F446594

General Info

Members Datasets Scaffolds Average Seq Length
450 380 900 384

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10106050|Ga0207645_101060502
Length 414
Sequence MSAVAIKGWCPGALRPMLSGDGLVVRVRPFGGRLDAGQAAGLADLAERYGNGLIDLTSRANLQIRGVSHDGHLPLLDGLMRLGLLDPDSETESRRNILVTPFWRAGDDTCSLAIELERALADRSLDLPTKFGFAVDDGKERVLTTASADVRIERDPDGELTVRADGAELGRSVTRTEVIDVALALAEWFVTSGGAKGGRGRMAAHLRAGARLPEALRGHARPAAATVAPLPGLYPQGALVGATFGQLTHSALRHLASYGQALRMTPCRMVLVEGLREMPRRDDVITQADDPALRVIACSGAPRCREAHADTRALATALAPRIAADARLHVSGCAKGCAHPRPALCVVGADDGYHLMLDGVASDIPDAQIAGGDIDSAIEKLARLIKNERQAGESAAACLRRIGKHDAIKALRQE

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
44 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
60 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
61 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
62 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
98 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
99 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
101 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
106 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
131 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
177 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
178 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
179 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
180 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
181 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
184 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
185 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
186 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
187 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
188 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
189 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
190 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
191 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
192 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
193 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
194 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
195 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
196 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
197 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
198 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
199 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
200 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
201 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
202 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
203 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
204 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
205 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
206 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
207 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
208 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
209 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
210 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
211 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
212 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
213 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
214 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
215 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
216 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
217 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
218 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
219 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
220 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
221 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
222 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
223 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
224 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
225 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
226 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
227 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
228 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
229 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
230 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
231 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
232 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
233 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
234 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
235 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
236 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
237 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
238 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
239 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
240 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
241 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
242 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
243 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
244 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
245 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
246 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
247 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
248 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
249 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
250 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
251 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
252 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
253 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
254 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
255 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
256 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
257 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
258 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
259 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
260 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
261 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
262 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
263 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
264 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
265 2904699407
266 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
267 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
268 2906610324
269 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
270 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
271 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
272 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
273 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
274 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
275 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
276 2922368715
277 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
278 2922425934
279 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
280 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
281 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
282 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
283 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
284 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
285 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
286 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
287 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
288 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
289 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
290 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
291 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
292 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
293 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
294 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
295 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
296 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
297 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
298 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
299 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
300 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
301 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
302 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
303 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
304 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
305 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
306 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
307 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
308 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
309 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
310 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
311 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
312 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
313 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
314 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
315 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
316 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
317 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
318 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
319 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
320 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
321 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
322 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
323 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
324 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
325 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
326 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
327 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
328 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
329 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
330 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
331 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
332 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
333 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
334 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
335 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
336 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
337 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
338 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
339 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
340 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
341 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
342 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
343 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
344 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
345 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
346 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
347 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
348 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
349 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
350 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
351 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
352 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
353 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
354 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
355 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
356 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
357 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
358 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
359 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
360 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
361 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
362 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
363 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
364 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
365 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
366 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
367 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
368 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
369 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
370 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
371 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
372 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
373 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
374 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
375 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
376 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
377 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
378 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
379 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
380 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.07
Metatranscriptomes 0
Isolates 41.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12
Nodule 35.78
Rhizoplane 3.11
Rhizosphere 34.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10106050 3300025907 Bacteria 1816
2 JGI25153J46596_10001683 3300003215 Bacteria 13112
3 JGI25153J46596_10001686 3300003215 Bacteria 13101
4 JGI25160J50197_1000991 3300003354 Bacteria 14757
5 JGI25160J50197_1021402 3300003354 Bacteria 1923
6 Ga0055542_1007606 3300003762 Bacteria 2184
7 Ga0055531_10007448 3300003794 Bacteria 5972
8 Ga0065165_1000420 3300005262 Bacteria 66966
9 Ga0065165_1000556 3300005262 Bacteria 55512
10 Ga0065165_1022530 3300005262 Bacteria 2157
11 Ga0070670_100181431 3300005331 Bacteria 1828
12 Ga0070666_10117867 3300005335 Bacteria 1840
13 Ga0070682_100095890 3300005337 Bacteria 1949
14 Ga0070660_100108655 3300005339 Bacteria 2205
15 Ga0070687_100046187 3300005343 Bacteria 2228
16 Ga0070661_100081537 3300005344 Bacteria 2388
17 Ga0070692_10125190 3300005345 Bacteria 1438
18 Ga0070668_100042914 3300005347 Bacteria 3466
19 Ga0070668_100070156 3300005347 Bacteria 2727
20 Ga0070671_100114449 3300005355 Bacteria 2267
21 Ga0070659_100315954 3300005366 Bacteria 1305
22 Ga0070709_10000412 3300005434 Bacteria 26060
23 Ga0070714_100002292 3300005435 Bacteria 14079
24 Ga0070714_100034015 3300005435 Bacteria 4267
25 Ga0070710_10012033 3300005437 Bacteria 4290
26 Ga0070710_10016226 3300005437 Bacteria 3786
27 Ga0070705_100029232 3300005440 Bacteria 3028
28 Ga0070678_100277114 3300005456 Bacteria 1417
29 Ga0070662_100021506 3300005457 Bacteria 4405
30 Ga0070696_100086505 3300005546 Bacteria 2226
31 Ga0070693_100092442 3300005547 Bacteria 1827
32 Ga0070665_100145769 3300005548 Bacteria 2371
33 Ga0070665_100271517 3300005548 Bacteria 1698
34 Ga0068855_100082112 3300005563 Bacteria 3735
35 Ga0068857_100068885 3300005577 Bacteria 3150
36 Ga0068857_100298234 3300005577 Bacteria 1485
37 Ga0068852_100123890 3300005616 Bacteria 2370
38 Ga0068852_100246273 3300005616 Bacteria 1710
39 Ga0068852_100352385 3300005616 Bacteria 1438
40 Ga0068864_100106012 3300005618 Bacteria 2499
41 Ga0068870_10025307 3300005840 Bacteria 2945
42 Ga0068863_100043176 3300005841 Bacteria 4280
43 Ga0068863_100154933 3300005841 Bacteria 2193
44 Ga0068858_100066232 3300005842 Bacteria 3343
45 Ga0068860_100000312 3300005843 Bacteria 66724
46 Ga0068860_100080106 3300005843 Bacteria 3106
47 Ga0081540_1006288 3300005983 Bacteria 8692
48 Ga0070717_10009339 3300006028 Bacteria 7369
49 Ga0075365_10043348 3300006038 Bacteria 2945
50 Ga0075365_10082334 3300006038 Bacteria 2182
51 Ga0075368_10032736 3300006042 Bacteria 2020
52 Ga0075368_10049820 3300006042 Bacteria 1662
53 Ga0075364_10015455 3300006051 Bacteria 4735
54 Ga0070715_10001792 3300006163 Bacteria 6397
55 Ga0070716_100001697 3300006173 Bacteria 9938
56 Ga0070716_100060994 3300006173 Bacteria 2181
57 Ga0075366_10005300 3300006195 Bacteria 6984
58 Ga0097621_100089721 3300006237 Bacteria 2571
59 Ga0099824_1004605 3300006942 Bacteria 19784
60 Ga0099822_1000031 3300006943 Bacteria 62575
61 Ga0105245_10029674 3300009098 Bacteria 4834
62 Ga0114129_10093802 3300009147 Bacteria 4157
63 Ga0105241_10029509 3300009174 Bacteria 4093
64 Ga0105241_10060960 3300009174 Bacteria 2904
65 Ga0105248_10091048 3300009177 Bacteria 3435
66 Ga0105237_10030642 3300009545 Bacteria 5462
67 Ga0105237_10038406 3300009545 Bacteria 4834
68 Ga0105238_10134630 3300009551 Bacteria 2449
69 Ga0105239_10016189 3300010375 Bacteria 8250
70 Ga0105239_10164075 3300010375 Bacteria 2483
71 Ga0105239_10303723 3300010375 Bacteria 1797
72 Ga0105246_10061565 3300011119 Bacteria 2612
73 Ga0157374_10057825 3300013296 Bacteria 3623
74 Ga0157378_10042553 3300013297 Bacteria 4032
75 Ga0163163_10007677 3300014325 Bacteria 9530
76 Ga0163163_10071504 3300014325 Bacteria 3457
77 Ga0157377_10097242 3300014745 Bacteria 1748
78 Ga0157379_10007477 3300014968 Bacteria 9459
79 Ga0157379_10098603 3300014968 Bacteria 2623
80 Ga0157376_10021572 3300014969 Bacteria 5005
81 Ga0214544_1000004 3300021320 Bacteria 455869
82 Ga0214542_1000001 3300021321 Bacteria 1018696
83 Ga0214545_1000001 3300021324 Bacteria 1092817
84 Ga0214543_1000006 3300021327 Bacteria 443395
85 Ga0213876_10001319 3300021384 Bacteria 15581
86 Ga0213876_10114715 3300021384 Bacteria 1430
87 Ga0209677_101151 3300025253 Bacteria 12289
88 Ga0209148_1000566 3300025254 Bacteria 34786
89 Ga0209233_1001516 3300025261 Bacteria 9113
90 Ga0209233_1002707 3300025261 Bacteria 6398
91 Ga0209233_1010687 3300025261 Bacteria 2736
92 Ga0209455_1001114 3300025272 Bacteria 13145
93 Ga0209758_1000024 3300025297 Bacteria 591966
94 Ga0209758_1000068 3300025297 Bacteria 286488
95 Ga0209758_1002049 3300025297 Bacteria 21606
96 Ga0209758_1005922 3300025297 Bacteria 9090
97 Ga0209758_1048874 3300025297 Bacteria 1499
98 Ga0207426_1000120 3300025302 Bacteria 219117
99 Ga0207426_1000673 3300025302 Bacteria 41533
100 Ga0207426_1004196 3300025302 Bacteria 7183
101 Ga0209257_1001327 3300025304 Bacteria 30091
102 Ga0207692_10004793 3300025898 Bacteria 5377
103 Ga0207688_10064088 3300025901 Bacteria 2074
104 Ga0207685_10031338 3300025905 Bacteria 1903
105 Ga0207699_10044929 3300025906 Bacteria 2574
106 Ga0207693_10000217 3300025915 Bacteria 52791
107 Ga0207663_10000151 3300025916 Bacteria 32258
108 Ga0207657_10128206 3300025919 Bacteria 2082
109 Ga0207649_10048068 3300025920 Bacteria 2630
110 Ga0207700_10067405 3300025928 Bacteria 2739
111 Ga0207700_10228820 3300025928 Bacteria 1580
112 Ga0207664_10015026 3300025929 Bacteria 5607
113 Ga0207664_10040259 3300025929 Bacteria 3633
114 Ga0207706_10022693 3300025933 Bacteria 5634
115 Ga0207665_10000493 3300025939 Bacteria 26653
116 Ga0207689_10001713 3300025942 Bacteria 20753
117 Ga0207667_10068530 3300025949 Bacteria 3694
118 Ga0207640_10073577 3300025981 Bacteria 2310
119 Ga0207640_10136807 3300025981 Bacteria 1780
120 Ga0207658_10068456 3300025986 Bacteria 2679
121 Ga0207677_10024255 3300026023 Bacteria 3765
122 Ga0207703_10060972 3300026035 Bacteria 3087
123 Ga0207703_10106018 3300026035 Bacteria 2390
124 Ga0207639_10046719 3300026041 Bacteria 3268
125 Ga0207678_10008855 3300026067 Bacteria 8862
126 Ga0207678_10016825 3300026067 Bacteria 6421
127 Ga0207678_10094685 3300026067 Bacteria 2552
128 Ga0207641_10068221 3300026088 Bacteria 3049
129 Ga0207676_10009429 3300026095 Bacteria 6947
130 Ga0207674_10075668 3300026116 Bacteria 3376
131 Ga0207674_10082322 3300026116 Bacteria 3220
132 Ga0207675_100003788 3300026118 Bacteria 14726
133 Ga0207683_10026771 3300026121 Bacteria 4981
134 Ga0207698_10024978 3300026142 Bacteria 4200
135 Ga0209389_1000010 3300027296 Bacteria 223892
136 Ga0209389_1000149 3300027296 Bacteria 59631
137 Ga0209589_1000016 3300027357 Bacteria 223788
138 Ga0209589_1000025 3300027357 Bacteria 165546
139 Ga0209489_100016 3300027361 Bacteria 223873
140 Ga0209489_100039 3300027361 Bacteria 165546
141 Ga0209489_114750 3300027361 Bacteria 5258
142 Ga0209700_100030 3300027363 Bacteria 212982
143 Ga0209700_100043 3300027363 Bacteria 167890
144 Ga0209813_10031446 3300027866 Bacteria 1567
145 Ga0209813_10045155 3300027866 Bacteria 1356
146 Ga0268266_10016057 3300028379 Bacteria 6399
147 Ga0268264_10000030 3300028381 Bacteria 418542
148 Ga0268264_10118405 3300028381 Bacteria 2331
149 Ga0307511_10069376 3300030521 Bacteria 2592
150 Ga0315911_1000002 3300033442 Bacteria 926833
151 Ga0373937_0007657 3300036401 Bacteria 9359
152 Ga0373925_0071396 3300037068 Bacteria 2626
153 Ga0395905_0009332 3300037471 Bacteria 9596
154 Ga0395901_0215976 3300038443 Bacteria 2006
155 Ga0436365_0307003 3300039437 Bacteria 1452
156 Ga0436365_0894431 3300039437 Bacteria 17215
157 Ga0436360_0732042 3300039438 Bacteria 2945
158 Ga0466972_0000148 3300044658 Bacteria 57158
159 Ga0466972_0003448 3300044658 Bacteria 7842
160 Ga0466965_0124105 3300044683 Bacteria 1335
161 Ga0466966_0012261 3300044684 Bacteria 5679
162 Ga0466966_0015067 3300044684 Bacteria 5114
163 Ga0466961_0000008 3300044693 Bacteria 142607
164 Ga0466959_0009565 3300045049 Bacteria 6896
165 Ga0495592_0049716 3300046454 Bacteria 3116
166 Ga0495592_0090546 3300046454 Bacteria 2195
167 Ga0495629_0214803 3300046459 Bacteria 1328
168 Ga0495651_0001984 3300046462 Bacteria 15854
169 Ga0495651_0029080 3300046462 Bacteria 4310
170 Ga0495651_0085311 3300046462 Bacteria 2378
171 Ga0495653_0019076 3300046463 Bacteria 5564
172 Ga0495664_0031502 3300046477 Bacteria 3109
173 Ga0495606_0125679 3300046507 Bacteria 1530
174 Ga0495608_0012073 3300046511 Bacteria 6004
175 Ga0495628_0011313 3300046516 Bacteria 7548
176 Ga0495632_0086169 3300046519 Bacteria 1494
177 Ga0495652_0010482 3300046529 Bacteria 8398
178 Ga0495640_0016765 3300046533 Bacteria 5476
179 Ga0495640_0049025 3300046533 Bacteria 2915
180 Ga0495597_0004357 3300046542 Bacteria 7805
181 Ga0495645_0001873 3300046543 Bacteria 14306
182 Ga0495622_0037522 3300046557 Bacteria 2257
183 Ga0495667_0003300 3300046559 Bacteria 10818
184 Ga0495668_0025664 3300046616 Bacteria 3347
185 Ga0495634_0024720 3300046642 Bacteria 4211
186 Ga0495634_0104406 3300046642 Bacteria 1828
187 Ga0495635_0001999 3300046663 Bacteria 13856
188 Ga0495635_0009596 3300046663 Bacteria 6765
189 Ga0495588_0007284 3300046674 Bacteria 5028
190 Ga0495657_0001200 3300046675 Bacteria 22691
191 Ga0495613_0028267 3300046689 Bacteria 4171
192 Ga0495624_0014716 3300046690 Bacteria 5298
193 Ga0495649_0038769 3300046694 Bacteria 2613
194 Ga0495600_0002291 3300046809 Bacteria 10909
195 Ga0495581_0128706 3300047315 Bacteria 1475
196 Ga0495604_0009383 3300047317 Bacteria 7739
197 Ga0495674_0009389 3300047319 Bacteria 9296
198 Ga0495676_0041792 3300047321 Bacteria 3770
199 Ga0495680_0007048 3300047322 Bacteria 10359
200 Ga0495675_0001461 3300047444 Bacteria 14304
201 Ga0495684_0076471 3300047471 Bacteria 2543
202 Ga0495593_0031083 3300047673 Bacteria 2919
203 Ga0495602_0016196 3300048088 Bacteria 7500
204 Ga0496101_0063166 3300048904 Bacteria 2695
205 Ga0496102_0014553 3300048905 Bacteria 6836
206 Ga0496102_0056751 3300048905 Bacteria 3573
207 Ga0496102_0132083 3300048905 Bacteria 2338
208 Ga0496103_0011719 3300048906 Bacteria 5201
209 Ga0496104_0003456 3300048907 Bacteria 13613
210 Ga0496105_0001070 3300048908 Bacteria 18947
211 Ga0496110_0079158 3300048913 Bacteria 2926
212 Ga0496110_0098432 3300048913 Bacteria 2621
213 Ga0496112_0048480 3300048915 Bacteria 4164
214 Ga0496113_0043989 3300048916 Bacteria 3307
215 Ga0496114_0101393 3300048917 Bacteria 2458
216 Ga0496115_0031252 3300048918 Bacteria 4194
217 Ga0496116_0042437 3300048919 Bacteria 3109
218 Ga0496116_0072911 3300048919 Bacteria 2168
219 Ga0496118_0023183 3300048921 Bacteria 5400
220 Ga0496119_0011321 3300048922 Bacteria 7406
221 Ga0496120_0055355 3300048923 Bacteria 2243
222 Ga0496121_0035076 3300048924 Bacteria 4501
223 Ga0496121_0057029 3300048924 Bacteria 3240
224 Ga0496121_0060188 3300048924 Bacteria 3125
225 Ga0496121_0061598 3300048924 Bacteria 3078
226 Ga0496121_0131174 3300048924 Bacteria 1875
227 Ga0496122_0070871 3300048925 Bacteria 2487
228 Ga0496124_0097847 3300048927 Bacteria 2382
229 Ga0496125_0071000 3300048928 Bacteria 2723
230 Ga0496125_0089840 3300048928 Bacteria 2308
231 Ga0496126_0017234 3300048929 Bacteria 7199
232 Ga0496126_0034196 3300048929 Bacteria 4775
233 Ga0496126_0142350 3300048929 Bacteria 2063
234 Ga0496126_0144335 3300048929 Bacteria 2046
235 Ga0496126_0279548 3300048929 Bacteria 1383
236 Ga0501074_0113300 3300049590 Bacteria 1940
237 Ga0501044_0056476 3300049823 Bacteria 4031
238 nmdc:mga00v17_83213_c1 3300050491 Bacteria 2001
239 nmdc:mga0yw44_30835_c1 3300050492 Bacteria 3112
240 nmdc:mga0yw44_35076_c1 3300050492 Bacteria 2945
241 nmdc:mga0yw44_46356_c1 3300050492 Bacteria 2610
242 nmdc:mga0yw44_66048_c1 3300050492 Bacteria 2231
243 nmdc:mga06z11_19897_c1 3300050494 Bacteria 3095
244 nmdc:mga07m45_31452_c1 3300050496 Bacteria 2942
245 nmdc:mga0sz30_17191_c1 3300050516 Bacteria 2883
246 Ga0500566_0000613 3300053094 Bacteria 20005
247 Ga0500557_000009 3300053105 Bacteria 125806
248 Ga0500572_089090 3300053111 Bacteria 975
249 Ga0500595_013847 3300053119 Bacteria 3078
250 Ga0500607_039111 3300053121 Bacteria 2577
251 Ga0500642_0000154 3300053130 Bacteria 28564
252 Ga0500655_011316 3300053133 Bacteria 1616
253 Ga0500559_0069320 3300053136 Bacteria 1585
254 Ga0500590_091441 3300053148 Bacteria 1477
255 Ga0500636_0000228 3300053177 Bacteria 30746
256 Ga0500637_0119199 3300053178 Bacteria 1530
257 Ga0500625_000053 3300053729 Bacteria 23355
258 Ga0500601_000488 3300053737 Bacteria 6175
259 Ga0500661_005325 3300055283 Bacteria 2407
260 2507507978 2507262055 Bacteria 8048963
261 2508542085 2508501009 Bacteria 7784016
262 2508692368 2508501042 Bacteria 8719808
263 2511397996 2511231028 Bacteria 8046582
264 2513622571 2513237092 Bacteria 8341956
265 2513639404 2513237094 Bacteria 8789602
266 2513647193 2513237095 Bacteria 8976980
267 2513653751 2513237096 Bacteria 8722461
268 2513696595 2513237101 Bacteria 7952346
269 2513700781 2513237102 Bacteria 7703324
270 2513715174 2513237104 Bacteria 10034502
271 2513856188 2513237137 Bacteria 9558895
272 2513877605 2513237139 Bacteria 8737671
273 2513918091 2513237145 Bacteria 8979722
274 2514009750 2513237161 Bacteria 8871253
275 2515626865 2515154112 Bacteria 8294334
276 2517103808 2517093001 Bacteria 9002274
277 2517891671 2517572143 Bacteria 9484767
278 2524442496 2524023205 Bacteria 8918781
279 2524470111 2524023210 Bacteria 9029266
280 2524536724 2524023228 Bacteria 10118060
281 2617346478 2617270735 Bacteria 9163226
282 2617378583 2617270741 Bacteria 8201522
283 2671118558 2667528175 Bacteria 7532676
284 2728751906 2728368998 Bacteria 8720350
285 2745075603 2744054633 Bacteria 8678936
286 2793060793 2791355196 Bacteria 7323613
287 2793067043 2791355197 Bacteria 8420563
288 2805918385 2802429603 Bacteria 8777136
289 2818236230 2816332527 Bacteria 8933356
290 2824605317 2824600985 Bacteria 8488197
291 2824615567 2824609381 Bacteria 8672835
292 2824634779 2824626560 Bacteria 8813858
293 2824643740 2824635225 Bacteria 8785348
294 2824670623 2824661429 Bacteria 9877870
295 2824752804 2824746037 Bacteria 7911610
296 2824774738 2824773399 Bacteria 8360218
297 2838122982 2838122688 Bacteria 8803140
298 2841944733 2841941048 Bacteria 8688029
299 2841955975 2841949485 Bacteria 8680857
300 2841960027 2841957949 Bacteria 8652217
301 2841969888 2841966195 Bacteria 8673214
302 2841978682 2841974524 Bacteria 8931498
303 2841984192 2841983080 Bacteria 8395090
304 2842040333 2842038055 Bacteria 8002051
305 2842046723 2842045827 Bacteria 8006841
306 2844319699 2844315083 Bacteria 8138177
307 2847937020 2847930680 Bacteria 9342022
308 2847947420 2847939898 Bacteria 8606328
309 2849078688 2849076700 Bacteria 7039503
310 2857513099 2857509624 Bacteria 7472071
311 2874599071 2874590934 Bacteria 8299676
312 2874617246 2874612657 Bacteria 8252029
313 2874626620 2874620515 Bacteria 8290088
314 2874635337 2874628541 Bacteria 8630250
315 2874650484 2874645413 Bacteria 8214782
316 2876764337 2876761206 Bacteria 10111113
317 2876779110 2876771140 Bacteria 8287509
318 2876822714 2876818435 Bacteria 8274608
319 2879082903 2879074833 Bacteria 8279565
320 2879083881 2879083081 Bacteria 8587928
321 2879133032 2879127579 Bacteria 8294491
322 2879149319 2879142872 Bacteria 8267021
323 2881368109 2881364244 Bacteria 7710352
324 2881667807 2881665667 Bacteria 8175609
325 2885369587 2885366525 Bacteria 8326213
326 2885381001 2885374607 Bacteria 8927485
327 2885389130 2885383462 Bacteria 9473874
328 2888385120 2888378607 Bacteria 9652610
329 2888425267 2888419890 Bacteria 7857137
330 2899261407 2899259804 Bacteria 3320927
331 2903730620 2903727486 Bacteria 8281579
332 2903776261 2903768456 Bacteria 9749579
333 2904671961 2904666416 Bacteria 8226587
334 2904697880 2904690495 Bacteria 9412302
335 2904704589
336 2904712315 2904711408 Bacteria 9771557
337 2906609572 2906602504 Bacteria 8295279
338 2906616844
339 2906628885 2906626472 Bacteria 8826946
340 2906642885 2906635258 Bacteria 8601019
341 2906667175 2906660503 Bacteria 8595048
342 2908742031 2908739725 Bacteria 8628932
343 2908759703 2908756301 Bacteria 8864324
344 2908780827 2908775508 Bacteria 8092255
345 2919682024 2919679072 Bacteria 4629602
346 2922372764
347 2922397408 2922393267 Bacteria 8285685
348 2922431083
349 2929620586 2929615660 Bacteria 9193770
350 2929626480 2929624759 Bacteria 9339455
351 2932784653 2932784394 Bacteria 9704911
352 2932795445 2932794094 Bacteria 7915132
353 2932807961 2932801729 Bacteria 7987968
354 2932809633 2932809354 Bacteria 9135765
355 2932818624 2932818245 Bacteria 9955613
356 2932828421 2932828146 Bacteria 9745859
357 2933582503 2933577622 Bacteria 9116884
358 2935609526 2935608549 Bacteria 8203142
359 2935617394 2935616580 Bacteria 9032984
360 2935636921 2935630451 Bacteria 8169952
361 2935639124 2935638405 Bacteria 10015038
362 2935652323 2935648319 Bacteria 8801166
363 2935660905 2935656913 Bacteria 8965014
364 2935666024 2935665750 Bacteria 9571747
365 2935675672 2935675223 Bacteria 9928132
366 2935685319 2935684952 Bacteria 9590419
367 2935698568 2935694250 Bacteria 9291695
368 2935704131 2935703347 Bacteria 10242284
369 2935713872 2935713505 Bacteria 9608509
370 2935724491 2935722832 Bacteria 9608746
371 2935733151 2935732158 Bacteria 9706831
372 2935742530 2935741537 Bacteria 9707219
373 2935751284 2935750917 Bacteria 9590372
374 2935765945 2935760218 Bacteria 9817913
375 2935769926 2935769743 Bacteria 7878163
376 2935782054 2935777560 Bacteria 8077691
377 2935785832 2935785616 Bacteria 7962367
378 2935794240 2935793552 Bacteria 8012592
379 2935802214 2935801545 Bacteria 9301974
380 2935811038 2935810662 Bacteria 9401221
381 2935822688 2935819856 Bacteria 8261050
382 2935828619 2935827899 Bacteria 10038562
383 2935839995 2935837841 Bacteria 9454360
384 2935848270 2935847175 Bacteria 8228321
385 2935856019 2935855204 Bacteria 9035059
386 2935866037 2935864058 Bacteria 9784707
387 2935877638 2935873716 Bacteria 9632195
388 2935883655 2935883170 Bacteria 7964738
389 2935909927 2935908558 Bacteria 8568796
390 2935917653 2935916978 Bacteria 9113783
391 2935927407 2935926038 Bacteria 8601059
392 2935936748 2935934488 Bacteria 8602579
393 2935944949 2935942939 Bacteria 8599779
394 2935953386 2935951376 Bacteria 8602333
395 2935961121 2935959822 Bacteria 7869783
396 2935970226 2935967501 Bacteria 8603075
397 2935981047 2935975950 Bacteria 8347125
398 2935986794 2935984226 Bacteria 8302647
399 2935992582 2935992306 Bacteria 9802711
400 2936002454 2936002035 Bacteria 9362176
401 2936014961 2936011229 Bacteria 8801034
402 2936022058 2936019824 Bacteria 8804134
403 2936032746 2936028420 Bacteria 8965941
404 2936037543 2936037263 Bacteria 9446081
405 2936050702 2936046547 Bacteria 8903709
406 2936059521 2936055302 Bacteria 8785755
407 2940557914 2940556831 Bacteria 9590747
408 2941513623 2941507105 Bacteria 8166816
409 2941521521 2941515067 Bacteria 8166720
410 2941529275 2941523033 Bacteria 8169134
411 2941536757 2941531003 Bacteria 7653939
412 2941540665 2941538514 Bacteria 9402094
413 3005480905 3005474847 Bacteria 9259049
414 3005485069 3005483717 Bacteria 7877331
415 3005507408 3005506211 Bacteria 6943378
416 3005587366 3005587118 Bacteria 7794411
417 3005715521 3005710791 Bacteria 7622528
418 3005722857 3005718088 Bacteria 8283608
419 8006930661 8006926726 Bacteria 6749210
420 8006939805 8006933436 Bacteria 10410654
421 8006979574 8006973647 Bacteria 10679141
422 8006990314 8006984368 Bacteria 9651211
423 8016521096 8016511872 Bacteria 9921665
424 8016528992 8016522445 Bacteria 8156687
425 8016534193 8016530956 Bacteria 8155261
426 8016563090 8016557553 Bacteria 8154380
427 8016576703 8016575299 Bacteria 8154085
428 8016593791 8016583857 Bacteria 10421953
429 8016600847 8016595262 Bacteria 8149947
430 8016609646 8016603502 Bacteria 8731218
431 8016615282 8016613128 Bacteria 8794220
432 8016625926 8016622563 Bacteria 7999408
433 8016639508 8016630954 Bacteria 9217207
434 8017064511 8017057580 Bacteria 10023680
435 8019533965 8019530166 Bacteria 8155624
436 8019545706 8019538911 Bacteria 7872763
437 8019553007 8019547302 Bacteria 7996444
438 8019565711 8019555841 Bacteria 9642137
439 8019575802 8019565922 Bacteria 9639779
440 8019583876 8019576017 Bacteria 10049540
441 8019591687 8019586578 Bacteria 10212056
442 8019599649 8019597564 Bacteria 10041141
443 8019619487 8019619141 Bacteria 9218857
444 8019646271 8019638758 Bacteria 9062356
445 8019649023 8019648815 Bacteria 10014479
446 8019661512 8019659431 Bacteria 8577854
447 8019671045 8019668869 Bacteria 8791617
448 8019685145 8019678201 Bacteria 8863603
449 8019690737 8019687851 Bacteria 8712826
450 8055745448 8055742211 Bacteria 9226248
451 Ga0207645_10106050
452 JGI25153J46596_10001683
453 JGI25153J46596_10001686
454 JGI25160J50197_1000991
455 JGI25160J50197_1021402
456 Ga0055542_1007606
457 Ga0055531_10007448
458 Ga0065165_1000420
459 Ga0065165_1000556
460 Ga0065165_1022530
461 Ga0070670_100181431
462 Ga0070666_10117867
463 Ga0070682_100095890
464 Ga0070660_100108655
465 Ga0070687_100046187
466 Ga0070661_100081537
467 Ga0070692_10125190
468 Ga0070668_100042914
469 Ga0070668_100070156
470 Ga0070671_100114449
471 Ga0070659_100315954
472 Ga0070709_10000412
473 Ga0070714_100002292
474 Ga0070714_100034015
475 Ga0070710_10012033
476 Ga0070710_10016226
477 Ga0070705_100029232
478 Ga0070678_100277114
479 Ga0070662_100021506
480 Ga0070696_100086505
481 Ga0070693_100092442
482 Ga0070665_100145769
483 Ga0070665_100271517
484 Ga0068855_100082112
485 Ga0068857_100068885
486 Ga0068857_100298234
487 Ga0068852_100123890
488 Ga0068852_100246273
489 Ga0068852_100352385
490 Ga0068864_100106012
491 Ga0068870_10025307
492 Ga0068863_100043176
493 Ga0068863_100154933
494 Ga0068858_100066232
495 Ga0068860_100000312
496 Ga0068860_100080106
497 Ga0081540_1006288
498 Ga0070717_10009339
499 Ga0075365_10043348
500 Ga0075365_10082334
501 Ga0075368_10032736
502 Ga0075368_10049820
503 Ga0075364_10015455
504 Ga0070715_10001792
505 Ga0070716_100001697
506 Ga0070716_100060994
507 Ga0075366_10005300
508 Ga0097621_100089721
509 Ga0099824_1004605
510 Ga0099822_1000031
511 Ga0105245_10029674
512 Ga0114129_10093802
513 Ga0105241_10029509
514 Ga0105241_10060960
515 Ga0105248_10091048
516 Ga0105237_10030642
517 Ga0105237_10038406
518 Ga0105238_10134630
519 Ga0105239_10016189
520 Ga0105239_10164075
521 Ga0105239_10303723
522 Ga0105246_10061565
523 Ga0157374_10057825
524 Ga0157378_10042553
525 Ga0163163_10007677
526 Ga0163163_10071504
527 Ga0157377_10097242
528 Ga0157379_10007477
529 Ga0157379_10098603
530 Ga0157376_10021572
531 Ga0214544_1000004
532 Ga0214542_1000001
533 Ga0214545_1000001
534 Ga0214543_1000006
535 Ga0213876_10001319
536 Ga0213876_10114715
537 Ga0209677_101151
538 Ga0209148_1000566
539 Ga0209233_1001516
540 Ga0209233_1002707
541 Ga0209233_1010687
542 Ga0209455_1001114
543 Ga0209758_1000024
544 Ga0209758_1000068
545 Ga0209758_1002049
546 Ga0209758_1005922
547 Ga0209758_1048874
548 Ga0207426_1000120
549 Ga0207426_1000673
550 Ga0207426_1004196
551 Ga0209257_1001327
552 Ga0207692_10004793
553 Ga0207688_10064088
554 Ga0207685_10031338
555 Ga0207699_10044929
556 Ga0207693_10000217
557 Ga0207663_10000151
558 Ga0207657_10128206
559 Ga0207649_10048068
560 Ga0207700_10067405
561 Ga0207700_10228820
562 Ga0207664_10015026
563 Ga0207664_10040259
564 Ga0207706_10022693
565 Ga0207665_10000493
566 Ga0207689_10001713
567 Ga0207667_10068530
568 Ga0207640_10073577
569 Ga0207640_10136807
570 Ga0207658_10068456
571 Ga0207677_10024255
572 Ga0207703_10060972
573 Ga0207703_10106018
574 Ga0207639_10046719
575 Ga0207678_10008855
576 Ga0207678_10016825
577 Ga0207678_10094685
578 Ga0207641_10068221
579 Ga0207676_10009429
580 Ga0207674_10075668
581 Ga0207674_10082322
582 Ga0207675_100003788
583 Ga0207683_10026771
584 Ga0207698_10024978
585 Ga0209389_1000010
586 Ga0209389_1000149
587 Ga0209589_1000016
588 Ga0209589_1000025
589 Ga0209489_100016
590 Ga0209489_100039
591 Ga0209489_114750
592 Ga0209700_100030
593 Ga0209700_100043
594 Ga0209813_10031446
595 Ga0209813_10045155
596 Ga0268266_10016057
597 Ga0268264_10000030
598 Ga0268264_10118405
599 Ga0307511_10069376
600 Ga0315911_1000002
601 Ga0373937_0007657
602 Ga0373925_0071396
603 Ga0395905_0009332
604 Ga0395901_0215976
605 Ga0436365_0307003
606 Ga0436365_0894431
607 Ga0436360_0732042
608 Ga0466972_0000148
609 Ga0466972_0003448
610 Ga0466965_0124105
611 Ga0466966_0012261
612 Ga0466966_0015067
613 Ga0466961_0000008
614 Ga0466959_0009565
615 Ga0495592_0049716
616 Ga0495592_0090546
617 Ga0495629_0214803
618 Ga0495651_0001984
619 Ga0495651_0029080
620 Ga0495651_0085311
621 Ga0495653_0019076
622 Ga0495664_0031502
623 Ga0495606_0125679
624 Ga0495608_0012073
625 Ga0495628_0011313
626 Ga0495632_0086169
627 Ga0495652_0010482
628 Ga0495640_0016765
629 Ga0495640_0049025
630 Ga0495597_0004357
631 Ga0495645_0001873
632 Ga0495622_0037522
633 Ga0495667_0003300
634 Ga0495668_0025664
635 Ga0495634_0024720
636 Ga0495634_0104406
637 Ga0495635_0001999
638 Ga0495635_0009596
639 Ga0495588_0007284
640 Ga0495657_0001200
641 Ga0495613_0028267
642 Ga0495624_0014716
643 Ga0495649_0038769
644 Ga0495600_0002291
645 Ga0495581_0128706
646 Ga0495604_0009383
647 Ga0495674_0009389
648 Ga0495676_0041792
649 Ga0495680_0007048
650 Ga0495675_0001461
651 Ga0495684_0076471
652 Ga0495593_0031083
653 Ga0495602_0016196
654 Ga0496101_0063166
655 Ga0496102_0014553
656 Ga0496102_0056751
657 Ga0496102_0132083
658 Ga0496103_0011719
659 Ga0496104_0003456
660 Ga0496105_0001070
661 Ga0496110_0079158
662 Ga0496110_0098432
663 Ga0496112_0048480
664 Ga0496113_0043989
665 Ga0496114_0101393
666 Ga0496115_0031252
667 Ga0496116_0042437
668 Ga0496116_0072911
669 Ga0496118_0023183
670 Ga0496119_0011321
671 Ga0496120_0055355
672 Ga0496121_0035076
673 Ga0496121_0057029
674 Ga0496121_0060188
675 Ga0496121_0061598
676 Ga0496121_0131174
677 Ga0496122_0070871
678 Ga0496124_0097847
679 Ga0496125_0071000
680 Ga0496125_0089840
681 Ga0496126_0017234
682 Ga0496126_0034196
683 Ga0496126_0142350
684 Ga0496126_0144335
685 Ga0496126_0279548
686 Ga0501074_0113300
687 Ga0501044_0056476
688 nmdc:mga00v17_83213_c1
689 nmdc:mga0yw44_30835_c1
690 nmdc:mga0yw44_35076_c1
691 nmdc:mga0yw44_46356_c1
692 nmdc:mga0yw44_66048_c1
693 nmdc:mga06z11_19897_c1
694 nmdc:mga07m45_31452_c1
695 nmdc:mga0sz30_17191_c1
696 Ga0500566_0000613
697 Ga0500557_000009
698 Ga0500572_089090
699 Ga0500595_013847
700 Ga0500607_039111
701 Ga0500642_0000154
702 Ga0500655_011316
703 Ga0500559_0069320
704 Ga0500590_091441
705 Ga0500636_0000228
706 Ga0500637_0119199
707 Ga0500625_000053
708 Ga0500601_000488
709 Ga0500661_005325
710 2507507978
711 2508542085
712 2508692368
713 2511397996
714 2513622571
715 2513639404
716 2513647193
717 2513653751
718 2513696595
719 2513700781
720 2513715174
721 2513856188
722 2513877605
723 2513918091
724 2514009750
725 2515626865
726 2517103808
727 2517891671
728 2524442496
729 2524470111
730 2524536724
731 2617346478
732 2617378583
733 2671118558
734 2728751906
735 2745075603
736 2793060793
737 2793067043
738 2805918385
739 2818236230
740 2824605317
741 2824615567
742 2824634779
743 2824643740
744 2824670623
745 2824752804
746 2824774738
747 2838122982
748 2841944733
749 2841955975
750 2841960027
751 2841969888
752 2841978682
753 2841984192
754 2842040333
755 2842046723
756 2844319699
757 2847937020
758 2847947420
759 2849078688
760 2857513099
761 2874599071
762 2874617246
763 2874626620
764 2874635337
765 2874650484
766 2876764337
767 2876779110
768 2876822714
769 2879082903
770 2879083881
771 2879133032
772 2879149319
773 2881368109
774 2881667807
775 2885369587
776 2885381001
777 2885389130
778 2888385120
779 2888425267
780 2899261407
781 2903730620
782 2903776261
783 2904671961
784 2904697880
785 2904704589
786 2904712315
787 2906609572
788 2906616844
789 2906628885
790 2906642885
791 2906667175
792 2908742031
793 2908759703
794 2908780827
795 2919682024
796 2922372764
797 2922397408
798 2922431083
799 2929620586
800 2929626480
801 2932784653
802 2932795445
803 2932807961
804 2932809633
805 2932818624
806 2932828421
807 2933582503
808 2935609526
809 2935617394
810 2935636921
811 2935639124
812 2935652323
813 2935660905
814 2935666024
815 2935675672
816 2935685319
817 2935698568
818 2935704131
819 2935713872
820 2935724491
821 2935733151
822 2935742530
823 2935751284
824 2935765945
825 2935769926
826 2935782054
827 2935785832
828 2935794240
829 2935802214
830 2935811038
831 2935822688
832 2935828619
833 2935839995
834 2935848270
835 2935856019
836 2935866037
837 2935877638
838 2935883655
839 2935909927
840 2935917653
841 2935927407
842 2935936748
843 2935944949
844 2935953386
845 2935961121
846 2935970226
847 2935981047
848 2935986794
849 2935992582
850 2936002454
851 2936014961
852 2936022058
853 2936032746
854 2936037543
855 2936050702
856 2936059521
857 2940557914
858 2941513623
859 2941521521
860 2941529275
861 2941536757
862 2941540665
863 3005480905
864 3005485069
865 3005507408
866 3005587366
867 3005715521
868 3005722857
869 8006930661
870 8006939805
871 8006979574
872 8006990314
873 8016521096
874 8016528992
875 8016534193
876 8016563090
877 8016576703
878 8016593791
879 8016600847
880 8016609646
881 8016615282
882 8016625926
883 8016639508
884 8017064511
885 8019533965
886 8019545706
887 8019553007
888 8019565711
889 8019575802
890 8019583876
891 8019591687
892 8019599649
893 8019619487
894 8019646271
895 8019649023
896 8019661512
897 8019671045
898 8019685145
899 8019690737
900 8055745448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03460

NIR_SIR_ferr

Nitrite/Sulfite reductase ferredoxin-like half domain

15

82

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7npa-assembly4.cif.gz_M crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution 0.7494 20 153
7npa-assembly4.cif.gz_N crystal structure of the coenzyme f420-dependent sulfite reductase from methanothermococcus thermolithotrophicus at 1.55-a resolution 0.741 12 153
7np8-assembly1.cif.gz_B crystal structure of the coenzyme f420-dependent sulfite reductase from methanocaldococcus jannaschii at 2.3-a resolution 0.7262 12 139
3b0m-assembly1.cif.gz_A m175k mutant of assimilatory nitrite reductase (nii3) from tobbaco leaf 0.7004 12 366
3vly-assembly1.cif.gz_A assimilatory nitrite reductase (nii3) - n226k mutant - so3 partial complex from tobacco leaf 0.6992 12 366
ID Description Score Start End Superfamily
af_P47169_904_971_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.9488 24 81 3.90.480.10
af_Q10675_25_86_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.93 25 85 3.90.480.10
af_P08201_545_638_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.8896 16 85 3.90.480.10
af_O53674_571_635_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.8781 24 80 3.90.480.10
af_Q10675_25_86_3.90.480.10 Alpha Beta;Alpha-Beta Complex;Sulfite Reductase Hemoprotein; domain 2;Sulfite Reductase Hemoprotein;Domain 2 0.8739 25 85 3.90.480.10
ID Description Score Start End GO Terms
AF-A0A7Y4XGT6-F1-model_v4 Precorrin-3B synthase (EC 1.14.13.83) 0.9538 17 370 GO:0043818
GO:0046872
GO:0051536
AF-A0A7Y4XKZ4-F1-model_v4 Precorrin-3B synthase (EC 1.14.13.83) 0.9447 1 370 GO:0043818
GO:0046872
GO:0051536
AF-A0A4U6S7D2-F1-model_v4 Precorrin-3B synthase (EC 1.14.13.83) 0.9445 1 370 GO:0020037
GO:0043818
GO:0046872
GO:0051539
AF-A0A1Q5RVM7-F1-model_v4 Precorrin-3B synthase 0.9434 1 305 GO:0016491
AF-A0A7Y4XKZ4-F1-model_v4 Precorrin-3B synthase (EC 1.14.13.83) 0.9423 1 370 GO:0043818
GO:0046872
GO:0051536

Map