F446550

General Info

Members Datasets Scaffolds Average Seq Length
450 226 900 209

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100557687|Ga0068855_1005576872
Length 237
Sequence LTGVGSTEPAEEGRAGLAGASRVQSERAERLLQIADDELIVGWRDSEWTGIAPTLEEDVAFSSIAQNEIGHARALYELAAAELGTDADALAFDRQPDEYRCAPFVELRLMDWAHTIARRYLYEEADRVRLDALKAGDDAELAGLAAKIDREETYHRLHAEMWAGRLRDEPRFRSAVAELWPYALGVVEEEQRAELARRTGLRVDSTQIVQRGQHTPELAELWNEMTEVRRSAPGATW

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
127 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
128 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
212 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 2.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 7.56
Rhizosphere 91.33
Stem 0
Stem Tuber 0
Unclassified 17.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100557687 3300005563 Bacteria 1239
2 Ga0070658_10003469 3300005327 Bacteria 12957
3 Ga0070658_10011960 3300005327 Bacteria 6969
4 Ga0070658_10204811 3300005327 Bacteria 1666
5 Ga0070658_10383887 3300005327 Bacteria 1205
6 Ga0070658_10475860 3300005327 Bacteria 1078
7 Ga0070658_10525193 3300005327 Bacteria 1023
8 Ga0070658_11075628 3300005327 Bacteria 700
9 Ga0070683_100013245 3300005329 Bacteria 7187
10 Ga0070683_100068964 3300005329 Unclassified 3295
11 Ga0070683_100186588 3300005329 Unclassified 1969
12 Ga0070683_100540971 3300005329 Bacteria 1113
13 Ga0070680_100167406 3300005336 Unclassified 1848
14 Ga0070680_100239043 3300005336 Bacteria 1535
15 Ga0070680_100266248 3300005336 Bacteria 1451
16 Ga0070680_100772434 3300005336 Bacteria 827
17 Ga0070660_100000770 3300005339 Bacteria 21264
18 Ga0070660_100000958 3300005339 Bacteria 19288
19 Ga0070660_100039764 3300005339 Bacteria 3575
20 Ga0070660_100103906 3300005339 Bacteria 2253
21 Ga0070660_100766584 3300005339 Bacteria 810
22 Ga0070661_100132720 3300005344 Unclassified 1871
23 Ga0070661_100150600 3300005344 Bacteria 1758
24 Ga0070661_100208977 3300005344 Bacteria 1493
25 Ga0070661_100400842 3300005344 Unclassified 1085
26 Ga0070692_10192406 3300005345 Bacteria 1189
27 Ga0070671_100336056 3300005355 Bacteria 1288
28 Ga0070673_100438396 3300005364 Bacteria 1173
29 Ga0070714_100292439 3300005435 Unclassified 1516
30 Ga0070714_100302743 3300005435 Bacteria 1491
31 Ga0070714_100340116 3300005435 Bacteria 1407
32 Ga0070714_101069974 3300005435 Archaea 786
33 Ga0070713_100461324 3300005436 Bacteria 1194
34 Ga0070705_100014056 3300005440 Bacteria 4108
35 Ga0070708_100209507 3300005445 Unclassified 1826
36 Ga0070662_100200402 3300005457 Unclassified 1583
37 Ga0070681_10013253 3300005458 Bacteria 8192
38 Ga0070681_10029237 3300005458 Bacteria 5533
39 Ga0070681_10058957 3300005458 Bacteria 3818
40 Ga0070681_10154830 3300005458 Bacteria 2217
41 Ga0070685_10020303 3300005466 Bacteria 3595
42 Ga0070706_100045327 3300005467 Bacteria 4062
43 Ga0070706_100159650 3300005467 Bacteria 2105
44 Ga0070706_100622139 3300005467 Unclassified 1003
45 Ga0070698_100005575 3300005471 Bacteria 13761
46 Ga0070698_100301966 3300005471 Bacteria 1532
47 Ga0070698_100393607 3300005471 Unclassified 1319
48 Ga0070698_100703629 3300005471 Unclassified 952
49 Ga0070699_100009191 3300005518 Bacteria 8570
50 Ga0070679_100012090 3300005530 Bacteria 8244
51 Ga0070679_100069565 3300005530 Bacteria 3511
52 Ga0070679_100114800 3300005530 Bacteria 2679
53 Ga0070679_100318235 3300005530 Bacteria 1505
54 Ga0070679_100352297 3300005530 Bacteria 1420
55 Ga0070679_100409042 3300005530 Bacteria 1302
56 Ga0070679_101014863 3300005530 Unclassified 774
57 Ga0070684_100094521 3300005535 Bacteria 2663
58 Ga0070684_100252078 3300005535 Unclassified 1613
59 Ga0070697_100292175 3300005536 Bacteria 1400
60 Ga0068853_100235726 3300005539 Bacteria 1675
61 Ga0068853_100421598 3300005539 Bacteria 1251
62 Ga0070672_100028020 3300005543 Bacteria 4209
63 Ga0070696_100153928 3300005546 Bacteria 1690
64 Ga0070693_100032743 3300005547 Bacteria 2862
65 Ga0070693_100198818 3300005547 Unclassified 1300
66 Ga0070665_100035811 3300005548 Bacteria 4994
67 Ga0068855_100024269 3300005563 Bacteria 7260
68 Ga0068855_100116362 3300005563 Bacteria 3064
69 Ga0068855_100118130 3300005563 Bacteria 3037
70 Ga0068855_100247495 3300005563 Bacteria 1989
71 Ga0068857_100034598 3300005577 Bacteria 4468
72 Ga0068857_100040657 3300005577 Bacteria 4123
73 Ga0068852_100147275 3300005616 Unclassified 2185
74 Ga0068859_100034552 3300005617 Bacteria 5073
75 Ga0068866_10010783 3300005718 Bacteria 3929
76 Ga0068858_100122478 3300005842 Bacteria 2433
77 Ga0068862_100169910 3300005844 Bacteria 1951
78 Ga0070717_10368590 3300006028 Bacteria 1286
79 Ga0075363_100254284 3300006048 Bacteria 1012
80 Ga0075364_10026390 3300006051 Bacteria 3706
81 Ga0075432_10020746 3300006058 Bacteria 2247
82 Ga0075432_10073621 3300006058 Bacteria 1230
83 Ga0070715_10252835 3300006163 Unclassified 922
84 Ga0070712_100365184 3300006175 Bacteria 1185
85 Ga0070712_100682040 3300006175 Unclassified 875
86 Ga0068871_100102966 3300006358 Bacteria 2393
87 Ga0075428_100151804 3300006844 Bacteria 2517
88 Ga0075430_100004333 3300006846 Bacteria 11984
89 Ga0075434_100068175 3300006871 Bacteria 3544
90 Ga0075429_101121621 3300006880 Bacteria 687
91 Ga0068865_100016483 3300006881 Bacteria 4729
92 Ga0097620_100034553 3300006931 Bacteria 5073
93 Ga0075435_100018465 3300007076 Bacteria 5305
94 Ga0105244_10192117 3300009036 Bacteria 965
95 Ga0105240_10294968 3300009093 Unclassified 1857
96 Ga0105240_10302523 3300009093 Bacteria 1829
97 Ga0105240_10656873 3300009093 Unclassified 1149
98 Ga0111539_10029718 3300009094 Bacteria 6652
99 Ga0111539_10434042 3300009094 Bacteria 1529
100 Ga0111539_10468954 3300009094 Bacteria 1466
101 Ga0105245_10082572 3300009098 Bacteria 2940
102 Ga0105245_10371646 3300009098 Bacteria 1422
103 Ga0105247_10381808 3300009101 Unclassified 999
104 Ga0114129_10621863 3300009147 Unclassified 1397
105 Ga0114129_10734689 3300009147 Bacteria 1265
106 Ga0105242_10289931 3300009176 Unclassified 1490
107 Ga0105237_10544184 3300009545 Bacteria 1168
108 Ga0105237_11132288 3300009545 Bacteria 789
109 Ga0105238_10135908 3300009551 Unclassified 2436
110 Ga0105238_10598436 3300009551 Bacteria 1110
111 Ga0105238_10829990 3300009551 Bacteria 941
112 Ga0105246_10514047 3300011119 Bacteria 1019
113 Ga0157342_1010664 3300012507 Unclassified 943
114 Ga0157373_10767941 3300013100 Bacteria 709
115 Ga0157371_10058706 3300013102 Unclassified 2729
116 Ga0157370_10012707 3300013104 Bacteria 8714
117 Ga0157370_10027050 3300013104 Bacteria 5656
118 Ga0157370_10368440 3300013104 Bacteria 1324
119 Ga0157369_10033325 3300013105 Bacteria 5661
120 Ga0157369_10169266 3300013105 Bacteria 2303
121 Ga0157378_10080175 3300013297 Bacteria 2949
122 Ga0157372_10084210 3300013307 Unclassified 3603
123 Ga0157372_10134417 3300013307 Bacteria 2847
124 Ga0157372_10475162 3300013307 Bacteria 1457
125 Ga0157372_10683524 3300013307 Unclassified 1195
126 Ga0157372_10761949 3300013307 Bacteria 1125
127 Ga0157372_11323776 3300013307 Unclassified 831
128 Ga0157375_10408575 3300013308 Unclassified 1524
129 Ga0157375_10479157 3300013308 Bacteria 1409
130 Ga0157379_10047286 3300014968 Bacteria 3839
131 Ga0206356_10031109 3300020070 Bacteria 2906
132 Ga0206356_10201450 3300020070 Bacteria 912
133 Ga0206356_11548484 3300020070 Bacteria 1726
134 Ga0206352_11351725 3300020078 Bacteria 894
135 Ga0206354_10186196 3300020081 Bacteria 3488
136 Ga0206354_10301111 3300020081 Bacteria 5364
137 Ga0206354_10484028 3300020081 Bacteria 1480
138 Ga0206354_10560557 3300020081 Bacteria 1846
139 Ga0206354_11524493 3300020081 Bacteria 2670
140 Ga0206354_11702124 3300020081 Unclassified 2032
141 Ga0206353_10597085 3300020082 Bacteria 3848
142 Ga0213874_10133602 3300021377 Bacteria 854
143 Ga0224712_10033779 3300022467 Unclassified 1875
144 Ga0207656_10054145 3300025321 Unclassified 1743
145 Ga0207710_10044878 3300025900 Unclassified 1970
146 Ga0207647_10255226 3300025904 Unclassified 1005
147 Ga0207705_10087417 3300025909 Bacteria 2279
148 Ga0207705_10167051 3300025909 Unclassified 1655
149 Ga0207705_10271118 3300025909 Bacteria 1298
150 Ga0207705_10537376 3300025909 Bacteria 909
151 Ga0207684_10083213 3300025910 Unclassified 2725
152 Ga0207654_10482337 3300025911 Archaea 873
153 Ga0207707_10009913 3300025912 Bacteria 8260
154 Ga0207707_10041218 3300025912 Bacteria 4032
155 Ga0207707_10071389 3300025912 Bacteria 3026
156 Ga0207707_10126697 3300025912 Bacteria 2233
157 Ga0207707_10335381 3300025912 Unclassified 1304
158 Ga0207695_10100259 3300025913 Unclassified 2892
159 Ga0207695_10544845 3300025913 Bacteria 1042
160 Ga0207695_10884538 3300025913 Bacteria 773
161 Ga0207671_10116740 3300025914 Unclassified 2036
162 Ga0207693_10095723 3300025915 Bacteria 2327
163 Ga0207660_10029469 3300025917 Bacteria 3766
164 Ga0207660_10056430 3300025917 Bacteria 2810
165 Ga0207660_10067436 3300025917 Bacteria 2592
166 Ga0207660_10132535 3300025917 Bacteria 1898
167 Ga0207657_10000416 3300025919 Bacteria 45222
168 Ga0207657_10000610 3300025919 Bacteria 37898
169 Ga0207657_10011107 3300025919 Bacteria 8952
170 Ga0207657_10011244 3300025919 Bacteria 8893
171 Ga0207657_10030157 3300025919 Bacteria 4927
172 Ga0207657_10165579 3300025919 Bacteria 1793
173 Ga0207657_10896469 3300025919 Bacteria 683
174 Ga0207649_10032978 3300025920 Bacteria 3091
175 Ga0207649_10079107 3300025920 Bacteria 2123
176 Ga0207649_10099349 3300025920 Bacteria 1922
177 Ga0207649_10260119 3300025920 Bacteria 1254
178 Ga0207649_10324027 3300025920 Bacteria 1133
179 Ga0207652_10014185 3300025921 Bacteria 6452
180 Ga0207652_10024439 3300025921 Bacteria 5013
181 Ga0207652_10028720 3300025921 Bacteria 4643
182 Ga0207652_10037811 3300025921 Bacteria 4087
183 Ga0207652_10101655 3300025921 Bacteria 2539
184 Ga0207652_10311564 3300025921 Bacteria 1421
185 Ga0207652_10427892 3300025921 Bacteria 1194
186 Ga0207652_10537273 3300025921 Bacteria 1051
187 Ga0207652_10905361 3300025921 Bacteria 779
188 Ga0207646_10786117 3300025922 Bacteria 848
189 Ga0207700_10113433 3300025928 Unclassified 2185
190 Ga0207700_10486757 3300025928 Bacteria 1091
191 Ga0207700_10863486 3300025928 Unclassified 810
192 Ga0207664_10001609 3300025929 Bacteria 14849
193 Ga0207664_10004599 3300025929 Bacteria 9350
194 Ga0207664_10033779 3300025929 Bacteria 3935
195 Ga0207664_10034027 3300025929 Bacteria 3922
196 Ga0207664_10108713 3300025929 Bacteria 2303
197 Ga0207664_10230796 3300025929 Bacteria 1608
198 Ga0207664_10274653 3300025929 Unclassified 1477
199 Ga0207644_10266522 3300025931 Bacteria 1371
200 Ga0207690_10101909 3300025932 Unclassified 2052
201 Ga0207690_10488398 3300025932 Bacteria 995
202 Ga0207670_10313919 3300025936 Unclassified 1231
203 Ga0207691_10100820 3300025940 Bacteria 2577
204 Ga0207661_10116140 3300025944 Bacteria 2271
205 Ga0207661_10178036 3300025944 Unclassified 1855
206 Ga0207661_10354710 3300025944 Bacteria 1324
207 Ga0207679_10490163 3300025945 Bacteria 1095
208 Ga0207679_10916379 3300025945 Bacteria 802
209 Ga0207667_10035295 3300025949 Bacteria 5364
210 Ga0207667_10227120 3300025949 Bacteria 1912
211 Ga0207667_10368747 3300025949 Bacteria 1464
212 Ga0207667_10425607 3300025949 Bacteria 1350
213 Ga0207667_10465256 3300025949 Bacteria 1284
214 Ga0207667_10573750 3300025949 Bacteria 1139
215 Ga0207667_10754573 3300025949 Archaea 972
216 Ga0207667_10818315 3300025949 Bacteria 927
217 Ga0207639_10669875 3300026041 Bacteria 961
218 Ga0207639_10755630 3300026041 Bacteria 904
219 Ga0207648_10287685 3300026089 Unclassified 1471
220 Ga0207676_10688355 3300026095 Unclassified 989
221 Ga0207674_10002130 3300026116 Bacteria 25022
222 Ga0207674_10051110 3300026116 Bacteria 4219
223 Ga0207674_10109547 3300026116 Unclassified 2738
224 Ga0207698_10270097 3300026142 Bacteria 1567
225 Ga0207428_10023100 3300027907 Bacteria 5234
226 Ga0207428_10031952 3300027907 Bacteria 4335
227 Ga0207428_10192141 3300027907 Bacteria 1538
228 Ga0268264_10021051 3300028381 Bacteria 5330
229 Ga0265318_10032382 3300028577 Bacteria 2023
230 Ga0265338_10003515 3300028800 Bacteria 21949
231 Ga0265332_10028012 3300031238 Bacteria 2467
232 Ga0265325_10112752 3300031241 Bacteria 1319
233 Ga0265339_10042901 3300031249 Bacteria 2503
234 Ga0265316_10105558 3300031344 Bacteria 2137
235 Ga0265313_10066148 3300031595 Bacteria 1676
236 Ga0265314_10086718 3300031711 Bacteria 2048
237 Ga0307416_100033905 3300032002 Bacteria 3878
238 Ga0373934_0219966 3300035086 Bacteria 783
239 Ga0373923_0049874 3300035111 Bacteria 1752
240 Ga0373946_0220067 3300035171 Unclassified 916
241 Ga0373955_0084565 3300035172 Bacteria 1799
242 Ga0373935_0167662 3300035692 Bacteria 1500
243 Ga0373933_0155010 3300035724 Bacteria 1452
244 Ga0373947_0210853 3300035725 Unclassified 1274
245 Ga0395899_0009583 3300037312 Bacteria 7435
246 Ga0395899_0020914 3300037312 Bacteria 4963
247 Ga0395899_0109834 3300037312 Unclassified 1984
248 Ga0395899_0512547 3300037312 Bacteria 776
249 Ga0395900_0003269 3300037418 Bacteria 17549
250 Ga0395900_0005435 3300037418 Bacteria 13348
251 Ga0395900_0015675 3300037418 Bacteria 7726
252 Ga0395900_0039965 3300037418 Bacteria 4834
253 Ga0395900_0076531 3300037418 Bacteria 3439
254 Ga0395900_0230228 3300037418 Unclassified 1864
255 Ga0395898_0002036 3300037466 Bacteria 25304
256 Ga0395898_0004415 3300037466 Bacteria 15390
257 Ga0395898_0023807 3300037466 Bacteria 6183
258 Ga0395898_0096858 3300037466 Bacteria 2834
259 Ga0395898_0106784 3300037466 Bacteria 2685
260 Ga0395898_0114557 3300037466 Bacteria 2583
261 Ga0395898_0133762 3300037466 Bacteria 2374
262 Ga0395898_0274595 3300037466 Unclassified 1607
263 Ga0395898_0523214 3300037466 Bacteria 1127
264 Ga0395898_0581555 3300037466 Bacteria 1062
265 Ga0395898_0779046 3300037466 Bacteria 897
266 Ga0395905_0013206 3300037471 Bacteria 7925
267 Ga0395905_0042800 3300037471 Unclassified 4248
268 Ga0395905_0058750 3300037471 Bacteria 3596
269 Ga0395905_0090739 3300037471 Bacteria 2865
270 Ga0395905_0099798 3300037471 Bacteria 2726
271 Ga0395905_0160384 3300037471 Bacteria 2114
272 Ga0395905_0354707 3300037471 Bacteria 1359
273 Ga0395905_0552546 3300037471 Unclassified 1053
274 Ga0395905_0955587 3300037471 Bacteria 760
275 Ga0395901_0003449 3300038443 Bacteria 15941
276 Ga0395901_0041820 3300038443 Bacteria 4750
277 Ga0395901_0076257 3300038443 Bacteria 3497
278 Ga0395901_0083972 3300038443 Bacteria 3329
279 Ga0395901_0084802 3300038443 Bacteria 3311
280 Ga0395901_0119021 3300038443 Bacteria 2775
281 Ga0395901_0326371 3300038443 Bacteria 1587
282 Ga0395901_0457469 3300038443 Bacteria 1304
283 Ga0395901_0611488 3300038443 Unclassified 1098
284 Ga0395901_0614948 3300038443 Unclassified 1094
285 Ga0395901_0755365 3300038443 Unclassified 965
286 Ga0436363_1551465 3300039450 Unclassified 842
287 Ga0450923_060889 3300042125 Bacteria 823
288 Ga0466966_0018063 3300044684 Bacteria 4655
289 Ga0466966_0119824 3300044684 Bacteria 1617
290 Ga0466966_0388891 3300044684 Unclassified 838
291 Ga0466961_0215387 3300044693 Bacteria 1185
292 Ga0466961_0271695 3300044693 Bacteria 1038
293 Ga0466963_0006203 3300044694 Bacteria 7061
294 Ga0466963_0054124 3300044694 Bacteria 2666
295 Ga0466963_0222460 3300044694 Bacteria 1322
296 Ga0466964_0002807 3300044706 Bacteria 6269
297 Ga0466971_0026023 3300044719 Bacteria 2614
298 Ga0466968_0074794 3300044735 Bacteria 1480
299 Ga0466957_0270103 3300044842 Bacteria 1135
300 Ga0466957_0318621 3300044842 Archaea 1049
301 Ga0466959_0001430 3300045049 Bacteria 14615
302 Ga0466959_0022176 3300045049 Bacteria 4691
303 Ga0466958_0015095 3300045836 Bacteria 4420
304 Ga0466958_0051355 3300045836 Bacteria 2496
305 Ga0466958_0083367 3300045836 Bacteria 1970
306 Ga0466958_0346161 3300045836 Unclassified 956
307 Ga0466958_0420962 3300045836 Archaea 863
308 Ga0466967_0002231 3300045976 Bacteria 11932
309 Ga0466967_0004455 3300045976 Bacteria 9448
310 Ga0466967_0007992 3300045976 Bacteria 7701
311 Ga0466967_0014643 3300045976 Bacteria 6119
312 Ga0466967_0016687 3300045976 Bacteria 5800
313 Ga0466967_0021851 3300045976 Bacteria 5207
314 Ga0466967_0039588 3300045976 Bacteria 4053
315 Ga0466967_0230878 3300045976 Unclassified 1762
316 Ga0466967_0368089 3300045976 Bacteria 1394
317 Ga0466967_0556293 3300045976 Bacteria 1129
318 Ga0466967_0690588 3300045976 Bacteria 1010
319 Ga0495592_0050328 3300046454 Bacteria 3095
320 Ga0495603_0300235 3300046455 Unclassified 922
321 Ga0495629_0137680 3300046459 Unclassified 1699
322 Ga0495651_0014102 3300046462 Bacteria 6180
323 Ga0495653_0090906 3300046463 Bacteria 2232
324 Ga0495582_0041370 3300046473 Unclassified 2539
325 Ga0495605_0196790 3300046474 Bacteria 880
326 Ga0495662_0217248 3300046476 Bacteria 942
327 Ga0495664_0113163 3300046477 Bacteria 1639
328 Ga0495594_0290686 3300046499 Unclassified 931
329 Ga0495596_0284272 3300046500 Bacteria 643
330 Ga0495608_0021759 3300046511 Bacteria 4399
331 Ga0495608_0028598 3300046511 Bacteria 3788
332 Ga0495618_0163135 3300046514 Bacteria 1420
333 Ga0495628_0085118 3300046516 Unclassified 2453
334 Ga0495630_0055383 3300046517 Bacteria 2972
335 Ga0495663_0209606 3300046525 Bacteria 682
336 Ga0495652_0083335 3300046529 Unclassified 2632
337 Ga0495665_0202249 3300046531 Unclassified 1029
338 Ga0495640_0018013 3300046533 Bacteria 5251
339 Ga0495587_0068338 3300046536 Unclassified 2069
340 Ga0495667_0035035 3300046559 Bacteria 3356
341 Ga0495656_0069961 3300046615 Bacteria 1556
342 Ga0495634_0141128 3300046642 Bacteria 1529
343 Ga0495634_0184245 3300046642 Bacteria 1306
344 Ga0495635_0372317 3300046663 Bacteria 951
345 Ga0495657_0090092 3300046675 Unclassified 1969
346 Ga0495599_0047260 3300046678 Bacteria 2697
347 Ga0495623_0083936 3300046679 Bacteria 1966
348 Ga0495646_0086773 3300046680 Bacteria 1814
349 Ga0495613_0371954 3300046689 Unclassified 978
350 Ga0495581_0006867 3300047315 Bacteria 6602
351 Ga0495604_0153664 3300047317 Bacteria 1632
352 Ga0495674_0005282 3300047319 Bacteria 12386
353 Ga0495674_0062325 3300047319 Bacteria 3248
354 Ga0495674_0266334 3300047319 Bacteria 1407
355 Ga0495676_0089428 3300047321 Bacteria 2307
356 Ga0495680_0055160 3300047322 Bacteria 3083
357 Ga0495680_0069307 3300047322 Bacteria 2691
358 Ga0495675_0051700 3300047444 Bacteria 2609
359 Ga0495684_0159503 3300047471 Bacteria 1683
360 Ga0495684_0250499 3300047471 Bacteria 1289
361 Ga0495602_0128017 3300048088 Bacteria 2030
362 Ga0495602_0330168 3300048088 Bacteria 1106
363 Ga0495614_0141287 3300048089 Unclassified 1070
364 Ga0496100_0001462 3300048903 Bacteria 11571
365 Ga0496100_0022239 3300048903 Bacteria 3835
366 Ga0496100_0262147 3300048903 Unclassified 1282
367 Ga0496101_0024104 3300048904 Bacteria 4209
368 Ga0496101_0087899 3300048904 Bacteria 2307
369 Ga0496102_0033555 3300048905 Bacteria 4612
370 Ga0496102_0051834 3300048905 Bacteria 3738
371 Ga0496103_0073909 3300048906 Bacteria 2136
372 Ga0496104_0000610 3300048907 Bacteria 30613
373 Ga0496104_0208920 3300048907 Bacteria 1864
374 Ga0496105_0000258 3300048908 Bacteria 35685
375 Ga0496105_0033251 3300048908 Bacteria 4233
376 Ga0496106_0020205 3300048909 Bacteria 4941
377 Ga0496107_0005142 3300048910 Bacteria 8928
378 Ga0496107_0010809 3300048910 Bacteria 6350
379 Ga0496108_0007577 3300048911 Bacteria 8791
380 Ga0496108_0422308 3300048911 Bacteria 1164
381 Ga0496109_0000505 3300048912 Bacteria 33331
382 Ga0496109_0182813 3300048912 Bacteria 1969
383 Ga0496110_0044078 3300048913 Bacteria 3895
384 Ga0496111_0036894 3300048914 Bacteria 3496
385 Ga0496111_0319777 3300048914 Unclassified 1149
386 Ga0496112_0017212 3300048915 Bacteria 6787
387 Ga0496112_0051841 3300048915 Bacteria 4025
388 Ga0496112_0158208 3300048915 Archaea 2232
389 Ga0496112_0679734 3300048915 Bacteria 958
390 Ga0496113_0339703 3300048916 Bacteria 1204
391 Ga0496113_0477012 3300048916 Archaea 1002
392 Ga0496114_0022894 3300048917 Bacteria 5092
393 Ga0496114_0234267 3300048917 Bacteria 1613
394 Ga0496114_0466716 3300048917 Bacteria 1117
395 Ga0496115_0010517 3300048918 Bacteria 6917
396 Ga0496115_0070978 3300048918 Bacteria 2824
397 Ga0496115_0091740 3300048918 Bacteria 2483
398 Ga0501031_0238797 3300049568 Bacteria 1182
399 Ga0501038_0259535 3300049574 Bacteria 1374
400 Ga0501040_0111732 3300049576 Bacteria 1911
401 Ga0501042_0050036 3300049578 Bacteria 2981
402 Ga0501048_0332709 3300049582 Bacteria 1082
403 Ga0501067_0001545 3300049583 Bacteria 12553
404 Ga0501067_0109840 3300049583 Bacteria 1533
405 Ga0501067_0112462 3300049583 Bacteria 1514
406 Ga0501068_0200236 3300049584 Bacteria 1266
407 Ga0501068_0379550 3300049584 Bacteria 910
408 Ga0501069_0035781 3300049585 Unclassified 2736
409 Ga0501069_0209029 3300049585 Bacteria 1132
410 Ga0501069_0308434 3300049585 Bacteria 929
411 Ga0501069_0476286 3300049585 Bacteria 743
412 Ga0501070_0011133 3300049586 Bacteria 7592
413 Ga0501070_0026496 3300049586 Bacteria 4862
414 Ga0501070_0191379 3300049586 Bacteria 1681
415 Ga0501071_0008346 3300049587 Bacteria 6843
416 Ga0501072_0110853 3300049588 Bacteria 2184
417 Ga0501073_0014448 3300049589 Bacteria 5737
418 Ga0501073_0028986 3300049589 Bacteria 3955
419 Ga0501074_0076323 3300049590 Bacteria 2405
420 Ga0501075_0003907 3300049591 Bacteria 10039
421 Ga0501075_0226979 3300049591 Bacteria 1424
422 Ga0501076_0225909 3300049592 Bacteria 1530
423 Ga0501079_0162006 3300049741 Bacteria 1744
424 Ga0501080_0002500 3300049742 Bacteria 16098
425 Ga0501081_0104793 3300049743 Unclassified 2003
426 Ga0501083_0001476 3300049744 Bacteria 16080
427 Ga0501035_0304440 3300049822 Bacteria 1342
428 Ga0501045_0055507 3300049824 Bacteria 2897
429 nmdc:mga00v17_91532_c1 3300050491 Bacteria 1911
430 nmdc:mga05p37_1046181_c1 3300050507 Bacteria 862
431 nmdc:mga05p37_247460_c1 3300050507 Bacteria 2140
432 nmdc:mga09592_89538_c1 3300050508 Bacteria 2629
433 nmdc:mga0qj67_45750_c1 3300050509 Bacteria 3453
434 nmdc:mga0qj67_8617_c1 3300050509 Bacteria 7567
435 nmdc:mga06r32_111300_c1 3300050510 Bacteria 2695
436 nmdc:mga08y16_262749_c1 3300050511 Bacteria 1783
437 nmdc:mga08y16_392317_c1 3300050511 Bacteria 1422
438 nmdc:mga08y16_71230_c1 3300050511 Bacteria 3623
439 nmdc:mga0n895_698634_c1 3300050512 Unclassified 1010
440 nmdc:mga0n895_75033_c1 3300050512 Bacteria 3361
441 nmdc:mga0rr50_6584_c1 3300050513 Bacteria 7095
442 nmdc:mga0a205_90384_c1 3300050515 Bacteria 1567
443 Ga0495595_0094983 3300053084 Bacteria 1434
444 Ga0495619_0014801 3300053085 Bacteria 4928
445 Ga0501084_0380857 3300054114 Bacteria 1192
446 Ga0501082_0035888 3300060353 Bacteria 4273
447 Ga0501082_0216394 3300060353 Bacteria 1667
448 Ga0466962_0028444 3300061719 Bacteria 2678
449 Ga0466962_0124422 3300061719 Bacteria 1245
450 Ga0530510_0217387 3300061734 Bacteria 1420
451 Ga0068855_100557687
452 Ga0070658_10003469
453 Ga0070658_10011960
454 Ga0070658_10204811
455 Ga0070658_10383887
456 Ga0070658_10475860
457 Ga0070658_10525193
458 Ga0070658_11075628
459 Ga0070683_100013245
460 Ga0070683_100068964
461 Ga0070683_100186588
462 Ga0070683_100540971
463 Ga0070680_100167406
464 Ga0070680_100239043
465 Ga0070680_100266248
466 Ga0070680_100772434
467 Ga0070660_100000770
468 Ga0070660_100000958
469 Ga0070660_100039764
470 Ga0070660_100103906
471 Ga0070660_100766584
472 Ga0070661_100132720
473 Ga0070661_100150600
474 Ga0070661_100208977
475 Ga0070661_100400842
476 Ga0070692_10192406
477 Ga0070671_100336056
478 Ga0070673_100438396
479 Ga0070714_100292439
480 Ga0070714_100302743
481 Ga0070714_100340116
482 Ga0070714_101069974
483 Ga0070713_100461324
484 Ga0070705_100014056
485 Ga0070708_100209507
486 Ga0070662_100200402
487 Ga0070681_10013253
488 Ga0070681_10029237
489 Ga0070681_10058957
490 Ga0070681_10154830
491 Ga0070685_10020303
492 Ga0070706_100045327
493 Ga0070706_100159650
494 Ga0070706_100622139
495 Ga0070698_100005575
496 Ga0070698_100301966
497 Ga0070698_100393607
498 Ga0070698_100703629
499 Ga0070699_100009191
500 Ga0070679_100012090
501 Ga0070679_100069565
502 Ga0070679_100114800
503 Ga0070679_100318235
504 Ga0070679_100352297
505 Ga0070679_100409042
506 Ga0070679_101014863
507 Ga0070684_100094521
508 Ga0070684_100252078
509 Ga0070697_100292175
510 Ga0068853_100235726
511 Ga0068853_100421598
512 Ga0070672_100028020
513 Ga0070696_100153928
514 Ga0070693_100032743
515 Ga0070693_100198818
516 Ga0070665_100035811
517 Ga0068855_100024269
518 Ga0068855_100116362
519 Ga0068855_100118130
520 Ga0068855_100247495
521 Ga0068857_100034598
522 Ga0068857_100040657
523 Ga0068852_100147275
524 Ga0068859_100034552
525 Ga0068866_10010783
526 Ga0068858_100122478
527 Ga0068862_100169910
528 Ga0070717_10368590
529 Ga0075363_100254284
530 Ga0075364_10026390
531 Ga0075432_10020746
532 Ga0075432_10073621
533 Ga0070715_10252835
534 Ga0070712_100365184
535 Ga0070712_100682040
536 Ga0068871_100102966
537 Ga0075428_100151804
538 Ga0075430_100004333
539 Ga0075434_100068175
540 Ga0075429_101121621
541 Ga0068865_100016483
542 Ga0097620_100034553
543 Ga0075435_100018465
544 Ga0105244_10192117
545 Ga0105240_10294968
546 Ga0105240_10302523
547 Ga0105240_10656873
548 Ga0111539_10029718
549 Ga0111539_10434042
550 Ga0111539_10468954
551 Ga0105245_10082572
552 Ga0105245_10371646
553 Ga0105247_10381808
554 Ga0114129_10621863
555 Ga0114129_10734689
556 Ga0105242_10289931
557 Ga0105237_10544184
558 Ga0105237_11132288
559 Ga0105238_10135908
560 Ga0105238_10598436
561 Ga0105238_10829990
562 Ga0105246_10514047
563 Ga0157342_1010664
564 Ga0157373_10767941
565 Ga0157371_10058706
566 Ga0157370_10012707
567 Ga0157370_10027050
568 Ga0157370_10368440
569 Ga0157369_10033325
570 Ga0157369_10169266
571 Ga0157378_10080175
572 Ga0157372_10084210
573 Ga0157372_10134417
574 Ga0157372_10475162
575 Ga0157372_10683524
576 Ga0157372_10761949
577 Ga0157372_11323776
578 Ga0157375_10408575
579 Ga0157375_10479157
580 Ga0157379_10047286
581 Ga0206356_10031109
582 Ga0206356_10201450
583 Ga0206356_11548484
584 Ga0206352_11351725
585 Ga0206354_10186196
586 Ga0206354_10301111
587 Ga0206354_10484028
588 Ga0206354_10560557
589 Ga0206354_11524493
590 Ga0206354_11702124
591 Ga0206353_10597085
592 Ga0213874_10133602
593 Ga0224712_10033779
594 Ga0207656_10054145
595 Ga0207710_10044878
596 Ga0207647_10255226
597 Ga0207705_10087417
598 Ga0207705_10167051
599 Ga0207705_10271118
600 Ga0207705_10537376
601 Ga0207684_10083213
602 Ga0207654_10482337
603 Ga0207707_10009913
604 Ga0207707_10041218
605 Ga0207707_10071389
606 Ga0207707_10126697
607 Ga0207707_10335381
608 Ga0207695_10100259
609 Ga0207695_10544845
610 Ga0207695_10884538
611 Ga0207671_10116740
612 Ga0207693_10095723
613 Ga0207660_10029469
614 Ga0207660_10056430
615 Ga0207660_10067436
616 Ga0207660_10132535
617 Ga0207657_10000416
618 Ga0207657_10000610
619 Ga0207657_10011107
620 Ga0207657_10011244
621 Ga0207657_10030157
622 Ga0207657_10165579
623 Ga0207657_10896469
624 Ga0207649_10032978
625 Ga0207649_10079107
626 Ga0207649_10099349
627 Ga0207649_10260119
628 Ga0207649_10324027
629 Ga0207652_10014185
630 Ga0207652_10024439
631 Ga0207652_10028720
632 Ga0207652_10037811
633 Ga0207652_10101655
634 Ga0207652_10311564
635 Ga0207652_10427892
636 Ga0207652_10537273
637 Ga0207652_10905361
638 Ga0207646_10786117
639 Ga0207700_10113433
640 Ga0207700_10486757
641 Ga0207700_10863486
642 Ga0207664_10001609
643 Ga0207664_10004599
644 Ga0207664_10033779
645 Ga0207664_10034027
646 Ga0207664_10108713
647 Ga0207664_10230796
648 Ga0207664_10274653
649 Ga0207644_10266522
650 Ga0207690_10101909
651 Ga0207690_10488398
652 Ga0207670_10313919
653 Ga0207691_10100820
654 Ga0207661_10116140
655 Ga0207661_10178036
656 Ga0207661_10354710
657 Ga0207679_10490163
658 Ga0207679_10916379
659 Ga0207667_10035295
660 Ga0207667_10227120
661 Ga0207667_10368747
662 Ga0207667_10425607
663 Ga0207667_10465256
664 Ga0207667_10573750
665 Ga0207667_10754573
666 Ga0207667_10818315
667 Ga0207639_10669875
668 Ga0207639_10755630
669 Ga0207648_10287685
670 Ga0207676_10688355
671 Ga0207674_10002130
672 Ga0207674_10051110
673 Ga0207674_10109547
674 Ga0207698_10270097
675 Ga0207428_10023100
676 Ga0207428_10031952
677 Ga0207428_10192141
678 Ga0268264_10021051
679 Ga0265318_10032382
680 Ga0265338_10003515
681 Ga0265332_10028012
682 Ga0265325_10112752
683 Ga0265339_10042901
684 Ga0265316_10105558
685 Ga0265313_10066148
686 Ga0265314_10086718
687 Ga0307416_100033905
688 Ga0373934_0219966
689 Ga0373923_0049874
690 Ga0373946_0220067
691 Ga0373955_0084565
692 Ga0373935_0167662
693 Ga0373933_0155010
694 Ga0373947_0210853
695 Ga0395899_0009583
696 Ga0395899_0020914
697 Ga0395899_0109834
698 Ga0395899_0512547
699 Ga0395900_0003269
700 Ga0395900_0005435
701 Ga0395900_0015675
702 Ga0395900_0039965
703 Ga0395900_0076531
704 Ga0395900_0230228
705 Ga0395898_0002036
706 Ga0395898_0004415
707 Ga0395898_0023807
708 Ga0395898_0096858
709 Ga0395898_0106784
710 Ga0395898_0114557
711 Ga0395898_0133762
712 Ga0395898_0274595
713 Ga0395898_0523214
714 Ga0395898_0581555
715 Ga0395898_0779046
716 Ga0395905_0013206
717 Ga0395905_0042800
718 Ga0395905_0058750
719 Ga0395905_0090739
720 Ga0395905_0099798
721 Ga0395905_0160384
722 Ga0395905_0354707
723 Ga0395905_0552546
724 Ga0395905_0955587
725 Ga0395901_0003449
726 Ga0395901_0041820
727 Ga0395901_0076257
728 Ga0395901_0083972
729 Ga0395901_0084802
730 Ga0395901_0119021
731 Ga0395901_0326371
732 Ga0395901_0457469
733 Ga0395901_0611488
734 Ga0395901_0614948
735 Ga0395901_0755365
736 Ga0436363_1551465
737 Ga0450923_060889
738 Ga0466966_0018063
739 Ga0466966_0119824
740 Ga0466966_0388891
741 Ga0466961_0215387
742 Ga0466961_0271695
743 Ga0466963_0006203
744 Ga0466963_0054124
745 Ga0466963_0222460
746 Ga0466964_0002807
747 Ga0466971_0026023
748 Ga0466968_0074794
749 Ga0466957_0270103
750 Ga0466957_0318621
751 Ga0466959_0001430
752 Ga0466959_0022176
753 Ga0466958_0015095
754 Ga0466958_0051355
755 Ga0466958_0083367
756 Ga0466958_0346161
757 Ga0466958_0420962
758 Ga0466967_0002231
759 Ga0466967_0004455
760 Ga0466967_0007992
761 Ga0466967_0014643
762 Ga0466967_0016687
763 Ga0466967_0021851
764 Ga0466967_0039588
765 Ga0466967_0230878
766 Ga0466967_0368089
767 Ga0466967_0556293
768 Ga0466967_0690588
769 Ga0495592_0050328
770 Ga0495603_0300235
771 Ga0495629_0137680
772 Ga0495651_0014102
773 Ga0495653_0090906
774 Ga0495582_0041370
775 Ga0495605_0196790
776 Ga0495662_0217248
777 Ga0495664_0113163
778 Ga0495594_0290686
779 Ga0495596_0284272
780 Ga0495608_0021759
781 Ga0495608_0028598
782 Ga0495618_0163135
783 Ga0495628_0085118
784 Ga0495630_0055383
785 Ga0495663_0209606
786 Ga0495652_0083335
787 Ga0495665_0202249
788 Ga0495640_0018013
789 Ga0495587_0068338
790 Ga0495667_0035035
791 Ga0495656_0069961
792 Ga0495634_0141128
793 Ga0495634_0184245
794 Ga0495635_0372317
795 Ga0495657_0090092
796 Ga0495599_0047260
797 Ga0495623_0083936
798 Ga0495646_0086773
799 Ga0495613_0371954
800 Ga0495581_0006867
801 Ga0495604_0153664
802 Ga0495674_0005282
803 Ga0495674_0062325
804 Ga0495674_0266334
805 Ga0495676_0089428
806 Ga0495680_0055160
807 Ga0495680_0069307
808 Ga0495675_0051700
809 Ga0495684_0159503
810 Ga0495684_0250499
811 Ga0495602_0128017
812 Ga0495602_0330168
813 Ga0495614_0141287
814 Ga0496100_0001462
815 Ga0496100_0022239
816 Ga0496100_0262147
817 Ga0496101_0024104
818 Ga0496101_0087899
819 Ga0496102_0033555
820 Ga0496102_0051834
821 Ga0496103_0073909
822 Ga0496104_0000610
823 Ga0496104_0208920
824 Ga0496105_0000258
825 Ga0496105_0033251
826 Ga0496106_0020205
827 Ga0496107_0005142
828 Ga0496107_0010809
829 Ga0496108_0007577
830 Ga0496108_0422308
831 Ga0496109_0000505
832 Ga0496109_0182813
833 Ga0496110_0044078
834 Ga0496111_0036894
835 Ga0496111_0319777
836 Ga0496112_0017212
837 Ga0496112_0051841
838 Ga0496112_0158208
839 Ga0496112_0679734
840 Ga0496113_0339703
841 Ga0496113_0477012
842 Ga0496114_0022894
843 Ga0496114_0234267
844 Ga0496114_0466716
845 Ga0496115_0010517
846 Ga0496115_0070978
847 Ga0496115_0091740
848 Ga0501031_0238797
849 Ga0501038_0259535
850 Ga0501040_0111732
851 Ga0501042_0050036
852 Ga0501048_0332709
853 Ga0501067_0001545
854 Ga0501067_0109840
855 Ga0501067_0112462
856 Ga0501068_0200236
857 Ga0501068_0379550
858 Ga0501069_0035781
859 Ga0501069_0209029
860 Ga0501069_0308434
861 Ga0501069_0476286
862 Ga0501070_0011133
863 Ga0501070_0026496
864 Ga0501070_0191379
865 Ga0501071_0008346
866 Ga0501072_0110853
867 Ga0501073_0014448
868 Ga0501073_0028986
869 Ga0501074_0076323
870 Ga0501075_0003907
871 Ga0501075_0226979
872 Ga0501076_0225909
873 Ga0501079_0162006
874 Ga0501080_0002500
875 Ga0501081_0104793
876 Ga0501083_0001476
877 Ga0501035_0304440
878 Ga0501045_0055507
879 nmdc:mga00v17_91532_c1
880 nmdc:mga05p37_1046181_c1
881 nmdc:mga05p37_247460_c1
882 nmdc:mga09592_89538_c1
883 nmdc:mga0qj67_45750_c1
884 nmdc:mga0qj67_8617_c1
885 nmdc:mga06r32_111300_c1
886 nmdc:mga08y16_262749_c1
887 nmdc:mga08y16_392317_c1
888 nmdc:mga08y16_71230_c1
889 nmdc:mga0n895_698634_c1
890 nmdc:mga0n895_75033_c1
891 nmdc:mga0rr50_6584_c1
892 nmdc:mga0a205_90384_c1
893 Ga0495595_0094983
894 Ga0495619_0014801
895 Ga0501084_0380857
896 Ga0501082_0035888
897 Ga0501082_0216394
898 Ga0466962_0028444
899 Ga0466962_0124422
900 Ga0530510_0217387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05138

PaaA_PaaC

Phenylacetic acid catabolic protein

16

211

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pwq-assembly5.cif.gz_K the phenylacetyl-coa monooxygenase paaac subcomplex 0.8711 4 189
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8561 1 202
4ii4-assembly1.cif.gz_C the phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa 0.8522 1 202
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8373 2 202
4iit-assembly1.cif.gz_C-2 the phenylacetyl-coa monooxygenase paaabc subcomplex with phenylacetyl-coa 0.8297 2 202
ID Description Score Start End Superfamily
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8476 3 202 1.20.1260.10
3pwqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.836 3 202 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7534 3 195 1.20.1260.10
3pwqH00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7206 3 195 1.20.1260.10
2vxiG00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.6726 3 145 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1F2XQP2-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaI 0.9558 7 146 GO:0005829
GO:0010124
AF-A0A7W0SX96-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaC 0.9358 1 202 GO:0005829
GO:0010124
AF-A0A7W0SX96-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaC 0.9313 1 202 GO:0005829
GO:0010124
AF-A0A538FWT0-F1-model_v4 Phenylacetate-CoA oxygenase subunit PaaC 0.9234 29 202 GO:0005829
GO:0010124
AF-A0A7G3D8R8-F1-model_v4 deleted 0.9211 3 152

Map