 Unclassified 2046
41 Ga0068853_100226859 3300005539 Bacteria 1708
42 Ga0070665_100000015 3300005548 Bacteria 462744
43 Ga0070665_100000441 3300005548 Bacteria 60634
44 Ga0070665_100032944 3300005548 Bacteria 5212
45 Ga0068855_100070276 3300005563 Bacteria 4074
46 Ga0068855_100288579 3300005563 Bacteria 1820
47 Ga0068856_100183225 3300005614 Bacteria 2108
48 Ga0068852_100038996 3300005616 Bacteria 3996
49 Ga0068859_100000671 3300005617 Bacteria 34266
50 Ga0068859_100009336 3300005617 Bacteria 9902
51 Ga0068859_100107525 3300005617 Bacteria 2850
52 Ga0068859_100360275 3300005617 Bacteria 1549
53 Ga0068864_100000071 3300005618 Bacteria 111481
54 Ga0068864_100008464 3300005618 Bacteria 8490
55 Ga0068864_100031006 3300005618 Bacteria 4534
56 Ga0068861_100122735 3300005719 Bacteria 2098
57 Ga0068861_100408969 3300005719 Bacteria 1206
58 Ga0068851_10195253 3300005834 Bacteria 1127
59 Ga0068863_100000037 3300005841 Bacteria 162638
60 Ga0068863_100000451 3300005841 Bacteria 41841
61 Ga0068863_100021083 3300005841 Bacteria 6224
62 Ga0068863_100064681 3300005841 Bacteria 3459
63 Ga0068858_100000029 3300005842 Bacteria 144691
64 Ga0068858_100002275 3300005842 Bacteria 19425
65 Ga0068858_100006867 3300005842 Bacteria 11061
66 Ga0068858_100422474 3300005842 Bacteria 1282
67 Ga0068860_100001003 3300005843 Bacteria 31241
68 Ga0068860_100002441 3300005843 Bacteria 19525
69 Ga0068860_100009413 3300005843 Bacteria 9710
70 Ga0068860_100247428 3300005843 Bacteria 1735
71 Ga0068862_100000057 3300005844 Bacteria 140795
72 Ga0068862_100030882 3300005844 Bacteria 4517
73 Ga0068862_100091482 3300005844 Bacteria 2650
74 Ga0070717_10017847 3300006028 Bacteria 5532
75 Ga0070717_10111695 3300006028 Bacteria 2332
76 Ga0075368_10006829 3300006042 Bacteria 4009
77 Ga0075364_10009664 3300006051 Bacteria 5795
78 Ga0070712_100587260 3300006175 Bacteria 942
79 Ga0075367_10006951 3300006178 Bacteria 5762
80 Ga0075366_10009937 3300006195 Bacteria 5327
81 Ga0075366_10082445 3300006195 Bacteria 1921
82 Ga0075370_10050624 3300006353 Bacteria 2356
83 Ga0068865_100082273 3300006881 Bacteria 2314
84 Ga0068865_100304506 3300006881 Bacteria 1277
85 Ga0097620_100000671 3300006931 Bacteria 34266
86 Ga0097620_100009336 3300006931 Bacteria 9902
87 Ga0097620_100107524 3300006931 Bacteria 2850
88 Ga0097620_100360309 3300006931 Bacteria 1549
89 Ga0105240_10001340 3300009093 Bacteria 42221
90 Ga0105240_10010073 3300009093 Bacteria 13307
91 Ga0105240_10056843 3300009093 Bacteria 4894
92 Ga0105240_10121559 3300009093 Bacteria 3143
93 Ga0105240_10131977 3300009093 Bacteria 2995
94 Ga0105240_10183351 3300009093 Bacteria 2469
95 Ga0105240_10192658 3300009093 Bacteria 2396
96 Ga0105240_10593350 3300009093 Bacteria 1220
97 Ga0105247_10108879 3300009101 Bacteria 1781
98 Ga0105241_10439633 3300009174 Bacteria 1152
99 Ga0105248_10001636 3300009177 Bacteria 24907
100 Ga0105248_10003631 3300009177 Bacteria 17121
101 Ga0105248_10009715 3300009177 Bacteria 10596
102 Ga0105248_10010680 3300009177 Bacteria 10131
103 Ga0105248_10128381 3300009177 Bacteria 2860
104 Ga0105248_10239489 3300009177 Bacteria 2042
105 Ga0105237_10265465 3300009545 Bacteria 1719
106 Ga0105238_10002006 3300009551 Bacteria 20530
107 Ga0105238_10012701 3300009551 Bacteria 8500
108 Ga0105238_10032595 3300009551 Bacteria 5302
109 Ga0105249_10000792 3300009553 Bacteria 28363
110 Ga0105239_10252943 3300010375 Bacteria 1979
111 Ga0105239_10293309 3300010375 Bacteria 1831
112 Ga0157370_10367339 3300013104 Bacteria 1326
113 Ga0163162_10097670 3300013306 Bacteria 3026
114 Ga0157372_10015498 3300013307 Bacteria 8172
115 Ga0163163_10002745 3300014325 Bacteria 14860
116 Ga0163163_10060815 3300014325 Bacteria 3741
117 Ga0163163_10088102 3300014325 Bacteria 3115
118 Ga0163163_10187454 3300014325 Bacteria 2116
119 Ga0163163_10283556 3300014325 Bacteria 1708
120 Ga0157379_10000579 3300014968 Bacteria 29639
121 Ga0157379_10066106 3300014968 Bacteria 3232
122 Ga0157379_10220033 3300014968 Bacteria 1720
123 Ga0157379_10269652 3300014968 Bacteria 1548
124 Ga0213876_10020698 3300021384 Bacteria 3478
125 Ga0213875_10000182 3300021388 Bacteria 64147
126 Ga0209026_1000474 3300025250 Bacteria 30684
127 Ga0209673_1000979 3300025273 Bacteria 35212
128 Ga0209676_1000289 3300025292 Bacteria 103078
129 Ga0209676_1000799 3300025292 Bacteria 41601
130 Ga0209564_1008743 3300025295 Bacteria 4938
131 Ga0209564_1024742 3300025295 Bacteria 2044
132 Ga0209758_1003978 3300025297 Bacteria 12794
133 Ga0209758_1004642 3300025297 Bacteria 11249
134 Ga0209050_1000029 3300025298 Bacteria 465801
135 Ga0209050_1000724 3300025298 Bacteria 48231
136 Ga0209050_1001015 3300025298 Bacteria 35056
137 Ga0209050_1022828 3300025298 Bacteria 2227
138 Ga0209256_1004199 3300025299 Bacteria 9263
139 Ga0209256_1005763 3300025299 Bacteria 6919
140 Ga0209256_1011476 3300025299 Bacteria 3536
141 Ga0209051_1015403 3300025303 Bacteria 3517
142 Ga0209257_1000036 3300025304 Bacteria 616006
143 Ga0209257_1000152 3300025304 Bacteria 189432
144 Ga0209257_1000660 3300025304 Bacteria 54233
145 Ga0209257_1000903 3300025304 Bacteria 41596
146 Ga0209257_1007400 3300025304 Bacteria 6640
147 Ga0207699_10050355 3300025906 Bacteria 2456
148 Ga0207705_10032288 3300025909 Bacteria 3740
149 Ga0207705_10077770 3300025909 Bacteria 2414
150 Ga0207707_10073062 3300025912 Bacteria 2990
151 Ga0207707_10120574 3300025912 Bacteria 2293
152 Ga0207707_10123541 3300025912 Bacteria 2263
153 Ga0207695_10003819 3300025913 Bacteria 20878
154 Ga0207695_10008153 3300025913 Bacteria 13172
155 Ga0207695_10009530 3300025913 Bacteria 12008
156 Ga0207695_10100087 3300025913 Bacteria 2895
157 Ga0207660_10064231 3300025917 Bacteria 2649
158 Ga0207660_10100216 3300025917 Bacteria 2163
159 Ga0207657_10042708 3300025919 Bacteria 3998
160 Ga0207681_10142510 3300025923 Bacteria 1786
161 Ga0207694_10072099 3300025924 Bacteria 2700
162 Ga0207694_10096463 3300025924 Bacteria 2338
163 Ga0207694_10180483 3300025924 Bacteria 1712
164 Ga0207650_10000175 3300025925 Bacteria 75521
165 Ga0207650_10037016 3300025925 Bacteria 3553
166 Ga0207650_10068515 3300025925 Bacteria 2665
167 Ga0207664_10071807 3300025929 Bacteria 2789
168 Ga0207644_10161317 3300025931 Bacteria 1743
169 Ga0207690_10000887 3300025932 Bacteria 19086
170 Ga0207706_10088356 3300025933 Bacteria 2725
171 Ga0207704_10022695 3300025938 Bacteria 3368
172 Ga0207665_10111864 3300025939 Bacteria 1920
173 Ga0207711_10000978 3300025941 Bacteria 27393
174 Ga0207711_10001642 3300025941 Bacteria 20636
175 Ga0207711_10003500 3300025941 Bacteria 13594
176 Ga0207711_10013054 3300025941 Bacteria 6900
177 Ga0207667_10006902 3300025949 Bacteria 13714
178 Ga0207667_10110139 3300025949 Bacteria 2841
179 Ga0207712_10000376 3300025961 Bacteria 39304
180 Ga0207668_10000123 3300025972 Bacteria 54467
181 Ga0207668_10005201 3300025972 Bacteria 7654
182 Ga0207668_10006771 3300025972 Bacteria 6784
183 Ga0207668_10071587 3300025972 Bacteria 2477
184 Ga0207640_10261139 3300025981 Bacteria 1349
185 Ga0207658_10000118 3300025986 Bacteria 87228
186 Ga0207658_10014560 3300025986 Bacteria 5385
187 Ga0207658_10060628 3300025986 Bacteria 2824
188 Ga0207658_10384224 3300025986 Bacteria 1230
189 Ga0207703_10000079 3300026035 Bacteria 112451
190 Ga0207703_10002470 3300026035 Bacteria 16035
191 Ga0207703_10071077 3300026035 Bacteria 2874
192 Ga0207639_10401635 3300026041 Bacteria 1235
193 Ga0207702_10208367 3300026078 Bacteria 1816
194 Ga0207641_10000034 3300026088 Bacteria 217752
195 Ga0207641_10001419 3300026088 Bacteria 23630
196 Ga0207641_10027912 3300026088 Bacteria 4662
197 Ga0207641_10147610 3300026088 Bacteria 2128
198 Ga0207641_10707482 3300026088 Bacteria 992
199 Ga0207676_10000376 3300026095 Bacteria 38031
200 Ga0207676_10000506 3300026095 Bacteria 32940
201 Ga0207676_10068455 3300026095 Bacteria 2839
202 Ga0207676_10185947 3300026095 Bacteria 1824
203 Ga0207675_100065311 3300026118 Bacteria 3401
204 Ga0207683_10092016 3300026121 Bacteria 2702
205 Ga0207698_10063564 3300026142 Bacteria 2889
206 Ga0209999_1004916 3300027543 Bacteria 2404
207 Ga0209983_1015060 3300027665 Bacteria 1595
208 Ga0268266_10000005 3300028379 Bacteria 1448194
209 Ga0268266_10008699 3300028379 Bacteria 9000
210 Ga0268266_10050966 3300028379 Bacteria 3552
211 Ga0268266_10214048 3300028379 Bacteria 1768
212 Ga0268265_10001925 3300028380 Bacteria 16493
213 Ga0268265_10004919 3300028380 Bacteria 9186
214 Ga0268264_10000029 3300028381 Bacteria 419246
215 Ga0268264_10000481 3300028381 Bacteria 53088
216 Ga0268264_10024684 3300028381 Bacteria 4910
217 Ga0307517_10016140 3300028786 Bacteria 9843
218 Ga0307517_10030072 3300028786 Bacteria 6385
219 Ga0307517_10035496 3300028786 Bacteria 5642
220 Ga0307515_10023896 3300028794 Bacteria 10684
221 Ga0307515_10084117 3300028794 Bacteria 4091
222 Ga0307515_10135120 3300028794 Bacteria 2687
223 Ga0307511_10022238 3300030521 Bacteria 5945
224 Ga0265320_10000445 3300031240 Bacteria 32340
225 Ga0265325_10038582 3300031241 Bacteria 2520
226 Ga0265327_10002690 3300031251 Bacteria 18258
227 Ga0265327_10063743 3300031251 Bacteria 1870
228 Ga0307513_10000348 3300031456 Bacteria 67217
229 Ga0307513_10004937 3300031456 Bacteria 17710
230 Ga0307513_10006527 3300031456 Bacteria 15241
231 Ga0307513_10354469 3300031456 Bacteria 1214
232 Ga0265314_10032676 3300031711 Bacteria 3825
233 Ga0307414_10064669 3300032004 Bacteria 2605
234 Ga0307510_10012622 3300033180 Bacteria 10019
235 Ga0373936_0002059 3300035113 Bacteria 7453
236 Ga0373946_0060297 3300035171 Bacteria 1612
237 Ga0373927_0000622 3300035695 Bacteria 26882
238 Ga0373937_0043521 3300036401 Bacteria 4099
239 Ga0373925_0000067 3300037068 Bacteria 110348
240 Ga0395899_0000095 3300037312 Bacteria 152790
241 Ga0395900_0000006 3300037418 Bacteria 495364
242 Ga0395900_0033761 3300037418 Bacteria 5265
243 Ga0395898_0026222 3300037466 Bacteria 5867
244 Ga0395905_0003726 3300037471 Bacteria 16150
245 Ga0395905_0056563 3300037471 Bacteria 3669
246 Ga0395905_0089611 3300037471 Bacteria 2883
247 Ga0395905_0137107 3300037471 Bacteria 2302
248 Ga0395905_0161474 3300037471 Bacteria 2106
249 Ga0395905_0225847 3300037471 Bacteria 1752
250 Ga0395905_0248456 3300037471 Bacteria 1662
251 Ga0436364_0276897 3300037853 Bacteria 48262
252 Ga0436364_0474573 3300037853 Bacteria 1511
253 Ga0436364_1241179 3300037853 Bacteria 1014
254 Ga0395901_0000001 3300038443 Bacteria 800383
255 Ga0436365_0041576 3300039437 Bacteria 7684
256 Ga0436362_0122513 3300039453 Bacteria 2365
257 Ga0466970_0061464 3300044765 Bacteria 2013
258 Ga0495627_000321 3300046453 Bacteria 47021
259 Ga0495590_0001458 3300046457 Bacteria 10201
260 Ga0495638_0000900 3300046460 Bacteria 30396
261 Ga0495638_0001500 3300046460 Bacteria 21035
262 Ga0495638_0002395 3300046460 Bacteria 15355
263 Ga0495638_0050853 3300046460 Bacteria 2587
264 Ga0495638_0068867 3300046460 Bacteria 2169
265 Ga0495638_0115792 3300046460 Bacteria 1588
266 Ga0495650_0000068 3300046471 Bacteria 266671
267 Ga0495650_0083534 3300046471 Bacteria 1227
268 Ga0495585_0107453 3300046492 Bacteria 1487
269 Ga0495607_0116861 3300046501 Bacteria 1406
270 Ga0495583_0000002 3300046506 Bacteria 782521
271 Ga0495583_0023347 3300046506 Bacteria 3131
272 Ga0495606_0002435 3300046507 Bacteria 21634
273 Ga0495606_0030353 3300046507 Bacteria 3778
274 Ga0495610_0000260 3300046512 Bacteria 55537
275 Ga0495610_0000813 3300046512 Bacteria 29272
276 Ga0495610_0012390 3300046512 Bacteria 5136
277 Ga0495616_0000317 3300046513 Bacteria 38524
278 Ga0495620_0115249 3300046515 Bacteria 1062
279 Ga0495620_0155373 3300046515 Bacteria 890
280 Ga0495631_0007131 3300046518 Bacteria 5712
281 Ga0495632_0003901 3300046519 Bacteria 10362
282 Ga0495632_0020819 3300046519 Bacteria 3544
283 Ga0495637_0031739 3300046520 Bacteria 2333
284 Ga0495637_0050877 3300046520 Bacteria 1737
285 Ga0495648_0000067 3300046524 Bacteria 140250
286 Ga0495648_0029110 3300046524 Bacteria 3670
287 Ga0495642_0013931 3300046528 Bacteria 3114
288 Ga0495642_0096129 3300046528 Bacteria 1257
289 Ga0495654_0000042 3300046530 Bacteria 164346
290 Ga0495654_0039074 3300046530 Bacteria 2370
291 Ga0495665_0121018 3300046531 Bacteria 1371
292 Ga0495609_0027049 3300046538 Bacteria 2623
293 Ga0495609_0076376 3300046538 Bacteria 1468
294 Ga0495621_0117051 3300046539 Bacteria 1027
295 Ga0495597_0002477 3300046542 Bacteria 11654
296 Ga0495597_0015465 3300046542 Bacteria 3613
297 Ga0495668_0000026 3300046616 Bacteria 297287
298 Ga0495668_0001967 3300046616 Bacteria 18099
299 Ga0495668_0013362 3300046616 Bacteria 4847
300 Ga0495611_0043225 3300046648 Bacteria 2014
301 Ga0495625_0000127 3300046660 Bacteria 118526
302 Ga0495625_0018903 3300046660 Bacteria 5363
303 Ga0495625_0026427 3300046660 Bacteria 4386
304 Ga0495625_0057806 3300046660 Bacteria 2757
305 Ga0495625_0057893 3300046660 Bacteria 2754
306 Ga0495625_0099312 3300046660 Bacteria 2001
307 Ga0495625_0146712 3300046660 Bacteria 1588
308 Ga0495659_0066593 3300046664 Bacteria 1342
309 Ga0495623_0343177 3300046679 Bacteria 815
310 Ga0495669_0065510 3300046684 Bacteria 1649
311 Ga0495613_0001327 3300046689 Bacteria 18911
312 Ga0495671_0035677 3300046692 Bacteria 2524
313 Ga0495649_0000048 3300046694 Bacteria 118180
314 Ga0495589_0010353 3300046794 Bacteria 4842
315 Ga0495660_0001869 3300046810 Bacteria 13827
316 Ga0495660_0158927 3300046810 Bacteria 1110
317 Ga0495672_0003400 3300047320 Bacteria 13661
318 Ga0495683_0060009 3300047323 Bacteria 1886
319 Ga0495687_099777 3300047443 Bacteria 1092
320 Ga0495679_024475 3300047446 Bacteria 2033
321 Ga0495673_0000208 3300047469 Bacteria 88985
322 Ga0495673_0000293 3300047469 Bacteria 67070
323 Ga0495673_0002253 3300047469 Bacteria 13844
324 Ga0495681_0141429 3300047470 Bacteria 1016
325 Ga0495686_0001397 3300047472 Bacteria 26707
326 Ga0495686_0002164 3300047472 Bacteria 19143
327 Ga0495686_0008686 3300047472 Bacteria 7416
328 Ga0495686_0012327 3300047472 Bacteria 5984
329 Ga0496102_0152475 3300048905 Bacteria 2172
330 Ga0496102_0230738 3300048905 Bacteria 1745
331 Ga0496102_0629574 3300048905 Bacteria 996
332 Ga0496103_0172229 3300048906 Bacteria 1390
333 Ga0496107_0100456 3300048910 Bacteria 2121
334 Ga0496109_0439652 3300048912 Bacteria 1232
335 Ga0496112_0054527 3300048915 Bacteria 3928
336 Ga0496112_0173091 3300048915 Bacteria 2124
337 Ga0496112_0339236 3300048915 Bacteria 1446
338 Ga0496115_0001146 3300048918 Bacteria 19143
339 Ga0496115_0009027 3300048918 Bacteria 7396
340 Ga0496115_0012869 3300048918 Bacteria 6309
341 Ga0496115_0057933 3300048918 Bacteria 3117
342 Ga0496117_0060786 3300048920 Bacteria 2601
343 Ga0496118_0085799 3300048921 Bacteria 2190
344 Ga0496121_0000130 3300048924 Bacteria 168094
345 Ga0496121_0002319 3300048924 Bacteria 29484
346 Ga0496124_0013045 3300048927 Bacteria 8142
347 Ga0496125_0010944 3300048928 Bacteria 9116
348 Ga0495678_000358 3300049459 Bacteria 46919
349 Ga0501032_0169477 3300049569 Bacteria 1432
350 Ga0501039_0105217 3300049575 Bacteria 2204
351 Ga0501041_0242431 3300049577 Bacteria 1133
352 Ga0501046_0178770 3300049580 Bacteria 1588
353 Ga0501047_0000825 3300049581 Bacteria 32128
354 Ga0501047_0238470 3300049581 Bacteria 1670
355 Ga0501048_0130769 3300049582 Bacteria 1775
356 Ga0501076_0058210 3300049592 Bacteria 3071
357 Ga0501077_0377057 3300049593 Archaea 906
358 Ga0501238_001095 3300049671 Bacteria 3083
359 Ga0501238_001121 3300049671 Bacteria 3046
360 Ga0501079_0060955 3300049741 Bacteria 2911
361 Ga0501080_0180357 3300049742 Bacteria 1944
362 Ga0501035_0234198 3300049822 Bacteria 1564
363 Ga0501035_0311235 3300049822 Bacteria 1325
364 Ga0501044_0009852 3300049823 Bacteria 10387
365 Ga0501044_0352212 3300049823 Bacteria 1392
366 nmdc:mga00v17_2280_c1 3300050491 Bacteria 9840
367 nmdc:mga0k408_77644_c1 3300050493 Bacteria 1942
368 nmdc:mga04h51_124602_c1 3300050495 Bacteria 963
369 nmdc:mga07m45_1914_c1 3300050496 Bacteria 9617
370 nmdc:mga0sz30_13073_c1 3300050516 Bacteria 2940
371 Ga0495612_0115730 3300053078 Bacteria 1151
372 Ga0500635_0000328 3300053080 Bacteria 16376
373 Ga0500578_0000309 3300053086 Bacteria 59973
374 Ga0500643_001070 3300053087 Bacteria 16546
375 Ga0500643_009976 3300053087 Bacteria 3578
376 Ga0500643_059667 3300053087 Bacteria 1073
377 Ga0500644_0000036 3300053088 Bacteria 80681
378 Ga0500651_0098363 3300053093 Bacteria 1796
379 Ga0500641_0000276 3300053096 Bacteria 19065
380 Ga0500641_0003962 3300053096 Bacteria 5235
381 Ga0500641_0017893 3300053096 Bacteria 2658
382 Ga0500654_150621 3300053099 Bacteria 819
383 Ga0500554_000945 3300053102 Bacteria 5666
384 Ga0500555_055864 3300053103 Bacteria 1071
385 Ga0500556_0000382 3300053104 Bacteria 32379
386 Ga0500556_0002210 3300053104 Bacteria 6510
387 Ga0500556_0040116 3300053104 Bacteria 1644
388 Ga0500556_0071464 3300053104 Bacteria 1297
389 Ga0500562_001228 3300053108 Bacteria 6311
390 Ga0500562_006458 3300053108 Bacteria 2954
391 Ga0500562_016878 3300053108 Bacteria 1878
392 Ga0500569_001104 3300053109 Bacteria 4939
393 Ga0500594_0000141 3300053118 Bacteria 19985
394 Ga0500595_011120 3300053119 Bacteria 3538
395 Ga0500595_056365 3300053119 Bacteria 1201
396 Ga0500597_143611 3300053120 Bacteria 1027
397 Ga0500608_000107 3300053122 Bacteria 33885
398 Ga0500608_001574 3300053122 Bacteria 8182
399 Ga0500614_001953 3300053123 Bacteria 4732
400 Ga0500618_000074 3300053125 Bacteria 81608
401 Ga0500658_0005513 3300053134 Bacteria 4711
402 Ga0500559_0000086 3300053136 Bacteria 73688
403 Ga0500559_0003341 3300053136 Bacteria 7942
404 Ga0500559_0003905 3300053136 Bacteria 7203
405 Ga0500564_000359 3300053138 Bacteria 12852
406 Ga0500577_0009185 3300053142 Bacteria 2859
407 Ga0500604_0022964 3300053151 Bacteria 1776
408 Ga0500616_0016531 3300053153 Bacteria 4197
409 Ga0500616_0018299 3300053153 Bacteria 3963
410 Ga0500616_0150345 3300053153 Bacteria 1078
411 Ga0500622_0000608 3300053156 Bacteria 32512
412 Ga0500622_0008039 3300053156 Bacteria 5934
413 Ga0500622_0010260 3300053156 Bacteria 5148
414 Ga0500622_0010639 3300053156 Bacteria 5041
415 Ga0500622_0020783 3300053156 Bacteria 3484
416 Ga0500622_0036601 3300053156 Bacteria 2565
417 Ga0500624_018748 3300053157 Bacteria 1093
418 Ga0500627_0066975 3300053158 Bacteria 1586
419 Ga0500636_0012284 3300053177 Bacteria 5017
420 Ga0500637_0082082 3300053178 Bacteria 1862
421 Ga0500637_0094752 3300053178 Bacteria 1729
422 Ga0500625_017716 3300053729 Bacteria 3330
423 Ga0500645_000131 3300053730 Bacteria 58717
424 Ga0500645_002140 3300053730 Bacteria 9078
425 Ga0500645_002401 3300053730 Bacteria 8406
426 Ga0500645_002611 3300053730 Bacteria 7899
427 Ga0500609_001219 3300053731 Bacteria 3828
428 Ga0530510_0363823 3300061734 Bacteria 1087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10022275 Ga0070681_100222752 228
2 3300005539 Ga0068853_100157667 Ga0068853_1001576672 228
3 3300009093 Ga0105240_10183351 Ga0105240_101833512 228
4 3300025912 Ga0207707_10123541 Ga0207707_101235412 228
5 3300025913 Ga0207695_10009530 Ga0207695_100095309 228
6 3300049581 Ga0501047_0000825 Ga0501047_0000825_22736_23533 231
7 3300005366 Ga0070659_100002556 Ga0070659_1000025564 233
8 3300005530 Ga0070679_100883726 Ga0070679_1008837261 233
9 3300005548 Ga0070665_100000015 Ga0070665_100000015387 233
10 3300009093 Ga0105240_10121559 Ga0105240_101215593 233
11 3300025913 Ga0207695_10100087 Ga0207695_101000872 233
12 3300025919 Ga0207657_10042708 Ga0207657_100427083 233
13 3300025924 Ga0207694_10096463 Ga0207694_100964632 233
14 3300025932 Ga0207690_10000887 Ga0207690_100008878 233
15 3300028379 Ga0268266_10000005 Ga0268266_10000005731 233
16 3300048918 Ga0496115_0009027 Ga0496115_0009027_5956_6756 233
17 3300005367 Ga0070667_100138431 Ga0070667_1001384312 234
18 3300025972 Ga0207668_10071587 Ga0207668_100715872 234
19 3300025986 Ga0207658_10060628 Ga0207658_100606283 234
20 3300044765 Ga0466970_0061464 Ga0466970_0061464_1176_1961 235
21 3300010375 Ga0105239_10252943 Ga0105239_102529432 236
22 3300037466 Ga0395898_0026222 Ga0395898_0026222_4312_5103 236
23 3300006042 Ga0075368_10006829 Ga0075368_100068295 239
24 3300006051 Ga0075364_10009664 Ga0075364_100096647 239
25 3300026095 Ga0207676_10185947 Ga0207676_101859472 239
26 3300050491 nmdc:mga00v17_2280_c1 nmdc:mga00v17_2280_c1_4920_5723 239
27 3300050495 nmdc:mga04h51_124602_c1 nmdc:mga04h51_124602_c1_124_927 239
28 3300050516 nmdc:mga0sz30_13073_c1 nmdc:mga0sz30_13073_c1_1891_2694 239
29 3300005262 Ga0065165_1000413 Ga0065165_100041346 240
30 3300006178 Ga0075367_10006951 Ga0075367_100069515 240
31 3300003791 Ga0055530_10001800 Ga0055530_1000180014 241
32 3300003794 Ga0055531_10009045 Ga0055531_100090453 241
33 3300025297 Ga0209758_1003978 Ga0209758_10039783 241
34 3300025298 Ga0209050_1000029 Ga0209050_1000029139 241
35 3300025304 Ga0209257_1000152 Ga0209257_1000152177 241
36 3300037418 Ga0395900_0033761 Ga0395900_0033761_860_1651 241
37 3300037471 Ga0395905_0056563 Ga0395905_0056563_1079_1870 241
38 3300046679 Ga0495623_0343177 Ga0495623_0343177_35_799 241
39 3300053099 Ga0500654_150621 Ga0500654_150621_76_807 241
40 3300005834 Ga0068851_10195253 Ga0068851_101952532 242
41 3300028786 Ga0307517_10030072 Ga0307517_100300728 242
42 3300009551 Ga0105238_10032595 Ga0105238_100325954 243
43 3300037471 Ga0395905_0161474 Ga0395905_0161474_794_1567 245
44 3300005539 Ga0068853_100226859 Ga0068853_1002268591 246
45 3300049581 Ga0501047_0238470 Ga0501047_0238470_246_1040 246
46 3300049582 Ga0501048_0130769 Ga0501048_0130769_135_929 246
47 3300006175 Ga0070712_100587260 Ga0070712_1005872601 249
48 3300010375 Ga0105239_10293309 Ga0105239_102933091 249
49 3300021388 Ga0213875_10000182 Ga0213875_100001828 249
50 3300025906 Ga0207699_10050355 Ga0207699_100503552 249
51 3300025929 Ga0207664_10071807 Ga0207664_100718073 249
52 3300037853 Ga0436364_0276897 Ga0436364_0276897_918_1676 249
53 3300037853 Ga0436364_1241179 Ga0436364_1241179_238_996 249
54 3300053078 Ga0495612_0115730 Ga0495612_0115730_300_1058 249
55 iso_pu_bacteria 2510917020 2511125497 249
56 iso_pu_bacteria 2582581279 2585146456 249
57 iso_pu_bacteria 2582581293 2585194554 249
58 iso_pu_bacteria 2585428106 2587918477 249
59 iso_pu_bacteria 2643221545 2643748582 249
60 iso_pu_bacteria 2643221552 2643779477 249
61 iso_pu_bacteria 2643221583 2643923593 249
62 iso_pu_bacteria 2643221640 2644224962 249
63 iso_pu_bacteria 2643221642 2644234104 249
64 iso_pu_bacteria 2643221691 2644510255 249
65 iso_pu_bacteria 2791355048 2792462906 249
66 iso_pu_bacteria 2849560528 2849561833 249
67 iso_pu_bacteria 2849573788 2849574101 249
68 iso_pu_bacteria 2851153111 2851157783 249
69 iso_pu_bacteria 2884960567 2884962413 249
70 iso_pu_bacteria 2898329390 2898332574 249
71 3300025939 Ga0207665_10111864 Ga0207665_101118642 250
72 3300049575 Ga0501039_0105217 Ga0501039_0105217_1253_2017 250
73 3300049577 Ga0501041_0242431 Ga0501041_0242431_283_1047 250
74 3300049580 Ga0501046_0178770 Ga0501046_0178770_205_969 250
75 3300049592 Ga0501076_0058210 Ga0501076_0058210_2233_2997 250
76 3300049593 Ga0501077_0377057 Ga0501077_0377057_16_780 250
77 3300049741 Ga0501079_0060955 Ga0501079_0060955_1082_1846 250
78 3300049742 Ga0501080_0180357 Ga0501080_0180357_908_1672 250
79 3300061734 Ga0530510_0363823 Ga0530510_0363823_93_857 250
80 3300005347 Ga0070668_100001618 Ga0070668_10000161816 251
81 3300005617 Ga0068859_100360275 Ga0068859_1003602752 251
82 3300005843 Ga0068860_100001003 Ga0068860_10000100321 251
83 3300005843 Ga0068860_100002441 Ga0068860_10000244114 251
84 3300005844 Ga0068862_100030882 Ga0068862_1000308825 251
85 3300006931 Ga0097620_100360309 Ga0097620_1003603092 251
86 3300028380 Ga0268265_10001925 Ga0268265_1000192510 251
87 3300028381 Ga0268264_10000029 Ga0268264_10000029347 251
88 3300028381 Ga0268264_10000481 Ga0268264_1000048122 251
89 3300031240 Ga0265320_10000445 Ga0265320_1000044523 251
90 3300031241 Ga0265325_10038582 Ga0265325_100385824 251
91 3300046460 Ga0495638_0068867 Ga0495638_0068867_1342_2100 251
92 3300046694 Ga0495649_0000048 Ga0495649_0000048_50848_51606 251
93 iso_pu_bacteria 2928531327 2928533217 251
94 3300005331 Ga0070670_100016359 Ga0070670_1000163592 252
95 3300005347 Ga0070668_100004507 Ga0070668_1000045074 252
96 3300005353 Ga0070669_100008310 Ga0070669_1000083102 252
97 3300005355 Ga0070671_100022027 Ga0070671_1000220272 252
98 3300005367 Ga0070667_100004064 Ga0070667_10000406413 252
99 3300005617 Ga0068859_100000671 Ga0068859_10000067134 252
100 3300005841 Ga0068863_100021083 Ga0068863_1000210833 252
101 3300005842 Ga0068858_100006867 Ga0068858_1000068672 252
102 3300005843 Ga0068860_100247428 Ga0068860_1002474282 252
103 3300005844 Ga0068862_100091482 Ga0068862_1000914821 252
104 3300006931 Ga0097620_100000671 Ga0097620_10000067134 252
105 3300009177 Ga0105248_10003631 Ga0105248_1000363113 252
106 3300013306 Ga0163162_10097670 Ga0163162_100976702 252
107 3300014325 Ga0163163_10002745 Ga0163163_100027452 252
108 3300014968 Ga0157379_10000579 Ga0157379_1000057922 252
109 3300021384 Ga0213876_10020698 Ga0213876_100206982 252
110 3300025923 Ga0207681_10142510 Ga0207681_101425102 252
111 3300025925 Ga0207650_10068515 Ga0207650_100685153 252
112 3300025941 Ga0207711_10003500 Ga0207711_1000350011 252
113 3300025972 Ga0207668_10005201 Ga0207668_100052016 252
114 3300026088 Ga0207641_10027912 Ga0207641_100279125 252
115 3300032004 Ga0307414_10064669 Ga0307414_100646693 252
116 3300039437 Ga0436365_0041576 Ga0436365_0041576_512_1297 252
117 3300039453 Ga0436362_0122513 Ga0436362_0122513_1469_2281 252
118 3300053096 Ga0500641_0000276 Ga0500641_0000276_322_1137 252
119 3300003773 Ga0055537_1001546 Ga0055537_10015465 253
120 3300003781 Ga0055536_1000911 Ga0055536_10009114 253
121 3300003791 Ga0055530_10008847 Ga0055530_100088473 253
122 3300005262 Ga0065165_1000731 Ga0065165_100073135 253
123 3300005262 Ga0065165_1051739 Ga0065165_10517391 253
124 3300005327 Ga0070658_10301601 Ga0070658_103016012 253
125 3300005331 Ga0070670_100000020 Ga0070670_100000020141 253
126 3300005331 Ga0070670_100123994 Ga0070670_1001239942 253
127 3300005336 Ga0070680_100023268 Ga0070680_1000232682 253
128 3300005336 Ga0070680_100297814 Ga0070680_1002978142 253
129 3300005338 Ga0068868_100102934 Ga0068868_1001029342 253
130 3300005347 Ga0070668_100000108 Ga0070668_10000010833 253
131 3300005353 Ga0070669_100440131 Ga0070669_1004401312 253
132 3300005355 Ga0070671_100046265 Ga0070671_1000462654 253
133 3300005355 Ga0070671_100065165 Ga0070671_1000651652 253
134 3300005366 Ga0070659_100031441 Ga0070659_1000314412 253
135 3300005367 Ga0070667_100000163 Ga0070667_10000016338 253
136 3300005367 Ga0070667_100015105 Ga0070667_1000151053 253
137 3300005455 Ga0070663_100101532 Ga0070663_1001015322 253
138 3300005456 Ga0070678_100533362 Ga0070678_1005333622 253
139 3300005548 Ga0070665_100000441 Ga0070665_10000044148 253
140 3300005548 Ga0070665_100032944 Ga0070665_1000329444 253
141 3300005563 Ga0068855_100070276 Ga0068855_1000702761 253
142 3300005563 Ga0068855_100288579 Ga0068855_1002885792 253
143 3300005614 Ga0068856_100183225 Ga0068856_1001832252 253
144 3300005616 Ga0068852_100038996 Ga0068852_1000389962 253
145 3300005617 Ga0068859_100009336 Ga0068859_10000933611 253
146 3300005617 Ga0068859_100107525 Ga0068859_1001075251 253
147 3300005618 Ga0068864_100000071 Ga0068864_10000007131 253
148 3300005618 Ga0068864_100008464 Ga0068864_1000084647 253
149 3300005618 Ga0068864_100031006 Ga0068864_1000310063 253
150 3300005719 Ga0068861_100122735 Ga0068861_1001227352 253
151 3300005719 Ga0068861_100408969 Ga0068861_1004089692 253
152 3300005841 Ga0068863_100000037 Ga0068863_100000037101 253
153 3300005841 Ga0068863_100000451 Ga0068863_10000045139 253
154 3300005841 Ga0068863_100064681 Ga0068863_1000646813 253
155 3300005842 Ga0068858_100000029 Ga0068858_10000002944 253
156 3300005842 Ga0068858_100002275 Ga0068858_10000227516 253
157 3300005843 Ga0068860_100009413 Ga0068860_1000094133 253
158 3300005844 Ga0068862_100000057 Ga0068862_1000000572 253
159 3300006028 Ga0070717_10017847 Ga0070717_100178472 253
160 3300006195 Ga0075366_10009937 Ga0075366_100099373 253
161 3300006195 Ga0075366_10082445 Ga0075366_100824452 253
162 3300006353 Ga0075370_10050624 Ga0075370_100506242 253
163 3300006881 Ga0068865_100082273 Ga0068865_1000822733 253
164 3300006881 Ga0068865_100304506 Ga0068865_1003045062 253
165 3300006931 Ga0097620_100009336 Ga0097620_10000933611 253
166 3300006931 Ga0097620_100107524 Ga0097620_1001075241 253
167 3300009093 Ga0105240_10010073 Ga0105240_100100737 253
168 3300009093 Ga0105240_10056843 Ga0105240_100568436 253
169 3300009093 Ga0105240_10131977 Ga0105240_101319773 253
170 3300009093 Ga0105240_10192658 Ga0105240_101926583 253
171 3300009093 Ga0105240_10593350 Ga0105240_105933502 253
172 3300009101 Ga0105247_10108879 Ga0105247_101088792 253
173 3300009174 Ga0105241_10439633 Ga0105241_104396331 253
174 3300009177 Ga0105248_10009715 Ga0105248_100097152 253
175 3300009177 Ga0105248_10010680 Ga0105248_100106807 253
176 3300009177 Ga0105248_10128381 Ga0105248_101283812 253
177 3300009177 Ga0105248_10239489 Ga0105248_102394892 253
178 3300009545 Ga0105237_10265465 Ga0105237_102654652 253
179 3300009551 Ga0105238_10002006 Ga0105238_1000200617 253
180 3300009551 Ga0105238_10012701 Ga0105238_100127013 253
181 3300009553 Ga0105249_10000792 Ga0105249_100007922 253
182 3300013104 Ga0157370_10367339 Ga0157370_103673392 253
183 3300013307 Ga0157372_10015498 Ga0157372_100154982 253
184 3300014325 Ga0163163_10060815 Ga0163163_100608152 253
185 3300014325 Ga0163163_10088102 Ga0163163_100881022 253
186 3300014325 Ga0163163_10187454 Ga0163163_101874543 253
187 3300014325 Ga0163163_10283556 Ga0163163_102835562 253
188 3300014968 Ga0157379_10066106 Ga0157379_100661063 253
189 3300014968 Ga0157379_10220033 Ga0157379_102200332 253
190 3300014968 Ga0157379_10269652 Ga0157379_102696522 253
191 3300025250 Ga0209026_1000474 Ga0209026_100047411 253
192 3300025292 Ga0209676_1000289 Ga0209676_100028960 253
193 3300025295 Ga0209564_1008743 Ga0209564_10087432 253
194 3300025295 Ga0209564_1024742 Ga0209564_10247422 253
195 3300025297 Ga0209758_1004642 Ga0209758_10046422 253
196 3300025298 Ga0209050_1000724 Ga0209050_100072419 253
197 3300025298 Ga0209050_1022828 Ga0209050_10228282 253
198 3300025299 Ga0209256_1004199 Ga0209256_10041996 253
199 3300025299 Ga0209256_1011476 Ga0209256_10114765 253
200 3300025303 Ga0209051_1015403 Ga0209051_10154034 253
201 3300025304 Ga0209257_1000036 Ga0209257_1000036451 253
202 3300025304 Ga0209257_1000660 Ga0209257_100066021 253
203 3300025304 Ga0209257_1007400 Ga0209257_10074007 253
204 3300025909 Ga0207705_10032288 Ga0207705_100322882 253
205 3300025909 Ga0207705_10077770 Ga0207705_100777701 253
206 3300025912 Ga0207707_10073062 Ga0207707_100730622 253
207 3300025912 Ga0207707_10120574 Ga0207707_101205742 253
208 3300025913 Ga0207695_10008153 Ga0207695_100081538 253
209 3300025917 Ga0207660_10064231 Ga0207660_100642313 253
210 3300025917 Ga0207660_10100216 Ga0207660_101002162 253
211 3300025924 Ga0207694_10072099 Ga0207694_100720993 253
212 3300025924 Ga0207694_10180483 Ga0207694_101804832 253
213 3300025925 Ga0207650_10000175 Ga0207650_1000017537 253
214 3300025925 Ga0207650_10037016 Ga0207650_100370164 253
215 3300025931 Ga0207644_10161317 Ga0207644_101613172 253
216 3300025933 Ga0207706_10088356 Ga0207706_100883561 253
217 3300025938 Ga0207704_10022695 Ga0207704_100226952 253
218 3300025941 Ga0207711_10000978 Ga0207711_1000097824 253
219 3300025941 Ga0207711_10001642 Ga0207711_1000164210 253
220 3300025941 Ga0207711_10013054 Ga0207711_100130543 253
221 3300025949 Ga0207667_10006902 Ga0207667_1000690214 253
222 3300025949 Ga0207667_10110139 Ga0207667_101101392 253
223 3300025961 Ga0207712_10000376 Ga0207712_1000037638 253
224 3300025972 Ga0207668_10000123 Ga0207668_1000012323 253
225 3300025972 Ga0207668_10006771 Ga0207668_100067714 253
226 3300025981 Ga0207640_10261139 Ga0207640_102611392 253
227 3300025986 Ga0207658_10000118 Ga0207658_1000011852 253
228 3300025986 Ga0207658_10014560 Ga0207658_100145604 253
229 3300026035 Ga0207703_10000079 Ga0207703_1000007995 253
230 3300026035 Ga0207703_10002470 Ga0207703_1000247016 253
231 3300026035 Ga0207703_10071077 Ga0207703_100710772 253
232 3300026041 Ga0207639_10401635 Ga0207639_104016351 253
233 3300026078 Ga0207702_10208367 Ga0207702_102083672 253
234 3300026088 Ga0207641_10000034 Ga0207641_1000003499 253
235 3300026088 Ga0207641_10001419 Ga0207641_1000141919 253
236 3300026088 Ga0207641_10147610 Ga0207641_101476102 253
237 3300026088 Ga0207641_10707482 Ga0207641_107074822 253
238 3300026095 Ga0207676_10000376 Ga0207676_1000037628 253
239 3300026095 Ga0207676_10000506 Ga0207676_1000050626 253
240 3300026095 Ga0207676_10068455 Ga0207676_100684553 253
241 3300026118 Ga0207675_100065311 Ga0207675_1000653113 253
242 3300026121 Ga0207683_10092016 Ga0207683_100920162 253
243 3300026142 Ga0207698_10063564 Ga0207698_100635642 253
244 3300027543 Ga0209999_1004916 Ga0209999_10049162 253
245 3300027665 Ga0209983_1015060 Ga0209983_10150602 253
246 3300028379 Ga0268266_10008699 Ga0268266_100086993 253
247 3300028379 Ga0268266_10050966 Ga0268266_100509662 253
248 3300028379 Ga0268266_10214048 Ga0268266_102140482 253
249 3300028380 Ga0268265_10004919 Ga0268265_100049192 253
250 3300028381 Ga0268264_10024684 Ga0268264_100246843 253
251 3300028786 Ga0307517_10016140 Ga0307517_100161404 253
252 3300028786 Ga0307517_10035496 Ga0307517_100354964 253
253 3300028794 Ga0307515_10023896 Ga0307515_100238962 253
254 3300028794 Ga0307515_10084117 Ga0307515_100841172 253
255 3300028794 Ga0307515_10135120 Ga0307515_101351202 253
256 3300030521 Ga0307511_10022238 Ga0307511_100222382 253
257 3300031251 Ga0265327_10063743 Ga0265327_100637432 253
258 3300031456 Ga0307513_10000348 Ga0307513_1000034849 253
259 3300031456 Ga0307513_10004937 Ga0307513_100049375 253
260 3300031456 Ga0307513_10006527 Ga0307513_100065276 253
261 3300031456 Ga0307513_10354469 Ga0307513_103544692 253
262 3300031711 Ga0265314_10032676 Ga0265314_100326762 253
263 3300033180 Ga0307510_10012622 Ga0307510_100126222 253
264 3300035113 Ga0373936_0002059 Ga0373936_0002059_184_957 253
265 3300036401 Ga0373937_0043521 Ga0373937_0043521_1605_2417 253
266 3300037471 Ga0395905_0089611 Ga0395905_0089611_423_1214 253
267 3300037471 Ga0395905_0137107 Ga0395905_0137107_563_1348 253
268 3300037471 Ga0395905_0225847 Ga0395905_0225847_316_1086 253
269 3300037471 Ga0395905_0248456 Ga0395905_0248456_245_1030 253
270 3300037853 Ga0436364_0474573 Ga0436364_0474573_638_1441 253
271 3300046453 Ga0495627_000321 Ga0495627_000321_10564_11325 253
272 3300046457 Ga0495590_0001458 Ga0495590_0001458_8955_9716 253
273 3300046460 Ga0495638_0000900 Ga0495638_0000900_21772_22533 253
274 3300046460 Ga0495638_0001500 Ga0495638_0001500_11404_12165 253
275 3300046460 Ga0495638_0002395 Ga0495638_0002395_13516_14277 253
276 3300046460 Ga0495638_0050853 Ga0495638_0050853_316_1077 253
277 3300046460 Ga0495638_0115792 Ga0495638_0115792_94_855 253
278 3300046471 Ga0495650_0000068 Ga0495650_0000068_81697_82458 253
279 3300046471 Ga0495650_0083534 Ga0495650_0083534_100_861 253
280 3300046492 Ga0495585_0107453 Ga0495585_0107453_638_1435 253
281 3300046501 Ga0495607_0116861 Ga0495607_0116861_436_1197 253
282 3300046506 Ga0495583_0000002 Ga0495583_0000002_619872_620642 253
283 3300046507 Ga0495606_0002435 Ga0495606_0002435_9915_10676 253
284 3300046507 Ga0495606_0030353 Ga0495606_0030353_1199_1960 253
285 3300046512 Ga0495610_0000260 Ga0495610_0000260_23049_23810 253
286 3300046512 Ga0495610_0000813 Ga0495610_0000813_14016_14777 253
287 3300046512 Ga0495610_0012390 Ga0495610_0012390_3121_3882 253
288 3300046513 Ga0495616_0000317 Ga0495616_0000317_25707_26468 253
289 3300046515 Ga0495620_0115249 Ga0495620_0115249_275_1036 253
290 3300046515 Ga0495620_0155373 Ga0495620_0155373_31_816 253
291 3300046518 Ga0495631_0007131 Ga0495631_0007131_320_1081 253
292 3300046519 Ga0495632_0003901 Ga0495632_0003901_1668_2429 253
293 3300046519 Ga0495632_0020819 Ga0495632_0020819_1543_2304 253
294 3300046520 Ga0495637_0031739 Ga0495637_0031739_534_1295 253
295 3300046520 Ga0495637_0050877 Ga0495637_0050877_854_1615 253
296 3300046524 Ga0495648_0000067 Ga0495648_0000067_125557_126318 253
297 3300046524 Ga0495648_0029110 Ga0495648_0029110_446_1207 253
298 3300046528 Ga0495642_0013931 Ga0495642_0013931_1823_2626 253
299 3300046528 Ga0495642_0096129 Ga0495642_0096129_322_1125 253
300 3300046530 Ga0495654_0000042 Ga0495654_0000042_121294_122055 253
301 3300046530 Ga0495654_0039074 Ga0495654_0039074_530_1291 253
302 3300046531 Ga0495665_0121018 Ga0495665_0121018_192_1004 253
303 3300046538 Ga0495609_0027049 Ga0495609_0027049_445_1257 253
304 3300046538 Ga0495609_0076376 Ga0495609_0076376_221_982 253
305 3300046539 Ga0495621_0117051 Ga0495621_0117051_164_949 253
306 3300046542 Ga0495597_0002477 Ga0495597_0002477_3772_4584 253
307 3300046542 Ga0495597_0015465 Ga0495597_0015465_676_1437 253
308 3300046616 Ga0495668_0001967 Ga0495668_0001967_13942_14703 253
309 3300046616 Ga0495668_0013362 Ga0495668_0013362_3380_4141 253
310 3300046648 Ga0495611_0043225 Ga0495611_0043225_544_1338 253
311 3300046660 Ga0495625_0000127 Ga0495625_0000127_88198_88974 253
312 3300046660 Ga0495625_0018903 Ga0495625_0018903_782_1543 253
313 3300046660 Ga0495625_0026427 Ga0495625_0026427_1511_2272 253
314 3300046660 Ga0495625_0057806 Ga0495625_0057806_1714_2475 253
315 3300046660 Ga0495625_0057893 Ga0495625_0057893_1130_1891 253
316 3300046660 Ga0495625_0099312 Ga0495625_0099312_485_1246 253
317 3300046660 Ga0495625_0146712 Ga0495625_0146712_748_1509 253
318 3300046664 Ga0495659_0066593 Ga0495659_0066593_243_1046 253
319 3300046684 Ga0495669_0065510 Ga0495669_0065510_612_1424 253
320 3300046689 Ga0495613_0001327 Ga0495613_0001327_8131_8922 253
321 3300046692 Ga0495671_0035677 Ga0495671_0035677_305_1066 253
322 3300046794 Ga0495589_0010353 Ga0495589_0010353_2954_3715 253
323 3300046810 Ga0495660_0001869 Ga0495660_0001869_7843_8604 253
324 3300046810 Ga0495660_0158927 Ga0495660_0158927_133_894 253
325 3300047320 Ga0495672_0003400 Ga0495672_0003400_8077_8838 253
326 3300047323 Ga0495683_0060009 Ga0495683_0060009_590_1351 253
327 3300047443 Ga0495687_099777 Ga0495687_099777_223_1035 253
328 3300047446 Ga0495679_024475 Ga0495679_024475_672_1433 253
329 3300047469 Ga0495673_0000208 Ga0495673_0000208_48712_49473 253
330 3300047469 Ga0495673_0000293 Ga0495673_0000293_22630_23391 253
331 3300047469 Ga0495673_0002253 Ga0495673_0002253_5357_6118 253
332 3300047470 Ga0495681_0141429 Ga0495681_0141429_115_876 253
333 3300047472 Ga0495686_0001397 Ga0495686_0001397_15136_15897 253
334 3300047472 Ga0495686_0002164 Ga0495686_0002164_15169_15951 253
335 3300047472 Ga0495686_0008686 Ga0495686_0008686_3218_3979 253
336 3300047472 Ga0495686_0012327 Ga0495686_0012327_828_1589 253
337 3300048905 Ga0496102_0152475 Ga0496102_0152475_227_1027 253
338 3300048905 Ga0496102_0230738 Ga0496102_0230738_857_1663 253
339 3300048905 Ga0496102_0629574 Ga0496102_0629574_26_829 253
340 3300048906 Ga0496103_0172229 Ga0496103_0172229_272_1072 253
341 3300048910 Ga0496107_0100456 Ga0496107_0100456_69_872 253
342 3300048912 Ga0496109_0439652 Ga0496109_0439652_281_1084 253
343 3300048915 Ga0496112_0054527 Ga0496112_0054527_1751_2554 253
344 3300048915 Ga0496112_0173091 Ga0496112_0173091_126_920 253
345 3300048915 Ga0496112_0339236 Ga0496112_0339236_55_858 253
346 3300048918 Ga0496115_0001146 Ga0496115_0001146_7868_8659 253
347 3300048918 Ga0496115_0012869 Ga0496115_0012869_1307_2068 253
348 3300048918 Ga0496115_0057933 Ga0496115_0057933_1993_2772 253
349 3300048920 Ga0496117_0060786 Ga0496117_0060786_37_843 253
350 3300048921 Ga0496118_0085799 Ga0496118_0085799_1029_1835 253
351 3300048924 Ga0496121_0000130 Ga0496121_0000130_5993_6799 253
352 3300048924 Ga0496121_0002319 Ga0496121_0002319_12719_13495 253
353 3300048927 Ga0496124_0013045 Ga0496124_0013045_4903_5664 253
354 3300048928 Ga0496125_0010944 Ga0496125_0010944_2940_3701 253
355 3300049459 Ga0495678_000358 Ga0495678_000358_27673_28434 253
356 3300049569 Ga0501032_0169477 Ga0501032_0169477_113_904 253
357 3300049671 Ga0501238_001095 Ga0501238_001095_834_1595 253
358 3300049671 Ga0501238_001121 Ga0501238_001121_1946_2707 253
359 3300049822 Ga0501035_0234198 Ga0501035_0234198_717_1496 253
360 3300049822 Ga0501035_0311235 Ga0501035_0311235_219_1010 253
361 3300049823 Ga0501044_0009852 Ga0501044_0009852_9060_9839 253
362 3300049823 Ga0501044_0352212 Ga0501044_0352212_90_908 253
363 3300050493 nmdc:mga0k408_77644_c1 nmdc:mga0k408_77644_c1_550_1353 253
364 3300050496 nmdc:mga07m45_1914_c1 nmdc:mga07m45_1914_c1_2084_2887 253
365 3300053080 Ga0500635_0000328 Ga0500635_0000328_11648_12454 253
366 3300053086 Ga0500578_0000309 Ga0500578_0000309_12539_13300 253
367 3300053087 Ga0500643_009976 Ga0500643_009976_2801_3565 253
368 3300053087 Ga0500643_059667 Ga0500643_059667_151_927 253
369 3300053088 Ga0500644_0000036 Ga0500644_0000036_57140_57901 253
370 3300053093 Ga0500651_0098363 Ga0500651_0098363_271_1083 253
371 3300053096 Ga0500641_0003962 Ga0500641_0003962_2673_3437 253
372 3300053102 Ga0500554_000945 Ga0500554_000945_2819_3601 253
373 3300053103 Ga0500555_055864 Ga0500555_055864_226_987 253
374 3300053104 Ga0500556_0000382 Ga0500556_0000382_17086_17847 253
375 3300053104 Ga0500556_0040116 Ga0500556_0040116_567_1376 253
376 3300053108 Ga0500562_016878 Ga0500562_016878_1097_1861 253
377 3300053109 Ga0500569_001104 Ga0500569_001104_2184_2996 253
378 3300053118 Ga0500594_0000141 Ga0500594_0000141_6617_7378 253
379 3300053119 Ga0500595_011120 Ga0500595_011120_432_1244 253
380 3300053119 Ga0500595_056365 Ga0500595_056365_324_1112 253
381 3300053120 Ga0500597_143611 Ga0500597_143611_129_941 253
382 3300053122 Ga0500608_001574 Ga0500608_001574_3623_4435 253
383 3300053123 Ga0500614_001953 Ga0500614_001953_155_967 253
384 3300053125 Ga0500618_000074 Ga0500618_000074_77807_78568 253
385 3300053134 Ga0500658_0005513 Ga0500658_0005513_1734_2495 253
386 3300053136 Ga0500559_0000086 Ga0500559_0000086_41748_42509 253
387 3300053136 Ga0500559_0003341 Ga0500559_0003341_7035_7796 253
388 3300053136 Ga0500559_0003905 Ga0500559_0003905_1373_2185 253
389 3300053138 Ga0500564_000359 Ga0500564_000359_3472_4233 253
390 3300053142 Ga0500577_0009185 Ga0500577_0009185_1848_2609 253
391 3300053151 Ga0500604_0022964 Ga0500604_0022964_198_962 253
392 3300053153 Ga0500616_0016531 Ga0500616_0016531_2126_2887 253
393 3300053156 Ga0500622_0000608 Ga0500622_0000608_12091_12852 253
394 3300053156 Ga0500622_0008039 Ga0500622_0008039_1606_2370 253
395 3300053156 Ga0500622_0010260 Ga0500622_0010260_3542_4303 253
396 3300053156 Ga0500622_0010639 Ga0500622_0010639_3253_4014 253
397 3300053156 Ga0500622_0020783 Ga0500622_0020783_2261_3022 253
398 3300053157 Ga0500624_018748 Ga0500624_018748_168_974 253
399 3300053158 Ga0500627_0066975 Ga0500627_0066975_422_1183 253
400 3300053177 Ga0500636_0012284 Ga0500636_0012284_3819_4625 253
401 3300053178 Ga0500637_0082082 Ga0500637_0082082_928_1740 253
402 3300053178 Ga0500637_0094752 Ga0500637_0094752_92_898 253
403 3300053729 Ga0500625_017716 Ga0500625_017716_2289_3101 253
404 3300053730 Ga0500645_000131 Ga0500645_000131_23651_24415 253
405 3300053730 Ga0500645_002401 Ga0500645_002401_6562_7323 253
406 3300053730 Ga0500645_002611 Ga0500645_002611_6238_7005 253
407 3300053731 Ga0500609_001219 Ga0500609_001219_2926_3687 253
408 iso_pu_bacteria 2857504554 2857505329 253
409 3300005367 Ga0070667_100194123 Ga0070667_1001941232 254
410 3300005842 Ga0068858_100422474 Ga0068858_1004224741 254
411 3300009093 Ga0105240_10001340 Ga0105240_1000134010 254
412 3300025913 Ga0207695_10003819 Ga0207695_1000381915 254
413 3300025986 Ga0207658_10384224 Ga0207658_103842242 254
414 3300046506 Ga0495583_0023347 Ga0495583_0023347_650_1438 255
415 3300003781 Ga0055536_1001435 Ga0055536_10014354 257
416 3300003791 Ga0055530_10007239 Ga0055530_100072394 257
417 3300003794 Ga0055531_10001288 Ga0055531_1000128817 257
418 3300003794 Ga0055531_10003395 Ga0055531_100033952 257
419 3300025292 Ga0209676_1000799 Ga0209676_100079915 257
420 3300025298 Ga0209050_1001015 Ga0209050_100101525 257
421 3300025304 Ga0209257_1000903 Ga0209257_100090315 257
422 3300053122 Ga0500608_000107 Ga0500608_000107_31101_31883 257
423 3300053104 Ga0500556_0071464 Ga0500556_0071464_165_944 258
424 3300053153 Ga0500616_0150345 Ga0500616_0150345_187_966 258
425 3300053156 Ga0500622_0036601 Ga0500622_0036601_1571_2350 258
426 3300006028 Ga0070717_10111695 Ga0070717_101116953 259
427 3300009177 Ga0105248_10001636 Ga0105248_1000163621 259
428 3300035171 Ga0373946_0060297 Ga0373946_0060297_667_1548 259
429 3300035695 Ga0373927_0000622 Ga0373927_0000622_2679_3560 259
430 3300037068 Ga0373925_0000067 Ga0373925_0000067_35775_36656 259
431 3300037312 Ga0395899_0000095 Ga0395899_0000095_77109_77915 259
432 3300037418 Ga0395900_0000006 Ga0395900_0000006_302593_303399 259
433 3300037471 Ga0395905_0003726 Ga0395905_0003726_9473_10279 259
434 3300038443 Ga0395901_0000001 Ga0395901_0000001_345841_346647 259
435 iso_pu_bacteria 2582581280 2585151961 261
436 iso_pu_bacteria 2643221584 2643931043 261
437 iso_pu_bacteria 2818991435 2819537364 261
438 iso_pu_bacteria 2818991454 2819646574 261
439 3300031251 Ga0265327_10002690 Ga0265327_1000269013 262
440 3300003322 rootL2_10140596 rootL2_101405962 263
441 3300025273 Ga0209673_1000979 Ga0209673_100097928 263
442 3300025299 Ga0209256_1005763 Ga0209256_10057632 263
443 3300046616 Ga0495668_0000026 Ga0495668_0000026_196058_196849 263
444 3300053087 Ga0500643_001070 Ga0500643_001070_11105_11956 263
445 3300053096 Ga0500641_0017893 Ga0500641_0017893_130_999 263
446 3300053104 Ga0500556_0002210 Ga0500556_0002210_586_1425 263
447 3300053108 Ga0500562_001228 Ga0500562_001228_1017_1883 263
448 3300053108 Ga0500562_006458 Ga0500562_006458_202_1041 263
449 3300053153 Ga0500616_0018299 Ga0500616_0018299_1395_2234 263
450 3300053730 Ga0500645_002140 Ga0500645_002140_4142_4981 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03473

MOSC

MOSC domain

168

289

0.9

PF03476

MOSC_N

MOSC N-terminal beta barrel domain

40

157

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o9q-assembly1.cif.gz_A crystal structure of the awp1 (adhesin-like wall protein 1) a-domain from candida glabrata 0.8181 82 106
5yhh-assembly1.cif.gz_A crystal structure of yiim from geobacillus stearothermophilus 0.813 151 263
7jr9-assembly1.cif.gz_B chlamydomonas reinhardtii radial spoke minimal head complex 0.7619 81 106
6fw2-assembly1.cif.gz_A crystal structure of human marc1 0.7561 11 262
7z4q-assembly1.cif.gz_A plasmodium falciparum pyruvate kinase mutant - c49a 0.7498 193 262
ID Description Score Start End Superfamily
af_Q58EJ9_194_321_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8869 151 261 2.40.33.20
af_A1Z803_208_336_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8841 151 261 2.40.33.20
af_Q96EN8_729_865_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8725 151 248 2.40.33.20
af_A4HT05_92_321_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8699 83 110 2.130.10.10
af_Q55D22_203_357_2.40.33.20 Mainly Beta;Beta Barrel;M1 Pyruvate Kinase; Domain 3;PK beta-barrel domain-like 0.8526 151 248 2.40.33.20
ID Description Score Start End GO Terms
AF-A0A4Q3RXW7-F1-model_v4 MOSC domain-containing protein 0.9859 11 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A4Q3RXW7-F1-model_v4 MOSC domain-containing protein 0.9821 11 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A6M0HZC9-F1-model_v4 MOSC domain-containing protein 0.9798 150 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A2D7IX20-F1-model_v4 MOSC domain-containing protein 0.9788 11 263 GO:0003824
GO:0030151
GO:0030170
AF-A0A5P9H1J6-F1-model_v4 Stearoyl-CoA 9-desaturase electron transfer partner 0.9688 151 263 GO:0016491
GO:0030151
GO:0030170
GO:0051537

Feature Viewer

pLDDT pTM Quality
92.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map