F446548

General Info

Members Datasets Scaffolds Average Seq Length
450 237 900 261

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100300494|Ga0070698_1003004942
Length 284
Sequence VRAGLRLRRTITLSTIGCSVSKSLDRLLAWLPAESADRELARRVNPERLPRHVAIIMDGNGRWAGKRHLPRVEGHRAGIEAVRAVVETSARLGLDVLTLYAFSVENWKRPAAEVSTLMLLLKRYLRSELSTLLENDIRFNVIGRAEELAPDILQELRAAEQKTAKSSGMLFNIALNYGGRSEIIDAARRAIEAGIPADALDERRFGELLYTAGQPDPDLLIRTSGEMRVSNFLLWQIAYAEIWVTDTLWPDFRCRDLLEAILAYQKRDRRYGGIASAHVAAGAK

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
136 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
137 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
138 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
139 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
140 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
141 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
151 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
152 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
155 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
156 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
227 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
234 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2939615513 Lactococcus lactis 1925 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 4.44
Rhizosphere 93.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100300494 3300005471 Bacteria 1536
2 Ga0065712_10039260 3300005290 Bacteria 1148
3 Ga0065712_10239246 3300005290 Bacteria 989
4 Ga0065715_10409685 3300005293 Bacteria 871
5 Ga0070670_100059476 3300005331 Bacteria 3280
6 Ga0068869_100278026 3300005334 Bacteria 1346
7 Ga0070666_10072574 3300005335 Bacteria 2343
8 Ga0070666_10087235 3300005335 Bacteria 2139
9 Ga0070682_100245426 3300005337 Bacteria 1288
10 Ga0070692_10043816 3300005345 Bacteria 2303
11 Ga0070668_100006636 3300005347 Bacteria 8578
12 Ga0070668_100070147 3300005347 Bacteria 2728
13 Ga0070669_100043411 3300005353 Bacteria 3274
14 Ga0070669_100105149 3300005353 Bacteria 2135
15 Ga0070675_100524120 3300005354 Bacteria 1069
16 Ga0070675_100542900 3300005354 Bacteria 1051
17 Ga0070671_100090311 3300005355 Bacteria 2564
18 Ga0070674_100033558 3300005356 Bacteria 3418
19 Ga0070674_100085165 3300005356 Bacteria 2268
20 Ga0070673_100026814 3300005364 Bacteria 4261
21 Ga0070659_100098075 3300005366 Bacteria 2356
22 Ga0070659_100129725 3300005366 Bacteria 2047
23 Ga0070667_100101921 3300005367 Bacteria 2480
24 Ga0070709_10368880 3300005434 Bacteria 1065
25 Ga0070713_100004300 3300005436 Bacteria 9545
26 Ga0070711_100069949 3300005439 Bacteria 2470
27 Ga0070705_100055922 3300005440 Bacteria 2321
28 Ga0070705_100348680 3300005440 Bacteria 1079
29 Ga0070662_100157840 3300005457 Bacteria 1772
30 Ga0070662_100195523 3300005457 Bacteria 1602
31 Ga0070662_100285510 3300005457 Bacteria 1337
32 Ga0070681_10003693 3300005458 Bacteria 14358
33 Ga0068867_100074656 3300005459 Bacteria 2542
34 Ga0070707_100125144 3300005468 Bacteria 2497
35 Ga0070698_100133526 3300005471 Bacteria 2437
36 Ga0070698_100159625 3300005471 Bacteria 2199
37 Ga0070698_100410225 3300005471 Bacteria 1288
38 Ga0070679_100080150 3300005530 Bacteria 3254
39 Ga0070672_100160747 3300005543 Bacteria 1863
40 Ga0070672_100317365 3300005543 Bacteria 1324
41 Ga0070695_100191896 3300005545 Bacteria 1454
42 Ga0070696_100019487 3300005546 Bacteria 4593
43 Ga0070665_100001879 3300005548 Bacteria 23848
44 Ga0070665_100233467 3300005548 Bacteria 1840
45 Ga0070704_100019719 3300005549 Bacteria 4338
46 Ga0070704_100071006 3300005549 Bacteria 2528
47 Ga0070664_100144108 3300005564 Bacteria 2100
48 Ga0070664_100444122 3300005564 Bacteria 1190
49 Ga0068857_100315828 3300005577 Bacteria 1442
50 Ga0070702_100010325 3300005615 Bacteria 4593
51 Ga0068852_100054353 3300005616 Bacteria 3451
52 Ga0068859_100540531 3300005617 Bacteria 1260
53 Ga0068859_100566826 3300005617 Bacteria 1230
54 Ga0068866_10041048 3300005718 Bacteria 2294
55 Ga0068861_100012368 3300005719 Bacteria 5951
56 Ga0068851_10184555 3300005834 Bacteria 1157
57 Ga0068863_100025860 3300005841 Bacteria 5600
58 Ga0068863_100325393 3300005841 Bacteria 1494
59 Ga0068858_100012178 3300005842 Bacteria 8109
60 Ga0068860_100241626 3300005843 Bacteria 1757
61 Ga0068860_100415101 3300005843 Bacteria 1333
62 Ga0068862_100012037 3300005844 Bacteria 7149
63 Ga0068862_100538314 3300005844 Bacteria 1114
64 Ga0068862_100548568 3300005844 Bacteria 1103
65 Ga0068862_100659791 3300005844 Bacteria 1010
66 Ga0081455_10187638 3300005937 Bacteria 1560
67 Ga0075368_10019907 3300006042 Bacteria 2537
68 Ga0075367_10007865 3300006178 Bacteria 5487
69 Ga0075366_10240951 3300006195 Bacteria 1102
70 Ga0097621_100008625 3300006237 Bacteria 7353
71 Ga0097621_100057255 3300006237 Bacteria 3187
72 Ga0068871_100024332 3300006358 Bacteria 4695
73 Ga0068871_100178172 3300006358 Bacteria 1826
74 Ga0075428_100000995 3300006844 Bacteria 29993
75 Ga0075428_100025242 3300006844 Bacteria 6577
76 Ga0075428_100063291 3300006844 Bacteria 4050
77 Ga0075428_100068382 3300006844 Bacteria 3885
78 Ga0075428_100816357 3300006844 Bacteria 991
79 Ga0075430_100003143 3300006846 Bacteria 13813
80 Ga0075430_100003168 3300006846 Bacteria 13771
81 Ga0075430_100179339 3300006846 Bacteria 1762
82 Ga0075430_100185525 3300006846 Bacteria 1730
83 Ga0075430_100297844 3300006846 Bacteria 1334
84 Ga0075431_100009084 3300006847 Bacteria 9964
85 Ga0075431_100011342 3300006847 Bacteria 8979
86 Ga0075431_100014869 3300006847 Bacteria 7880
87 Ga0075431_100015000 3300006847 Bacteria 7844
88 Ga0075431_100021584 3300006847 Bacteria 6586
89 Ga0075431_100035152 3300006847 Bacteria 5160
90 Ga0075431_100096381 3300006847 Bacteria 3054
91 Ga0075431_100171089 3300006847 Bacteria 2232
92 Ga0075431_100182583 3300006847 Bacteria 2153
93 Ga0075431_100237155 3300006847 Bacteria 1857
94 Ga0075431_100400283 3300006847 Bacteria 1374
95 Ga0075433_10008838 3300006852 Bacteria 8038
96 Ga0075433_10021567 3300006852 Bacteria 5403
97 Ga0075433_10053906 3300006852 Bacteria 3507
98 Ga0075433_10077673 3300006852 Bacteria 2924
99 Ga0075433_10126984 3300006852 Bacteria 2265
100 Ga0075433_10176061 3300006852 Bacteria 1904
101 Ga0075434_100086563 3300006871 Bacteria 3133
102 Ga0075429_100001657 3300006880 Bacteria 18416
103 Ga0075429_100046262 3300006880 Bacteria 3787
104 Ga0068865_100136772 3300006881 Bacteria 1842
105 Ga0068865_100283461 3300006881 Bacteria 1320
106 Ga0075436_100050954 3300006914 Bacteria 2857
107 Ga0097620_100540538 3300006931 Bacteria 1260
108 Ga0097620_100566826 3300006931 Bacteria 1230
109 Ga0075435_100004980 3300007076 Bacteria 9220
110 Ga0075435_100019332 3300007076 Bacteria 5201
111 Ga0105240_10017120 3300009093 Bacteria 9785
112 Ga0111539_10000201 3300009094 Bacteria 70327
113 Ga0111539_10098969 3300009094 Bacteria 3425
114 Ga0111539_10156632 3300009094 Bacteria 2665
115 Ga0111539_10211645 3300009094 Bacteria 2259
116 Ga0111539_10428899 3300009094 Bacteria 1540
117 Ga0105245_10044220 3300009098 Bacteria 3974
118 Ga0105247_10002386 3300009101 Bacteria 12782
119 Ga0105247_10196378 3300009101 Bacteria 1353
120 Ga0114129_10000751 3300009147 Bacteria 41232
121 Ga0114129_10001134 3300009147 Bacteria 35181
122 Ga0114129_10001999 3300009147 Bacteria 27921
123 Ga0114129_10003812 3300009147 Bacteria 21254
124 Ga0114129_10005506 3300009147 Bacteria 17904
125 Ga0114129_10008750 3300009147 Bacteria 14437
126 Ga0114129_10035177 3300009147 Bacteria 7077
127 Ga0114129_10042024 3300009147 Bacteria 6437
128 Ga0114129_10066845 3300009147 Bacteria 5013
129 Ga0114129_10155160 3300009147 Bacteria 3131
130 Ga0114129_10347217 3300009147 Bacteria 1967
131 Ga0105243_10375938 3300009148 Bacteria 1312
132 Ga0105241_10174158 3300009174 Bacteria 1779
133 Ga0105242_10067202 3300009176 Bacteria 2963
134 Ga0105242_10128458 3300009176 Bacteria 2184
135 Ga0105242_10714701 3300009176 Bacteria 982
136 Ga0105248_10004005 3300009177 Bacteria 16285
137 Ga0105248_10053353 3300009177 Bacteria 4537
138 Ga0105248_10066354 3300009177 Bacteria 4052
139 Ga0105248_10139208 3300009177 Bacteria 2737
140 Ga0105248_10172496 3300009177 Bacteria 2438
141 Ga0105248_10764480 3300009177 Bacteria 1090
142 Ga0105237_10465478 3300009545 Bacteria 1270
143 Ga0105239_10089908 3300010375 Bacteria 3387
144 Ga0157378_10630835 3300013297 Bacteria 1086
145 Ga0157378_10849033 3300013297 Bacteria 941
146 Ga0157375_10073949 3300013308 Bacteria 3428
147 Ga0157375_10221390 3300013308 Bacteria 2051
148 Ga0157375_10633748 3300013308 Bacteria 1226
149 Ga0163163_10036126 3300014325 Bacteria 4797
150 Ga0157380_10668318 3300014326 Bacteria 1039
151 Ga0157379_10079608 3300014968 Bacteria 2934
152 Ga0157379_10131682 3300014968 Bacteria 2251
153 Ga0157376_10004135 3300014969 Bacteria 10058
154 Ga0157376_10156950 3300014969 Bacteria 2058
155 Ga0163161_10315553 3300017792 Bacteria 1234
156 Ga0207642_10018052 3300025899 Bacteria 2699
157 Ga0207642_10090128 3300025899 Bacteria 1512
158 Ga0207680_10150851 3300025903 Bacteria 1549
159 Ga0207699_10046271 3300025906 Bacteria 2544
160 Ga0207645_10002511 3300025907 Bacteria 14376
161 Ga0207645_10057285 3300025907 Bacteria 2488
162 Ga0207654_10109300 3300025911 Bacteria 1717
163 Ga0207707_10083559 3300025912 Bacteria 2788
164 Ga0207660_10082272 3300025917 Bacteria 2368
165 Ga0207662_10010044 3300025918 Bacteria 5219
166 Ga0207657_10119585 3300025919 Bacteria 2168
167 Ga0207652_10463580 3300025921 Bacteria 1142
168 Ga0207646_10425005 3300025922 Bacteria 1199
169 Ga0207681_10151045 3300025923 Bacteria 1741
170 Ga0207650_10094438 3300025925 Bacteria 2291
171 Ga0207659_10091502 3300025926 Bacteria 2272
172 Ga0207700_10133593 3300025928 Bacteria 2029
173 Ga0207644_10081279 3300025931 Bacteria 2394
174 Ga0207690_10038420 3300025932 Bacteria 3116
175 Ga0207690_10297155 3300025932 Bacteria 1262
176 Ga0207706_10130589 3300025933 Bacteria 2210
177 Ga0207706_10347139 3300025933 Bacteria 1290
178 Ga0207706_10573120 3300025933 Bacteria 971
179 Ga0207686_10336129 3300025934 Bacteria 1133
180 Ga0207686_10548616 3300025934 Bacteria 903
181 Ga0207669_10095277 3300025937 Bacteria 1951
182 Ga0207704_10102171 3300025938 Bacteria 1914
183 Ga0207691_10061874 3300025940 Bacteria 3399
184 Ga0207711_10023199 3300025941 Bacteria 5193
185 Ga0207711_10318220 3300025941 Bacteria 1437
186 Ga0207689_10014199 3300025942 Bacteria 6776
187 Ga0207689_10070467 3300025942 Bacteria 2872
188 Ga0207679_10750783 3300025945 Bacteria 887
189 Ga0207667_10876940 3300025949 Bacteria 890
190 Ga0207651_10006484 3300025960 Bacteria 6134
191 Ga0207651_10013471 3300025960 Bacteria 4681
192 Ga0207651_10239837 3300025960 Bacteria 1477
193 Ga0207677_10605277 3300026023 Bacteria 962
194 Ga0207703_10116728 3300026035 Bacteria 2285
195 Ga0207703_10242892 3300026035 Bacteria 1620
196 Ga0207703_10891737 3300026035 Bacteria 851
197 Ga0207703_10935250 3300026035 Bacteria 831
198 Ga0207708_10018403 3300026075 Bacteria 5260
199 Ga0207708_10107833 3300026075 Bacteria 2160
200 Ga0207708_10175554 3300026075 Bacteria 1699
201 Ga0207641_10251413 3300026088 Bacteria 1651
202 Ga0207641_10416857 3300026088 Bacteria 1292
203 Ga0207641_10533023 3300026088 Bacteria 1143
204 Ga0207648_10093742 3300026089 Bacteria 2626
205 Ga0207648_10115526 3300026089 Bacteria 2358
206 Ga0207648_10708425 3300026089 Bacteria 933
207 Ga0207676_10016334 3300026095 Bacteria 5375
208 Ga0207675_100003564 3300026118 Bacteria 15160
209 Ga0207675_100064733 3300026118 Bacteria 3417
210 Ga0207683_10195712 3300026121 Bacteria 1837
211 Ga0207683_10513953 3300026121 Bacteria 1107
212 Ga0209813_10014211 3300027866 Bacteria 2141
213 Ga0207428_10000445 3300027907 Bacteria 50527
214 Ga0207428_10002413 3300027907 Bacteria 18659
215 Ga0207428_10179209 3300027907 Bacteria 1602
216 Ga0207428_10347185 3300027907 Bacteria 1092
217 Ga0268266_10203955 3300028379 Bacteria 1811
218 Ga0268266_10298376 3300028379 Bacteria 1502
219 Ga0268265_10096738 3300028380 Bacteria 2373
220 Ga0268265_10265068 3300028380 Bacteria 1529
221 Ga0268265_10555111 3300028380 Bacteria 1091
222 Ga0268264_10150083 3300028381 Bacteria 2089
223 Ga0268264_10708771 3300028381 Bacteria 1000
224 Ga0307513_10547502 3300031456 Bacteria 870
225 Ga0307408_100005759 3300031548 Bacteria 8254
226 Ga0307408_100095422 3300031548 Bacteria 2254
227 Ga0307408_100189122 3300031548 Bacteria 1657
228 Ga0316578_10066203 3300031728 Bacteria 2134
229 Ga0307410_10084721 3300031852 Bacteria 2235
230 Ga0307410_10232206 3300031852 Bacteria 1425
231 Ga0307410_10479431 3300031852 Bacteria 1020
232 Ga0307406_10075346 3300031901 Bacteria 2226
233 Ga0307406_10106325 3300031901 Bacteria 1922
234 Ga0307406_10668662 3300031901 Bacteria 864
235 Ga0307412_10552741 3300031911 Bacteria 967
236 Ga0307416_100040297 3300032002 Bacteria 3627
237 Ga0307416_100076446 3300032002 Bacteria 2806
238 Ga0307416_100138570 3300032002 Bacteria 2206
239 Ga0307416_100151899 3300032002 Bacteria 2125
240 Ga0307416_100182350 3300032002 Bacteria 1969
241 Ga0307411_10100466 3300032005 Bacteria 2044
242 Ga0307415_100048304 3300032126 Bacteria 2871
243 Ga0316580_10028413 3300032139 Bacteria 1729
244 Ga0373934_0037848 3300035086 Bacteria 1899
245 Ga0373934_0074023 3300035086 Bacteria 1364
246 Ga0373951_0035804 3300035091 Bacteria 1183
247 Ga0373945_0022207 3300035116 Bacteria 2184
248 Ga0373945_0038785 3300035116 Bacteria 1715
249 Ga0373953_0030439 3300035117 Bacteria 2093
250 Ga0373954_0091942 3300035118 Bacteria 1458
251 Ga0373943_0031772 3300035170 Bacteria 2506
252 Ga0373943_0168899 3300035170 Bacteria 1196
253 Ga0373943_0270547 3300035170 Bacteria 958
254 Ga0373946_0010185 3300035171 Bacteria 3476
255 Ga0373946_0056744 3300035171 Bacteria 1655
256 Ga0373946_0214062 3300035171 Bacteria 928
257 Ga0373955_0037650 3300035172 Bacteria 2573
258 Ga0373955_0092149 3300035172 Bacteria 1728
259 Ga0373955_0230022 3300035172 Bacteria 1109
260 Ga0316574_0183873 3300035398 Bacteria 1344
261 Ga0373924_0002742 3300035410 Bacteria 5949
262 Ga0373931_0169563 3300035691 Bacteria 1285
263 Ga0373927_0080617 3300035695 Bacteria 2109
264 Ga0373947_0091904 3300035725 Bacteria 1894
265 Ga0373937_0000513 3300036401 Bacteria 35017
266 Ga0373937_0057140 3300036401 Bacteria 3584
267 Ga0373937_0243982 3300036401 Bacteria 1693
268 Ga0316584_0081934 3300036712 Bacteria 2417
269 Ga0373925_0003323 3300037068 Bacteria 12500
270 Ga0373925_0003479 3300037068 Bacteria 12183
271 Ga0373925_0543968 3300037068 Bacteria 955
272 Ga0436365_0589265 3300039437 Bacteria 3362
273 Ga0439461_0036812 3300041410 Bacteria 1043
274 Ga0439461_0082316 3300041410 Bacteria 761
275 Ga0439433_0033950 3300041999 Bacteria 1173
276 Ga0439441_020618 3300042001 Bacteria 1209
277 Ga0439445_0031255 3300042004 Bacteria 1383
278 Ga0439449_0022696 3300042007 Bacteria 2350
279 Ga0439457_014388 3300042014 Bacteria 1771
280 Ga0450888_012300 3300042126 Bacteria 1013
281 Ga0450895_004607 3300042132 Bacteria 1091
282 Ga0439446_0130586 3300042156 Bacteria 814
283 Ga0439434_0001238 3300042435 Bacteria 7351
284 Ga0439435_0003326 3300042436 Bacteria 3331
285 Ga0439464_0006098 3300042439 Bacteria 3134
286 Ga0439464_0025314 3300042439 Bacteria 1643
287 Ga0439460_0016107 3300042461 Bacteria 1988
288 Ga0439460_0058392 3300042461 Bacteria 1172
289 Ga0439460_0083519 3300042461 Bacteria 1005
290 Ga0451577_0012810 3300042876 Bacteria 7870
291 Ga0451577_0664002 3300042876 Bacteria 945
292 Ga0439440_0016925 3300042993 Bacteria 1601
293 Ga0453684_0124671 3300044712 Bacteria 3103
294 Ga0453684_0863226 3300044712 Bacteria 972
295 Ga0495592_0306915 3300046454 Bacteria 1030
296 Ga0495629_0233023 3300046459 Bacteria 1269
297 Ga0495582_0080216 3300046473 Bacteria 1812
298 Ga0495608_0008013 3300046511 Bacteria 7428
299 Ga0495628_0002852 3300046516 Bacteria 15494
300 Ga0495628_0364169 3300046516 Bacteria 1061
301 Ga0495630_0009226 3300046517 Bacteria 7092
302 Ga0495630_0024883 3300046517 Bacteria 4426
303 Ga0495652_0470402 3300046529 Bacteria 876
304 Ga0495587_0047900 3300046536 Bacteria 2533
305 Ga0495634_0208798 3300046642 Bacteria 1210
306 Ga0495599_0136612 3300046678 Bacteria 1522
307 Ga0495646_0290419 3300046680 Bacteria 867
308 Ga0495647_0106873 3300046681 Bacteria 1164
309 Ga0495658_0192801 3300046683 Bacteria 1268
310 Ga0495613_0003890 3300046689 Bacteria 11176
311 Ga0495613_0443950 3300046689 Bacteria 880
312 Ga0495604_0031490 3300047317 Bacteria 4206
313 Ga0495604_0130531 3300047317 Bacteria 1807
314 Ga0495604_0255119 3300047317 Bacteria 1194
315 Ga0495674_0008199 3300047319 Bacteria 9969
316 Ga0495680_0319320 3300047322 Bacteria 1087
317 Ga0495675_0220553 3300047444 Bacteria 1148
318 Ga0495684_0017049 3300047471 Bacteria 5594
319 Ga0495602_0218847 3300048088 Bacteria 1439
320 Ga0496100_0000818 3300048903 Bacteria 14930
321 Ga0496101_0001661 3300048904 Bacteria 13342
322 Ga0496102_0010055 3300048905 Bacteria 8138
323 Ga0496102_0173353 3300048905 Bacteria 2031
324 Ga0496104_0003527 3300048907 Bacteria 13490
325 Ga0496104_0030167 3300048907 Bacteria 5037
326 Ga0496104_0116293 3300048907 Bacteria 2566
327 Ga0496105_0056566 3300048908 Bacteria 3238
328 Ga0496106_0011246 3300048909 Bacteria 6623
329 Ga0496107_0225137 3300048910 Bacteria 1395
330 Ga0496108_0246200 3300048911 Bacteria 1555
331 Ga0496108_0727049 3300048911 Bacteria 860
332 Ga0496109_0229569 3300048912 Bacteria 1746
333 Ga0496109_0343137 3300048912 Bacteria 1410
334 Ga0496110_0303874 3300048913 Bacteria 1453
335 Ga0496111_0057054 3300048914 Bacteria 2827
336 Ga0496112_0010102 3300048915 Bacteria 8546
337 Ga0496113_0265775 3300048916 Bacteria 1371
338 Ga0496114_0000958 3300048917 Bacteria 21594
339 Ga0496115_0065821 3300048918 Bacteria 2928
340 Ga0496117_0000079 3300048920 Bacteria 226960
341 Ga0501031_0088367 3300049568 Bacteria 2021
342 Ga0501034_0009079 3300049571 Bacteria 10442
343 Ga0501038_0287785 3300049574 Bacteria 1292
344 Ga0501038_0684501 3300049574 Bacteria 770
345 Ga0501039_0046708 3300049575 Bacteria 3346
346 Ga0501039_0078906 3300049575 Bacteria 2561
347 Ga0501039_0437031 3300049575 Bacteria 1028
348 Ga0501040_0031302 3300049576 Bacteria 3595
349 Ga0501040_0070246 3300049576 Bacteria 2416
350 Ga0501042_0059731 3300049578 Bacteria 2723
351 Ga0501042_0235950 3300049578 Bacteria 1320
352 Ga0501042_0316276 3300049578 Bacteria 1128
353 Ga0501046_0237003 3300049580 Bacteria 1347
354 Ga0501048_0213897 3300049582 Bacteria 1367
355 Ga0501048_0309266 3300049582 Bacteria 1125
356 Ga0501068_0276809 3300049584 Bacteria 1072
357 Ga0501071_0228613 3300049587 Bacteria 1401
358 Ga0501072_0066874 3300049588 Bacteria 2835
359 Ga0501072_0111471 3300049588 Bacteria 2178
360 Ga0501073_0018855 3300049589 Bacteria 4986
361 Ga0501073_0323958 3300049589 Bacteria 1064
362 Ga0501075_0059639 3300049591 Bacteria 2874
363 Ga0501076_0012889 3300049592 Bacteria 6257
364 Ga0501076_0022893 3300049592 Bacteria 4807
365 Ga0501076_0038905 3300049592 Bacteria 3733
366 Ga0501076_0060409 3300049592 Bacteria 3016
367 Ga0501076_0136981 3300049592 Bacteria 1988
368 Ga0501076_0343459 3300049592 Bacteria 1225
369 Ga0501077_0359841 3300049593 Bacteria 929
370 Ga0501077_0375248 3300049593 Bacteria 908
371 Ga0501077_0380277 3300049593 Bacteria 902
372 Ga0501079_0106001 3300049741 Bacteria 2181
373 Ga0501079_0182038 3300049741 Bacteria 1640
374 Ga0501080_0370117 3300049742 Bacteria 1292
375 Ga0501081_0028362 3300049743 Bacteria 3778
376 Ga0501081_0064578 3300049743 Bacteria 2543
377 Ga0501081_0137400 3300049743 Bacteria 1750
378 Ga0501275_007175 3300049772 Bacteria 1115
379 Ga0501044_0005862 3300049823 Bacteria 13610
380 Ga0501045_0264565 3300049824 Bacteria 1280
381 Ga0501045_0358456 3300049824 Bacteria 1085
382 nmdc:mga0k408_399725_c1 3300050493 Bacteria 818
383 nmdc:mga06z11_99953_c1 3300050494 Bacteria 1590
384 nmdc:mga05p37_1089_c2 3300050507 Bacteria 22817
385 nmdc:mga05p37_13248_c1 3300050507 Bacteria 9872
386 nmdc:mga05p37_17662_c1 3300050507 Bacteria 8608
387 nmdc:mga05p37_24585_c1 3300050507 Bacteria 7323
388 nmdc:mga05p37_3190_c1 3300050507 Bacteria 19076
389 nmdc:mga05p37_406677_c1 3300050507 Bacteria 1588
390 nmdc:mga05p37_48699_c1 3300050507 Bacteria 5212
391 nmdc:mga05p37_638_c1 3300050507 Bacteria 38795
392 nmdc:mga05p37_7289_c1 3300050507 Bacteria 13048
393 nmdc:mga09592_201795_c1 3300050508 Bacteria 1722
394 nmdc:mga09592_2104_c1 3300050508 Bacteria 16079
395 nmdc:mga09592_574513_c1 3300050508 Bacteria 967
396 nmdc:mga09592_98413_c1 3300050508 Bacteria 2504
397 nmdc:mga0qj67_1418_c1 3300050509 Bacteria 16781
398 nmdc:mga0qj67_16753_c1 3300050509 Bacteria 1778
399 nmdc:mga0qj67_191129_c1 3300050509 Bacteria 1664
400 nmdc:mga0qj67_26156_c1 3300050509 Bacteria 4516
401 nmdc:mga0qj67_462470_c1 3300050509 Bacteria 1021
402 nmdc:mga0qj67_68163_c1 3300050509 Bacteria 2835
403 nmdc:mga0qj67_84767_c1 3300050509 Bacteria 2541
404 nmdc:mga06r32_116222_c1 3300050510 Bacteria 2636
405 nmdc:mga06r32_171214_c1 3300050510 Bacteria 2155
406 nmdc:mga06r32_18246_c1 3300050510 Bacteria 6422
407 nmdc:mga06r32_256112_c1 3300050510 Bacteria 1738
408 nmdc:mga06r32_330202_c1 3300050510 Bacteria 1510
409 nmdc:mga06r32_402227_c1 3300050510 Bacteria 1351
410 nmdc:mga06r32_420285_c1 3300050510 Bacteria 1318
411 nmdc:mga06r32_531038_c1 3300050510 Bacteria 1152
412 nmdc:mga06r32_635494_c1 3300050510 Bacteria 1036
413 nmdc:mga06r32_640784_c1 3300050510 Bacteria 1031
414 nmdc:mga06r32_7742_c1 3300050510 Bacteria 9661
415 nmdc:mga08y16_11526_c1 3300050511 Bacteria 9290
416 nmdc:mga08y16_134943_c1 3300050511 Bacteria 2565
417 nmdc:mga08y16_22957_c1 3300050511 Bacteria 6586
418 nmdc:mga08y16_240936_c1 3300050511 Bacteria 1870
419 nmdc:mga08y16_422576_c1 3300050511 Bacteria 1362
420 nmdc:mga08y16_4743_c1 3300050511 Bacteria 14177
421 nmdc:mga0n895_23759_c1 3300050512 Bacteria 5767
422 nmdc:mga0n895_948488_c1 3300050512 Bacteria 844
423 nmdc:mga0rr50_14702_c1 3300050513 Bacteria 5145
424 nmdc:mga0rr50_172872_c1 3300050513 Bacteria 1762
425 nmdc:mga08x19_198661_c1 3300050514 Bacteria 1374
426 nmdc:mga08x19_41891_c1 3300050514 Bacteria 2917
427 nmdc:mga0a205_189664_c1 3300050515 Bacteria 1948
428 nmdc:mga0a205_197897_c2 3300050515 Bacteria 1604
429 nmdc:mga0a205_30478_c1 3300050515 Bacteria 5165
430 nmdc:mga0a205_42661_c1 3300050515 Bacteria 4371
431 nmdc:mga0a205_7790_c1 3300050515 Bacteria 9724
432 Ga0495601_0009584 3300053077 Bacteria 5735
433 Ga0495601_0335179 3300053077 Bacteria 984
434 Ga0495595_0138976 3300053084 Bacteria 1191
435 Ga0495619_0002018 3300053085 Bacteria 13495
436 Ga0495619_0051374 3300053085 Bacteria 2724
437 Ga0495619_0086299 3300053085 Bacteria 2121
438 Ga0495619_0096362 3300053085 Bacteria 2008
439 Ga0495619_0303285 3300053085 Bacteria 1106
440 Ga0500556_0077228 3300053104 Bacteria 1253
441 Ga0501084_0035846 3300054114 Bacteria 4147
442 Ga0501084_0062718 3300054114 Bacteria 3112
443 Ga0501084_0168936 3300054114 Bacteria 1846
444 Ga0501084_0249946 3300054114 Bacteria 1497
445 Ga0590075_049921 3300059424 Bacteria 1073
446 Ga0590077_021269 3300059426 Bacteria 1380
447 Ga0501082_0062927 3300060353 Bacteria 3195
448 Ga0501082_0104346 3300060353 Bacteria 2452
449 Ga0530510_0142745 3300061734 Bacteria 1765
450 2939617208 2939615513 Bacteria 2384962
451 Ga0070698_100300494
452 Ga0065712_10039260
453 Ga0065712_10239246
454 Ga0065715_10409685
455 Ga0070670_100059476
456 Ga0068869_100278026
457 Ga0070666_10072574
458 Ga0070666_10087235
459 Ga0070682_100245426
460 Ga0070692_10043816
461 Ga0070668_100006636
462 Ga0070668_100070147
463 Ga0070669_100043411
464 Ga0070669_100105149
465 Ga0070675_100524120
466 Ga0070675_100542900
467 Ga0070671_100090311
468 Ga0070674_100033558
469 Ga0070674_100085165
470 Ga0070673_100026814
471 Ga0070659_100098075
472 Ga0070659_100129725
473 Ga0070667_100101921
474 Ga0070709_10368880
475 Ga0070713_100004300
476 Ga0070711_100069949
477 Ga0070705_100055922
478 Ga0070705_100348680
479 Ga0070662_100157840
480 Ga0070662_100195523
481 Ga0070662_100285510
482 Ga0070681_10003693
483 Ga0068867_100074656
484 Ga0070707_100125144
485 Ga0070698_100133526
486 Ga0070698_100159625
487 Ga0070698_100410225
488 Ga0070679_100080150
489 Ga0070672_100160747
490 Ga0070672_100317365
491 Ga0070695_100191896
492 Ga0070696_100019487
493 Ga0070665_100001879
494 Ga0070665_100233467
495 Ga0070704_100019719
496 Ga0070704_100071006
497 Ga0070664_100144108
498 Ga0070664_100444122
499 Ga0068857_100315828
500 Ga0070702_100010325
501 Ga0068852_100054353
502 Ga0068859_100540531
503 Ga0068859_100566826
504 Ga0068866_10041048
505 Ga0068861_100012368
506 Ga0068851_10184555
507 Ga0068863_100025860
508 Ga0068863_100325393
509 Ga0068858_100012178
510 Ga0068860_100241626
511 Ga0068860_100415101
512 Ga0068862_100012037
513 Ga0068862_100538314
514 Ga0068862_100548568
515 Ga0068862_100659791
516 Ga0081455_10187638
517 Ga0075368_10019907
518 Ga0075367_10007865
519 Ga0075366_10240951
520 Ga0097621_100008625
521 Ga0097621_100057255
522 Ga0068871_100024332
523 Ga0068871_100178172
524 Ga0075428_100000995
525 Ga0075428_100025242
526 Ga0075428_100063291
527 Ga0075428_100068382
528 Ga0075428_100816357
529 Ga0075430_100003143
530 Ga0075430_100003168
531 Ga0075430_100179339
532 Ga0075430_100185525
533 Ga0075430_100297844
534 Ga0075431_100009084
535 Ga0075431_100011342
536 Ga0075431_100014869
537 Ga0075431_100015000
538 Ga0075431_100021584
539 Ga0075431_100035152
540 Ga0075431_100096381
541 Ga0075431_100171089
542 Ga0075431_100182583
543 Ga0075431_100237155
544 Ga0075431_100400283
545 Ga0075433_10008838
546 Ga0075433_10021567
547 Ga0075433_10053906
548 Ga0075433_10077673
549 Ga0075433_10126984
550 Ga0075433_10176061
551 Ga0075434_100086563
552 Ga0075429_100001657
553 Ga0075429_100046262
554 Ga0068865_100136772
555 Ga0068865_100283461
556 Ga0075436_100050954
557 Ga0097620_100540538
558 Ga0097620_100566826
559 Ga0075435_100004980
560 Ga0075435_100019332
561 Ga0105240_10017120
562 Ga0111539_10000201
563 Ga0111539_10098969
564 Ga0111539_10156632
565 Ga0111539_10211645
566 Ga0111539_10428899
567 Ga0105245_10044220
568 Ga0105247_10002386
569 Ga0105247_10196378
570 Ga0114129_10000751
571 Ga0114129_10001134
572 Ga0114129_10001999
573 Ga0114129_10003812
574 Ga0114129_10005506
575 Ga0114129_10008750
576 Ga0114129_10035177
577 Ga0114129_10042024
578 Ga0114129_10066845
579 Ga0114129_10155160
580 Ga0114129_10347217
581 Ga0105243_10375938
582 Ga0105241_10174158
583 Ga0105242_10067202
584 Ga0105242_10128458
585 Ga0105242_10714701
586 Ga0105248_10004005
587 Ga0105248_10053353
588 Ga0105248_10066354
589 Ga0105248_10139208
590 Ga0105248_10172496
591 Ga0105248_10764480
592 Ga0105237_10465478
593 Ga0105239_10089908
594 Ga0157378_10630835
595 Ga0157378_10849033
596 Ga0157375_10073949
597 Ga0157375_10221390
598 Ga0157375_10633748
599 Ga0163163_10036126
600 Ga0157380_10668318
601 Ga0157379_10079608
602 Ga0157379_10131682
603 Ga0157376_10004135
604 Ga0157376_10156950
605 Ga0163161_10315553
606 Ga0207642_10018052
607 Ga0207642_10090128
608 Ga0207680_10150851
609 Ga0207699_10046271
610 Ga0207645_10002511
611 Ga0207645_10057285
612 Ga0207654_10109300
613 Ga0207707_10083559
614 Ga0207660_10082272
615 Ga0207662_10010044
616 Ga0207657_10119585
617 Ga0207652_10463580
618 Ga0207646_10425005
619 Ga0207681_10151045
620 Ga0207650_10094438
621 Ga0207659_10091502
622 Ga0207700_10133593
623 Ga0207644_10081279
624 Ga0207690_10038420
625 Ga0207690_10297155
626 Ga0207706_10130589
627 Ga0207706_10347139
628 Ga0207706_10573120
629 Ga0207686_10336129
630 Ga0207686_10548616
631 Ga0207669_10095277
632 Ga0207704_10102171
633 Ga0207691_10061874
634 Ga0207711_10023199
635 Ga0207711_10318220
636 Ga0207689_10014199
637 Ga0207689_10070467
638 Ga0207679_10750783
639 Ga0207667_10876940
640 Ga0207651_10006484
641 Ga0207651_10013471
642 Ga0207651_10239837
643 Ga0207677_10605277
644 Ga0207703_10116728
645 Ga0207703_10242892
646 Ga0207703_10891737
647 Ga0207703_10935250
648 Ga0207708_10018403
649 Ga0207708_10107833
650 Ga0207708_10175554
651 Ga0207641_10251413
652 Ga0207641_10416857
653 Ga0207641_10533023
654 Ga0207648_10093742
655 Ga0207648_10115526
656 Ga0207648_10708425
657 Ga0207676_10016334
658 Ga0207675_100003564
659 Ga0207675_100064733
660 Ga0207683_10195712
661 Ga0207683_10513953
662 Ga0209813_10014211
663 Ga0207428_10000445
664 Ga0207428_10002413
665 Ga0207428_10179209
666 Ga0207428_10347185
667 Ga0268266_10203955
668 Ga0268266_10298376
669 Ga0268265_10096738
670 Ga0268265_10265068
671 Ga0268265_10555111
672 Ga0268264_10150083
673 Ga0268264_10708771
674 Ga0307513_10547502
675 Ga0307408_100005759
676 Ga0307408_100095422
677 Ga0307408_100189122
678 Ga0316578_10066203
679 Ga0307410_10084721
680 Ga0307410_10232206
681 Ga0307410_10479431
682 Ga0307406_10075346
683 Ga0307406_10106325
684 Ga0307406_10668662
685 Ga0307412_10552741
686 Ga0307416_100040297
687 Ga0307416_100076446
688 Ga0307416_100138570
689 Ga0307416_100151899
690 Ga0307416_100182350
691 Ga0307411_10100466
692 Ga0307415_100048304
693 Ga0316580_10028413
694 Ga0373934_0037848
695 Ga0373934_0074023
696 Ga0373951_0035804
697 Ga0373945_0022207
698 Ga0373945_0038785
699 Ga0373953_0030439
700 Ga0373954_0091942
701 Ga0373943_0031772
702 Ga0373943_0168899
703 Ga0373943_0270547
704 Ga0373946_0010185
705 Ga0373946_0056744
706 Ga0373946_0214062
707 Ga0373955_0037650
708 Ga0373955_0092149
709 Ga0373955_0230022
710 Ga0316574_0183873
711 Ga0373924_0002742
712 Ga0373931_0169563
713 Ga0373927_0080617
714 Ga0373947_0091904
715 Ga0373937_0000513
716 Ga0373937_0057140
717 Ga0373937_0243982
718 Ga0316584_0081934
719 Ga0373925_0003323
720 Ga0373925_0003479
721 Ga0373925_0543968
722 Ga0436365_0589265
723 Ga0439461_0036812
724 Ga0439461_0082316
725 Ga0439433_0033950
726 Ga0439441_020618
727 Ga0439445_0031255
728 Ga0439449_0022696
729 Ga0439457_014388
730 Ga0450888_012300
731 Ga0450895_004607
732 Ga0439446_0130586
733 Ga0439434_0001238
734 Ga0439435_0003326
735 Ga0439464_0006098
736 Ga0439464_0025314
737 Ga0439460_0016107
738 Ga0439460_0058392
739 Ga0439460_0083519
740 Ga0451577_0012810
741 Ga0451577_0664002
742 Ga0439440_0016925
743 Ga0453684_0124671
744 Ga0453684_0863226
745 Ga0495592_0306915
746 Ga0495629_0233023
747 Ga0495582_0080216
748 Ga0495608_0008013
749 Ga0495628_0002852
750 Ga0495628_0364169
751 Ga0495630_0009226
752 Ga0495630_0024883
753 Ga0495652_0470402
754 Ga0495587_0047900
755 Ga0495634_0208798
756 Ga0495599_0136612
757 Ga0495646_0290419
758 Ga0495647_0106873
759 Ga0495658_0192801
760 Ga0495613_0003890
761 Ga0495613_0443950
762 Ga0495604_0031490
763 Ga0495604_0130531
764 Ga0495604_0255119
765 Ga0495674_0008199
766 Ga0495680_0319320
767 Ga0495675_0220553
768 Ga0495684_0017049
769 Ga0495602_0218847
770 Ga0496100_0000818
771 Ga0496101_0001661
772 Ga0496102_0010055
773 Ga0496102_0173353
774 Ga0496104_0003527
775 Ga0496104_0030167
776 Ga0496104_0116293
777 Ga0496105_0056566
778 Ga0496106_0011246
779 Ga0496107_0225137
780 Ga0496108_0246200
781 Ga0496108_0727049
782 Ga0496109_0229569
783 Ga0496109_0343137
784 Ga0496110_0303874
785 Ga0496111_0057054
786 Ga0496112_0010102
787 Ga0496113_0265775
788 Ga0496114_0000958
789 Ga0496115_0065821
790 Ga0496117_0000079
791 Ga0501031_0088367
792 Ga0501034_0009079
793 Ga0501038_0287785
794 Ga0501038_0684501
795 Ga0501039_0046708
796 Ga0501039_0078906
797 Ga0501039_0437031
798 Ga0501040_0031302
799 Ga0501040_0070246
800 Ga0501042_0059731
801 Ga0501042_0235950
802 Ga0501042_0316276
803 Ga0501046_0237003
804 Ga0501048_0213897
805 Ga0501048_0309266
806 Ga0501068_0276809
807 Ga0501071_0228613
808 Ga0501072_0066874
809 Ga0501072_0111471
810 Ga0501073_0018855
811 Ga0501073_0323958
812 Ga0501075_0059639
813 Ga0501076_0012889
814 Ga0501076_0022893
815 Ga0501076_0038905
816 Ga0501076_0060409
817 Ga0501076_0136981
818 Ga0501076_0343459
819 Ga0501077_0359841
820 Ga0501077_0375248
821 Ga0501077_0380277
822 Ga0501079_0106001
823 Ga0501079_0182038
824 Ga0501080_0370117
825 Ga0501081_0028362
826 Ga0501081_0064578
827 Ga0501081_0137400
828 Ga0501275_007175
829 Ga0501044_0005862
830 Ga0501045_0264565
831 Ga0501045_0358456
832 nmdc:mga0k408_399725_c1
833 nmdc:mga06z11_99953_c1
834 nmdc:mga05p37_1089_c2
835 nmdc:mga05p37_13248_c1
836 nmdc:mga05p37_17662_c1
837 nmdc:mga05p37_24585_c1
838 nmdc:mga05p37_3190_c1
839 nmdc:mga05p37_406677_c1
840 nmdc:mga05p37_48699_c1
841 nmdc:mga05p37_638_c1
842 nmdc:mga05p37_7289_c1
843 nmdc:mga09592_201795_c1
844 nmdc:mga09592_2104_c1
845 nmdc:mga09592_574513_c1
846 nmdc:mga09592_98413_c1
847 nmdc:mga0qj67_1418_c1
848 nmdc:mga0qj67_16753_c1
849 nmdc:mga0qj67_191129_c1
850 nmdc:mga0qj67_26156_c1
851 nmdc:mga0qj67_462470_c1
852 nmdc:mga0qj67_68163_c1
853 nmdc:mga0qj67_84767_c1
854 nmdc:mga06r32_116222_c1
855 nmdc:mga06r32_171214_c1
856 nmdc:mga06r32_18246_c1
857 nmdc:mga06r32_256112_c1
858 nmdc:mga06r32_330202_c1
859 nmdc:mga06r32_402227_c1
860 nmdc:mga06r32_420285_c1
861 nmdc:mga06r32_531038_c1
862 nmdc:mga06r32_635494_c1
863 nmdc:mga06r32_640784_c1
864 nmdc:mga06r32_7742_c1
865 nmdc:mga08y16_11526_c1
866 nmdc:mga08y16_134943_c1
867 nmdc:mga08y16_22957_c1
868 nmdc:mga08y16_240936_c1
869 nmdc:mga08y16_422576_c1
870 nmdc:mga08y16_4743_c1
871 nmdc:mga0n895_23759_c1
872 nmdc:mga0n895_948488_c1
873 nmdc:mga0rr50_14702_c1
874 nmdc:mga0rr50_172872_c1
875 nmdc:mga08x19_198661_c1
876 nmdc:mga08x19_41891_c1
877 nmdc:mga0a205_189664_c1
878 nmdc:mga0a205_197897_c2
879 nmdc:mga0a205_30478_c1
880 nmdc:mga0a205_42661_c1
881 nmdc:mga0a205_7790_c1
882 Ga0495601_0009584
883 Ga0495601_0335179
884 Ga0495595_0138976
885 Ga0495619_0002018
886 Ga0495619_0051374
887 Ga0495619_0086299
888 Ga0495619_0096362
889 Ga0495619_0303285
890 Ga0500556_0077228
891 Ga0501084_0035846
892 Ga0501084_0062718
893 Ga0501084_0168936
894 Ga0501084_0249946
895 Ga0590075_049921
896 Ga0590077_021269
897 Ga0501082_0062927
898 Ga0501082_0104346
899 Ga0530510_0142745
900 2939617208

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

56

272

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u82-assembly1.cif.gz_A structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate 0.9683 23 253
5hc8-assembly1.cif.gz_A crystal structure of lavandulyl diphosphate synthase from lavandula x intermedia in complex with dimethylallyl diphosphate 0.9623 28 251
1x07-assembly1.cif.gz_A crystal structure of undecaprenyl pyrophosphate synthase in complex with mg and ipp 0.9578 29 247
1x09-assembly1.cif.gz_A crystal structure of the d26a mutant upps in complex with magnesium and isopentenyl pyrophosphate 0.9541 27 246
4u82-assembly1.cif.gz_A structure of s. aureus undecaprenyl diphosphate synthase in complex with fspp and sulfate 0.9443 23 253
ID Description Score Start End Superfamily
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9625 28 246 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.954 22 253 3.40.1180.10
2dtnB00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9426 30 251 3.40.1180.10
af_Q58767_31_280_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.9399 16 251 3.40.1180.10
2vg2A01 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.938 23 246 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A1B2ZBN4-F1-model_v4 UDP pyrophosphate synthase 0.9904 27 144 GO:0016094
GO:0045547
AF-X1FLT0-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9877 27 173 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A202DGC7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9847 27 157 GO:0016094
GO:0045547
AF-A0A6B1DH71-F1-model_v4 Isoprenyl transferase (EC 2.5.1.-) 0.9846 1 253 GO:0000287
GO:0005829
GO:0008834
GO:0016094
GO:0045547
AF-A0A258EU35-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.975 21 235 GO:0016094
GO:0045547
GO:0046872

Map