F446400

General Info

Members Datasets Scaffolds Average Seq Length
449 240 449 80

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10027669|Ga0207684_100276692
Length 95
Sequence MILPRRGSFTDSDMATRFLFDPPRRPKAKVGPNLKSLLVRCPSTSKLTDTGQTMEEKRWRIARVKTQSFTCAHCGGIHTWTKKDVILGRPISINR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
77 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
165 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
166 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
178 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
179 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
180 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
215 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.01
Rhizosphere 93.54
Stem 0
Stem Tuber 0
Unclassified 0.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3091812 2162886007 Unclassified 1155
2 JGI24035J26624_1002606 3300002126 Bacteria 1684
3 JGI25405J52794_10002557 3300003911 Unclassified 3144
4 JGI25405J52794_10134608 3300003911 Unclassified 560
5 Ga0065714_10198230 3300005288 Unclassified 904
6 Ga0065714_10239087 3300005288 Unclassified 775
7 Ga0065704_10031597 3300005289 Unclassified 774
8 Ga0065704_10083566 3300005289 Bacteria 3448
9 Ga0065712_10175636 3300005290 Bacteria 1196
10 Ga0065712_10208697 3300005290 Bacteria 1081
11 Ga0065712_10213629 3300005290 Unclassified 1046
12 Ga0065712_10339090 3300005290 Unclassified 803
13 Ga0065712_10498800 3300005290 Unclassified 650
14 Ga0065715_10030536 3300005293 Bacteria 1060
15 Ga0065715_10116467 3300005293 Bacteria 2378
16 Ga0065715_10398975 3300005293 Unclassified 884
17 Ga0065715_10593819 3300005293 Unclassified 712
18 Ga0065707_10039729 3300005295 Bacteria 1124
19 Ga0065707_10333507 3300005295 Unclassified 945
20 Ga0070676_10227638 3300005328 Bacteria 1234
21 Ga0070676_11176891 3300005328 Bacteria 582
22 Ga0070683_100493402 3300005329 Unclassified 1170
23 Ga0070683_100598085 3300005329 Bacteria 1055
24 Ga0070683_100854740 3300005329 Unclassified 872
25 Ga0070690_100815371 3300005330 Unclassified 725
26 Ga0070670_100671047 3300005331 Unclassified 931
27 Ga0070680_100680870 3300005336 Bacteria 885
28 Ga0068868_100526507 3300005338 Unclassified 1038
29 Ga0068868_100699539 3300005338 Unclassified 907
30 Ga0070660_100284724 3300005339 Bacteria 1353
31 Ga0070660_101224421 3300005339 Unclassified 637
32 Ga0070689_100337638 3300005340 Bacteria 1261
33 Ga0070687_100586548 3300005343 Unclassified 764
34 Ga0070692_10409651 3300005345 Unclassified 858
35 Ga0070668_100054758 3300005347 Bacteria 3077
36 Ga0070668_101305951 3300005347 Unclassified 659
37 Ga0070675_100006224 3300005354 Bacteria 9155
38 Ga0070675_100176212 3300005354 Unclassified 1847
39 Ga0070675_100299523 3300005354 Bacteria 1416
40 Ga0070674_100098848 3300005356 Bacteria 2122
41 Ga0070673_100627941 3300005364 Bacteria 982
42 Ga0070673_101271795 3300005364 Unclassified 690
43 Ga0070688_100184159 3300005365 Bacteria 1450
44 Ga0070714_100511209 3300005435 Bacteria 1146
45 Ga0070714_101398501 3300005435 Bacteria 683
46 Ga0070713_101510930 3300005436 Unclassified 652
47 Ga0070701_10110314 3300005438 Bacteria 1536
48 Ga0070711_100733570 3300005439 Unclassified 834
49 Ga0070711_101280476 3300005439 Unclassified 636
50 Ga0070705_100134537 3300005440 Bacteria 1617
51 Ga0070705_101767471 3300005440 Unclassified 524
52 Ga0070700_100056848 3300005441 Bacteria 2454
53 Ga0070708_100219987 3300005445 Unclassified 1781
54 Ga0070708_101327402 3300005445 Unclassified 672
55 Ga0070662_100203354 3300005457 Bacteria 1573
56 Ga0070685_10222815 3300005466 Unclassified 1236
57 Ga0070706_100514286 3300005467 Unclassified 1114
58 Ga0070706_100619207 3300005467 Unclassified 1005
59 Ga0070706_100623643 3300005467 Unclassified 1001
60 Ga0070706_100759234 3300005467 Unclassified 898
61 Ga0070706_100825380 3300005467 Unclassified 858
62 Ga0070707_100014309 3300005468 Bacteria 7438
63 Ga0070707_100154573 3300005468 Unclassified 2235
64 Ga0070707_101677475 3300005468 Unclassified 603
65 Ga0070698_100029855 3300005471 Bacteria 5656
66 Ga0070698_100136810 3300005471 Bacteria 2403
67 Ga0070698_100316450 3300005471 Bacteria 1491
68 Ga0070699_100245952 3300005518 Bacteria 1598
69 Ga0070699_101054836 3300005518 Unclassified 745
70 Ga0070699_101073645 3300005518 Unclassified 739
71 Ga0070679_100390019 3300005530 Bacteria 1339
72 Ga0070684_100040959 3300005535 Bacteria 3991
73 Ga0070684_100412280 3300005535 Bacteria 1246
74 Ga0070684_100975979 3300005535 Unclassified 795
75 Ga0070697_100029326 3300005536 Bacteria 4410
76 Ga0070697_100316938 3300005536 Bacteria 1342
77 Ga0070697_100428823 3300005536 Unclassified 1150
78 Ga0070697_100732087 3300005536 Bacteria 873
79 Ga0068853_100440613 3300005539 Unclassified 1224
80 Ga0068853_102434813 3300005539 Unclassified 507
81 Ga0070672_100431948 3300005543 Unclassified 1132
82 Ga0070696_101247379 3300005546 Unclassified 629
83 Ga0070665_100231343 3300005548 Bacteria 1848
84 Ga0070665_100531756 3300005548 Bacteria 1187
85 Ga0070704_100002997 3300005549 Bacteria 9598
86 Ga0068855_100869535 3300005563 Unclassified 954
87 Ga0070664_101125708 3300005564 Bacteria 740
88 Ga0068861_100245269 3300005719 Unclassified 1526
89 Ga0068863_100065177 3300005841 Bacteria 3446
90 Ga0068858_100243514 3300005842 Bacteria 1707
91 Ga0068860_100046304 3300005843 Bacteria 4147
92 Ga0081455_10027728 3300005937 Bacteria 5187
93 Ga0081455_10033517 3300005937 Bacteria 4614
94 Ga0081455_10066064 3300005937 Bacteria 3022
95 Ga0081540_1115352 3300005983 Bacteria 1126
96 Ga0081540_1158383 3300005983 Unclassified 882
97 Ga0081540_1294720 3300005983 Unclassified 558
98 Ga0081539_10090675 3300005985 Unclassified 1580
99 Ga0070717_10052827 3300006028 Unclassified 3349
100 Ga0070717_11381067 3300006028 Unclassified 640
101 Ga0070717_11674957 3300006028 Bacteria 576
102 Ga0070715_10134239 3300006163 Bacteria 1195
103 Ga0070716_100157366 3300006173 Bacteria 1468
104 Ga0070712_100340425 3300006175 Bacteria 1224
105 Ga0070712_101999328 3300006175 Unclassified 508
106 Ga0068871_100292198 3300006358 Unclassified 1428
107 Ga0068871_100440392 3300006358 Bacteria 1166
108 Ga0075428_100493240 3300006844 Bacteria 1311
109 Ga0075428_101563938 3300006844 Unclassified 690
110 Ga0075431_101521737 3300006847 Unclassified 627
111 Ga0075434_100440123 3300006871 Unclassified 1325
112 Ga0075434_100627048 3300006871 Bacteria 1094
113 Ga0068865_100531934 3300006881 Bacteria 984
114 Ga0075436_100034999 3300006914 Unclassified 3464
115 Ga0075436_100450902 3300006914 Unclassified 937
116 Ga0099794_10120537 3300007265 Unclassified 1319
117 Ga0099794_10132288 3300007265 Unclassified 1260
118 Ga0099794_10468309 3300007265 Bacteria 661
119 Ga0099795_10026214 3300007788 Unclassified 1962
120 Ga0105245_10086639 3300009098 Bacteria 2873
121 Ga0105245_11703175 3300009098 Unclassified 683
122 Ga0105245_11936425 3300009098 Bacteria 643
123 Ga0105245_12649762 3300009098 Unclassified 554
124 Ga0105245_13018334 3300009098 Unclassified 522
125 Ga0105245_13028831 3300009098 Unclassified 521
126 Ga0114129_10006734 3300009147 Bacteria 16318
127 Ga0114129_10568236 3300009147 Bacteria 1473
128 Ga0114129_11520245 3300009147 Bacteria 822
129 Ga0105243_10527635 3300009148 Bacteria 1124
130 Ga0105243_12822566 3300009148 Unclassified 526
131 Ga0105242_10195527 3300009176 Bacteria 1793
132 Ga0105242_10810641 3300009176 Unclassified 928
133 Ga0105242_11421808 3300009176 Unclassified 722
134 Ga0105242_11994652 3300009176 Bacteria 622
135 Ga0105248_11425707 3300009177 Unclassified 784
136 Ga0105248_11721517 3300009177 Unclassified 711
137 Ga0105237_10765724 3300009545 Unclassified 972
138 Ga0105249_10078307 3300009553 Bacteria 3067
139 Ga0105249_10078509 3300009553 Bacteria 3063
140 Ga0105249_10309196 3300009553 Bacteria 1588
141 Ga0105249_13053651 3300009553 Unclassified 538
142 Ga0099796_10005068 3300010159 Bacteria 3254
143 Ga0099796_10139556 3300010159 Unclassified 946
144 Ga0105239_10146127 3300010375 Bacteria 2637
145 Ga0105239_10430894 3300010375 Unclassified 1495
146 Ga0105246_10233438 3300011119 Bacteria 1450
147 Ga0157345_1005848 3300012498 Unclassified 964
148 Ga0157315_1004532 3300012508 Bacteria 998
149 Ga0157371_10767544 3300013102 Bacteria 725
150 Ga0157371_10969326 3300013102 Unclassified 647
151 Ga0157369_10635669 3300013105 Unclassified 1101
152 Ga0157374_10142065 3300013296 Unclassified 2331
153 Ga0157374_10260773 3300013296 Bacteria 1707
154 Ga0157374_10280613 3300013296 Bacteria 1645
155 Ga0157374_10556481 3300013296 Bacteria 1155
156 Ga0157374_10703709 3300013296 Bacteria 1023
157 Ga0157374_11145023 3300013296 Bacteria 799
158 Ga0157374_12847166 3300013296 Bacteria 511
159 Ga0157378_10017733 3300013297 Bacteria 6250
160 Ga0157378_10045457 3300013297 Bacteria 3901
161 Ga0157378_10122310 3300013297 Bacteria 2401
162 Ga0157378_10519570 3300013297 Unclassified 1192
163 Ga0157378_10676410 3300013297 Bacteria 1050
164 Ga0163162_10169749 3300013306 Bacteria 2306
165 Ga0163162_10960349 3300013306 Unclassified 965
166 Ga0157372_10016210 3300013307 Bacteria 7995
167 Ga0157372_10247746 3300013307 Bacteria 2068
168 Ga0157372_10515038 3300013307 Unclassified 1395
169 Ga0157375_10039899 3300013308 Bacteria 4521
170 Ga0157375_10050583 3300013308 Bacteria 4076
171 Ga0157375_13218418 3300013308 Unclassified 544
172 Ga0157375_13220902 3300013308 Unclassified 544
173 Ga0163163_10888968 3300014325 Bacteria 954
174 Ga0163163_11258350 3300014325 Bacteria 802
175 Ga0157377_10112400 3300014745 Unclassified 1639
176 Ga0157377_10195707 3300014745 Bacteria 1280
177 Ga0157379_10295126 3300014968 Bacteria 1477
178 Ga0157376_10372014 3300014969 Bacteria 1374
179 Ga0157376_11439896 3300014969 Unclassified 721
180 Ga0157376_12507578 3300014969 Bacteria 555
181 Ga0163161_10848202 3300017792 Unclassified 771
182 Ga0163161_11355567 3300017792 Unclassified 620
183 Ga0163161_11477931 3300017792 Unclassified 596
184 Ga0207666_1001307 3300025271 Bacteria 2930
185 Ga0207666_1015481 3300025271 Unclassified 1086
186 Ga0207673_1003036 3300025290 Bacteria 1947
187 Ga0207697_10003691 3300025315 Bacteria 7495
188 Ga0207697_10019321 3300025315 Bacteria 2790
189 Ga0207697_10024938 3300025315 Bacteria 2446
190 Ga0207697_10147220 3300025315 Bacteria 1023
191 Ga0207697_10189109 3300025315 Unclassified 904
192 Ga0207697_10256769 3300025315 Bacteria 773
193 Ga0207653_10031133 3300025885 Bacteria 1723
194 Ga0207692_10591864 3300025898 Unclassified 712
195 Ga0207692_11008141 3300025898 Unclassified 550
196 Ga0207692_11137278 3300025898 Unclassified 518
197 Ga0207647_10117115 3300025904 Bacteria 1573
198 Ga0207647_10138863 3300025904 Bacteria 1425
199 Ga0207684_10010154 3300025910 Bacteria 8290
200 Ga0207684_10027669 3300025910 Unclassified 4829
201 Ga0207684_10062978 3300025910 Bacteria 3149
202 Ga0207693_10205518 3300025915 Bacteria 1548
203 Ga0207693_10296141 3300025915 Unclassified 1267
204 Ga0207693_11095517 3300025915 Unclassified 605
205 Ga0207663_10064242 3300025916 Bacteria 2341
206 Ga0207663_11102012 3300025916 Unclassified 638
207 Ga0207662_10094084 3300025918 Unclassified 1847
208 Ga0207662_10270029 3300025918 Unclassified 1122
209 Ga0207657_10023722 3300025919 Bacteria 5705
210 Ga0207652_10306238 3300025921 Bacteria 1434
211 Ga0207646_10443897 3300025922 Unclassified 1171
212 Ga0207646_10576228 3300025922 Unclassified 1011
213 Ga0207646_11055414 3300025922 Bacteria 716
214 Ga0207646_11190607 3300025922 Unclassified 668
215 Ga0207659_10227612 3300025926 Bacteria 1502
216 Ga0207659_10294336 3300025926 Unclassified 1331
217 Ga0207687_11554001 3300025927 Unclassified 568
218 Ga0207700_11716914 3300025928 Unclassified 553
219 Ga0207644_10087804 3300025931 Bacteria 2312
220 Ga0207690_10138803 3300025932 Bacteria 1788
221 Ga0207706_10065598 3300025933 Bacteria 3197
222 Ga0207706_10161352 3300025933 Unclassified 1970
223 Ga0207706_10435772 3300025933 Bacteria 1135
224 Ga0207706_11091487 3300025933 Unclassified 667
225 Ga0207709_11045401 3300025935 Unclassified 669
226 Ga0207670_10245867 3300025936 Bacteria 1380
227 Ga0207670_10769517 3300025936 Bacteria 801
228 Ga0207704_10585989 3300025938 Unclassified 911
229 Ga0207665_10217376 3300025939 Bacteria 1399
230 Ga0207665_10895027 3300025939 Unclassified 704
231 Ga0207665_11688831 3300025939 Unclassified 501
232 Ga0207691_10169221 3300025940 Bacteria 1914
233 Ga0207711_10714212 3300025941 Bacteria 935
234 Ga0207689_10047568 3300025942 Bacteria 3540
235 Ga0207661_10132785 3300025944 Bacteria 2135
236 Ga0207661_11491162 3300025944 Unclassified 620
237 Ga0207679_10884698 3300025945 Unclassified 816
238 Ga0207667_11545884 3300025949 Unclassified 633
239 Ga0207712_10081794 3300025961 Bacteria 2353
240 Ga0207712_11117432 3300025961 Unclassified 702
241 Ga0207668_10132376 3300025972 Bacteria 1906
242 Ga0207668_11704885 3300025972 Unclassified 569
243 Ga0207658_10272333 3300025986 Bacteria 1448
244 Ga0207658_11238511 3300025986 Unclassified 682
245 Ga0207677_10202731 3300026023 Unclassified 1578
246 Ga0207703_10336759 3300026035 Bacteria 1386
247 Ga0207678_10763892 3300026067 Unclassified 852
248 Ga0207708_10112133 3300026075 Bacteria 2118
249 Ga0207641_10328786 3300026088 Bacteria 1451
250 Ga0207641_12116724 3300026088 Unclassified 563
251 Ga0207676_11621383 3300026095 Unclassified 645
252 Ga0207675_100389387 3300026118 Bacteria 1372
253 Ga0207683_10109673 3300026121 Bacteria 2470
254 Ga0207683_11366542 3300026121 Unclassified 655
255 Ga0210002_1019115 3300027617 Unclassified 1099
256 Ga0209588_1190195 3300027671 Bacteria 642
257 Ga0209971_1079852 3300027682 Unclassified 796
258 Ga0209998_10003228 3300027717 Bacteria 3601
259 Ga0209974_10013786 3300027876 Bacteria 2692
260 Ga0268266_10660362 3300028379 Bacteria 1006
261 Ga0268264_10564247 3300028381 Unclassified 1118
262 Ga0268264_12326514 3300028381 Bacteria 542
263 Ga0373926_0140302 3300035083 Unclassified 918
264 Ga0373934_0063529 3300035086 Bacteria 1473
265 Ga0373944_0057681 3300035089 Unclassified 1238
266 Ga0373923_0182490 3300035111 Unclassified 965
267 Ga0373936_0512653 3300035113 Unclassified 558
268 Ga0373936_0523727 3300035113 Unclassified 552
269 Ga0373936_0602689 3300035113 Unclassified 516
270 Ga0373939_0085882 3300035114 Bacteria 1055
271 Ga0373945_0154769 3300035116 Bacteria 931
272 Ga0373945_0284923 3300035116 Unclassified 705
273 Ga0373945_0400520 3300035116 Unclassified 601
274 Ga0373953_0183286 3300035117 Bacteria 903
275 Ga0373954_0195817 3300035118 Unclassified 993
276 Ga0373956_0184846 3300035119 Unclassified 986
277 Ga0373943_0259056 3300035170 Unclassified 979
278 Ga0373943_0312700 3300035170 Bacteria 894
279 Ga0373943_0394930 3300035170 Bacteria 798
280 Ga0373946_0060719 3300035171 Unclassified 1608
281 Ga0373946_0231295 3300035171 Unclassified 896
282 Ga0373946_0360962 3300035171 Unclassified 728
283 Ga0373955_0127974 3300035172 Unclassified 1481
284 Ga0373955_0176473 3300035172 Unclassified 1266
285 Ga0373931_0055092 3300035691 Bacteria 2127
286 Ga0373931_0460923 3300035691 Unclassified 814
287 Ga0373935_0036165 3300035692 Plasmid 3086
288 Ga0373935_0055207 3300035692 Bacteria 2531
289 Ga0373935_0183915 3300035692 Bacteria 1436
290 Ga0373935_0727032 3300035692 Unclassified 731
291 Ga0373927_0480317 3300035695 Unclassified 821
292 Ga0373927_0866176 3300035695 Unclassified 596
293 Ga0373933_0156110 3300035724 Bacteria 1447
294 Ga0373933_0263728 3300035724 Bacteria 1111
295 Ga0373947_0023777 3300035725 Unclassified 3567
296 Ga0373947_0245120 3300035725 Bacteria 1183
297 Ga0373947_0347236 3300035725 Unclassified 995
298 Ga0373947_0961100 3300035725 Unclassified 583
299 Ga0373947_1226759 3300035725 Unclassified 511
300 Ga0373937_0051503 3300036401 Unclassified 3774
301 Ga0373937_0407867 3300036401 Unclassified 1289
302 Ga0373937_0674658 3300036401 Bacteria 979
303 Ga0373937_0850634 3300036401 Bacteria 861
304 Ga0373925_0214857 3300037068 Bacteria 1533
305 Ga0373925_0215732 3300037068 Bacteria 1530
306 Ga0373925_0337999 3300037068 Bacteria 1221
307 Ga0373925_0685962 3300037068 Unclassified 844
308 Ga0373925_1064315 3300037068 Unclassified 666
309 Ga0373925_1344555 3300037068 Unclassified 586
310 Ga0395900_0005020 3300037418 Bacteria 13882
311 Ga0395900_0102768 3300037418 Unclassified 2936
312 Ga0395900_0732166 3300037418 Unclassified 920
313 Ga0395905_1791101 3300037471 Unclassified 520
314 Ga0395901_0101057 3300038443 Bacteria 3026
315 Ga0395901_0267590 3300038443 Bacteria 1778
316 Ga0395901_0846490 3300038443 Unclassified 900
317 Ga0436365_1123849 3300039437 Unclassified 547
318 Ga0436363_1252962 3300039450 Bacteria 1055
319 Ga0436362_0358886 3300039453 Unclassified 683
320 Ga0439448_0059937 3300042005 Bacteria 1257
321 Ga0439448_0123381 3300042005 Unclassified 890
322 Ga0439450_040912 3300042008 Bacteria 1076
323 Ga0439455_0002349 3300042012 Bacteria 3416
324 Ga0439455_0026410 3300042012 Bacteria 1418
325 Ga0439455_0162433 3300042012 Unclassified 639
326 Ga0439455_0187558 3300042012 Unclassified 596
327 Ga0439458_0026772 3300042157 Bacteria 1358
328 Ga0439464_0073500 3300042439 Unclassified 1014
329 Ga0439464_0175770 3300042439 Unclassified 677
330 Ga0439460_0088531 3300042461 Unclassified 981
331 Ga0451576_0544346 3300045051 Bacteria 1220
332 Ga0495592_0003064 3300046454 Bacteria 11922
333 Ga0495590_0440988 3300046457 Unclassified 503
334 Ga0495629_0330404 3300046459 Bacteria 1041
335 Ga0495641_0300381 3300046461 Bacteria 724
336 Ga0495651_0102300 3300046462 Unclassified 2131
337 Ga0495651_0530203 3300046462 Unclassified 750
338 Ga0495653_0058018 3300046463 Unclassified 2943
339 Ga0495653_0479818 3300046463 Bacteria 778
340 Ga0495580_0346851 3300046472 Unclassified 1006
341 Ga0495662_0130069 3300046476 Bacteria 1237
342 Ga0495664_0258654 3300046477 Bacteria 1052
343 Ga0495664_0468872 3300046477 Unclassified 753
344 Ga0495584_0191282 3300046491 Unclassified 1040
345 Ga0495584_0269655 3300046491 Unclassified 865
346 Ga0495585_0084862 3300046492 Bacteria 1712
347 Ga0495616_0128811 3300046513 Bacteria 1162
348 Ga0495618_0355333 3300046514 Bacteria 902
349 Ga0495618_0676769 3300046514 Unclassified 608
350 Ga0495628_0026105 3300046516 Unclassified 4768
351 Ga0495628_0231301 3300046516 Bacteria 1386
352 Ga0495630_0212501 3300046517 Bacteria 1476
353 Ga0495630_0489225 3300046517 Unclassified 943
354 Ga0495630_0797349 3300046517 Bacteria 721
355 Ga0495630_1303654 3300046517 Bacteria 547
356 Ga0495666_0054927 3300046526 Bacteria 1909
357 Ga0495652_0128915 3300046529 Bacteria 2005
358 Ga0495640_0239419 3300046533 Bacteria 1139
359 Ga0495586_0615364 3300046535 Unclassified 627
360 Ga0495587_0025896 3300046536 Bacteria 3580
361 Ga0495598_0007957 3300046537 Bacteria 2452
362 Ga0495621_0237999 3300046539 Unclassified 741
363 Ga0495645_0011858 3300046543 Bacteria 6141
364 Ga0495645_0122012 3300046543 Unclassified 1834
365 Ga0495633_0296475 3300046558 Bacteria 735
366 Ga0495667_0109439 3300046559 Bacteria 1785
367 Ga0495667_0331650 3300046559 Unclassified 962
368 Ga0495634_0558542 3300046642 Unclassified 667
369 Ga0495625_0645648 3300046660 Unclassified 631
370 Ga0495635_0265298 3300046663 Bacteria 1155
371 Ga0495635_0349255 3300046663 Unclassified 987
372 Ga0495659_0109039 3300046664 Unclassified 1079
373 Ga0495588_0735736 3300046674 Bacteria 516
374 Ga0495657_0672035 3300046675 Unclassified 596
375 Ga0495599_0018090 3300046678 Unclassified 4388
376 Ga0495623_0052654 3300046679 Bacteria 2571
377 Ga0495646_0191907 3300046680 Bacteria 1116
378 Ga0495646_0291000 3300046680 Unclassified 866
379 Ga0495647_0138915 3300046681 Unclassified 1035
380 Ga0495658_0479453 3300046683 Bacteria 795
381 Ga0495669_0049659 3300046684 Bacteria 1879
382 Ga0495669_0103324 3300046684 Bacteria 1325
383 Ga0495669_0123394 3300046684 Unclassified 1215
384 Ga0495589_0433605 3300046794 Bacteria 602
385 Ga0495604_0178586 3300047317 Bacteria 1486
386 Ga0495674_0071955 3300047319 Bacteria 2983
387 Ga0495674_0219398 3300047319 Bacteria 1572
388 Ga0495674_0311784 3300047319 Bacteria 1284
389 Ga0495676_0254154 3300047321 Bacteria 1198
390 Ga0495680_0194583 3300047322 Bacteria 1458
391 Ga0495680_0360245 3300047322 Unclassified 1011
392 Ga0495683_0444962 3300047323 Bacteria 532
393 Ga0495675_0081308 3300047444 Bacteria 2040
394 Ga0495675_0437039 3300047444 Unclassified 758
395 Ga0495675_0446832 3300047444 Unclassified 748
396 Ga0495684_0189391 3300047471 Unclassified 1522
397 Ga0495684_0291120 3300047471 Bacteria 1175
398 Ga0495602_0087719 3300048088 Unclassified 2592
399 Ga0495602_0698851 3300048088 Unclassified 688
400 Ga0496100_0480875 3300048903 Bacteria 955
401 Ga0496100_0872269 3300048903 Unclassified 706
402 Ga0496101_0548108 3300048904 Bacteria 914
403 Ga0496102_0280947 3300048905 Bacteria 1569
404 Ga0496102_0485399 3300048905 Unclassified 1157
405 Ga0496102_0677251 3300048905 Bacteria 954
406 Ga0496104_0062145 3300048907 Bacteria 3541
407 Ga0496105_0379929 3300048908 Bacteria 1124
408 Ga0496106_0260647 3300048909 Unclassified 1387
409 Ga0496108_0007056 3300048911 Bacteria 9097
410 Ga0496108_0136285 3300048911 Bacteria 2113
411 Ga0496108_0655892 3300048911 Bacteria 912
412 Ga0496109_1795545 3300048912 Unclassified 546
413 Ga0496110_0109495 3300048913 Bacteria 2481
414 Ga0496110_0135659 3300048913 Bacteria 2224
415 Ga0496111_1186928 3300048914 Unclassified 541
416 Ga0496111_1248891 3300048914 Unclassified 525
417 Ga0496112_0392633 3300048915 Bacteria 1328
418 Ga0496112_0394990 3300048915 Unclassified 1323
419 Ga0496112_0556672 3300048915 Bacteria 1080
420 Ga0496112_0625289 3300048915 Bacteria 1008
421 Ga0496113_0685148 3300048916 Bacteria 819
422 Ga0496114_0149117 3300048917 Bacteria 2029
423 Ga0496115_0011972 3300048918 Bacteria 6518
424 Ga0496115_0055307 3300048918 Bacteria 3188
425 Ga0496115_0336747 3300048918 Unclassified 1232
426 Ga0496115_0469740 3300048918 Bacteria 1014
427 nmdc:mga05p37_1866607_c1 3300050507 Unclassified 576
428 nmdc:mga05p37_407355_c1 3300050507 Bacteria 1586
429 nmdc:mga05p37_635685_c1 3300050507 Unclassified 1198
430 nmdc:mga05p37_71349_c1 3300050507 Bacteria 4272
431 nmdc:mga08y16_901846_c1 3300050511 Bacteria 870
432 nmdc:mga0n895_538531_c1 3300050512 Bacteria 1174
433 nmdc:mga0n895_548488_c1 3300050512 Bacteria 1162
434 nmdc:mga0n895_579459_c1 3300050512 Unclassified 1126
435 nmdc:mga0rr50_1628155_c1 3300050513 Unclassified 545
436 nmdc:mga0rr50_517576_c1 3300050513 Bacteria 1015
437 nmdc:mga0rr50_517655_c1 3300050513 Bacteria 1015
438 nmdc:mga08x19_1363495_c1 3300050514 Bacteria 502
439 nmdc:mga08x19_29033_c1 3300050514 Unclassified 3468
440 nmdc:mga0a205_331918_c1 3300050515 Unclassified 1390
441 nmdc:mga0a205_456518_c1 3300050515 Bacteria 1137
442 nmdc:mga0a205_532619_c1 3300050515 Bacteria 1030
443 nmdc:mga0a205_894731_c1 3300050515 Unclassified 735
444 Ga0495601_0233694 3300053077 Bacteria 1200
445 Ga0495612_0026483 3300053078 Bacteria 2330
446 Ga0495595_0260600 3300053084 Bacteria 869
447 Ga0495619_0218110 3300053085 Unclassified 1321
448 Ga0495619_0607822 3300053085 Bacteria 748
449 Ga0587067_127459 3300059640 Bacteria 618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005985 Ga0081539_10090675 Ga0081539_100906752 76
2 3300035170 Ga0373943_0394930 Ga0373943_0394930_207_440 76
3 3300005288 Ga0065714_10198230 Ga0065714_101982302 77
4 3300005290 Ga0065712_10498800 Ga0065712_104988002 77
5 3300005293 Ga0065715_10593819 Ga0065715_105938192 77
6 3300005328 Ga0070676_10227638 Ga0070676_102276383 77
7 3300005329 Ga0070683_100598085 Ga0070683_1005980853 77
8 3300005329 Ga0070683_100854740 Ga0070683_1008547402 77
9 3300005336 Ga0070680_100680870 Ga0070680_1006808702 77
10 3300005347 Ga0070668_101305951 Ga0070668_1013059511 77
11 3300005354 Ga0070675_100176212 Ga0070675_1001762123 77
12 3300005445 Ga0070708_101327402 Ga0070708_1013274022 77
13 3300005535 Ga0070684_100975979 Ga0070684_1009759792 77
14 3300005539 Ga0068853_100440613 Ga0068853_1004406133 77
15 3300005539 Ga0068853_102434813 Ga0068853_1024348132 77
16 3300005564 Ga0070664_101125708 Ga0070664_1011257083 77
17 3300005983 Ga0081540_1294720 Ga0081540_12947202 77
18 3300006163 Ga0070715_10134239 Ga0070715_101342391 77
19 3300006175 Ga0070712_101999328 Ga0070712_1019993281 77
20 3300006358 Ga0068871_100440392 Ga0068871_1004403923 77
21 3300006871 Ga0075434_100627048 Ga0075434_1006270482 77
22 3300009147 Ga0114129_11520245 Ga0114129_115202452 77
23 3300009553 Ga0105249_13053651 Ga0105249_130536511 77
24 3300011119 Ga0105246_10233438 Ga0105246_102334384 77
25 3300012498 Ga0157345_1005848 Ga0157345_10058482 77
26 3300012508 Ga0157315_1004532 Ga0157315_10045322 77
27 3300013102 Ga0157371_10767544 Ga0157371_107675442 77
28 3300013102 Ga0157371_10969326 Ga0157371_109693262 77
29 3300013296 Ga0157374_10142065 Ga0157374_101420654 77
30 3300013296 Ga0157374_10703709 Ga0157374_107037093 77
31 3300013296 Ga0157374_12847166 Ga0157374_128471661 77
32 3300013297 Ga0157378_10122310 Ga0157378_101223103 77
33 3300013297 Ga0157378_10676410 Ga0157378_106764102 77
34 3300013307 Ga0157372_10016210 Ga0157372_100162105 77
35 3300013307 Ga0157372_10247746 Ga0157372_102477462 77
36 3300013308 Ga0157375_10039899 Ga0157375_100398994 77
37 3300013308 Ga0157375_13218418 Ga0157375_132184181 77
38 3300014325 Ga0163163_10888968 Ga0163163_108889681 77
39 3300014325 Ga0163163_11258350 Ga0163163_112583502 77
40 3300014969 Ga0157376_10372014 Ga0157376_103720142 77
41 3300014969 Ga0157376_12507578 Ga0157376_125075781 77
42 3300017792 Ga0163161_11477931 Ga0163161_114779312 77
43 3300025315 Ga0207697_10003691 Ga0207697_100036912 77
44 3300025931 Ga0207644_10087804 Ga0207644_100878042 77
45 3300025933 Ga0207706_11091487 Ga0207706_110914872 77
46 3300025936 Ga0207670_10769517 Ga0207670_107695172 77
47 3300025941 Ga0207711_10714212 Ga0207711_107142121 77
48 3300025944 Ga0207661_11491162 Ga0207661_114911621 77
49 3300026121 Ga0207683_10109673 Ga0207683_101096733 77
50 3300035086 Ga0373934_0063529 Ga0373934_0063529_1141_1380 77
51 3300035089 Ga0373944_0057681 Ga0373944_0057681_788_1027 77
52 3300035113 Ga0373936_0512653 Ga0373936_0512653_34_276 77
53 3300035116 Ga0373945_0154769 Ga0373945_0154769_239_475 77
54 3300035116 Ga0373945_0284923 Ga0373945_0284923_64_300 77
55 3300035117 Ga0373953_0183286 Ga0373953_0183286_109_348 77
56 3300035118 Ga0373954_0195817 Ga0373954_0195817_695_934 77
57 3300035170 Ga0373943_0312700 Ga0373943_0312700_416_652 77
58 3300035171 Ga0373946_0231295 Ga0373946_0231295_403_639 77
59 3300035172 Ga0373955_0176473 Ga0373955_0176473_442_681 77
60 3300035691 Ga0373931_0055092 Ga0373931_0055092_1343_1579 77
61 3300035692 Ga0373935_0055207 Ga0373935_0055207_1114_1350 77
62 3300035692 Ga0373935_0183915 Ga0373935_0183915_413_652 77
63 3300035695 Ga0373927_0866176 Ga0373927_0866176_314_550 77
64 3300035724 Ga0373933_0156110 Ga0373933_0156110_946_1185 77
65 3300035725 Ga0373947_0023777 Ga0373947_0023777_1411_1653 77
66 3300035725 Ga0373947_0245120 Ga0373947_0245120_901_1137 77
67 3300035725 Ga0373947_0347236 Ga0373947_0347236_28_267 77
68 3300036401 Ga0373937_0407867 Ga0373937_0407867_334_573 77
69 3300036401 Ga0373937_0674658 Ga0373937_0674658_173_412 77
70 3300037068 Ga0373925_0214857 Ga0373925_0214857_1170_1406 77
71 3300037068 Ga0373925_0337999 Ga0373925_0337999_677_919 77
72 3300037068 Ga0373925_0685962 Ga0373925_0685962_469_708 77
73 3300037068 Ga0373925_1064315 Ga0373925_1064315_363_599 77
74 3300037418 Ga0395900_0005020 Ga0395900_0005020_4344_4586 77
75 3300038443 Ga0395901_0101057 Ga0395901_0101057_446_688 77
76 3300039437 Ga0436365_1123849 Ga0436365_1123849_108_341 77
77 3300042012 Ga0439455_0026410 Ga0439455_0026410_29_268 77
78 3300046454 Ga0495592_0003064 Ga0495592_0003064_1656_1895 77
79 3300046457 Ga0495590_0440988 Ga0495590_0440988_203_439 77
80 3300046459 Ga0495629_0330404 Ga0495629_0330404_484_723 77
81 3300046462 Ga0495651_0102300 Ga0495651_0102300_273_512 77
82 3300046463 Ga0495653_0058018 Ga0495653_0058018_1153_1392 77
83 3300046463 Ga0495653_0479818 Ga0495653_0479818_106_345 77
84 3300046472 Ga0495580_0346851 Ga0495580_0346851_68_304 77
85 3300046476 Ga0495662_0130069 Ga0495662_0130069_798_1037 77
86 3300046477 Ga0495664_0258654 Ga0495664_0258654_308_547 77
87 3300046491 Ga0495584_0269655 Ga0495584_0269655_55_291 77
88 3300046492 Ga0495585_0084862 Ga0495585_0084862_1004_1240 77
89 3300046513 Ga0495616_0128811 Ga0495616_0128811_767_1003 77
90 3300046514 Ga0495618_0355333 Ga0495618_0355333_417_656 77
91 3300046516 Ga0495628_0026105 Ga0495628_0026105_152_391 77
92 3300046517 Ga0495630_0212501 Ga0495630_0212501_1185_1424 77
93 3300046526 Ga0495666_0054927 Ga0495666_0054927_370_609 77
94 3300046529 Ga0495652_0128915 Ga0495652_0128915_726_965 77
95 3300046533 Ga0495640_0239419 Ga0495640_0239419_444_683 77
96 3300046535 Ga0495586_0615364 Ga0495586_0615364_111_350 77
97 3300046536 Ga0495587_0025896 Ga0495587_0025896_1811_2050 77
98 3300046537 Ga0495598_0007957 Ga0495598_0007957_1948_2184 77
99 3300046539 Ga0495621_0237999 Ga0495621_0237999_279_515 77
100 3300046543 Ga0495645_0011858 Ga0495645_0011858_4991_5230 77
101 3300046558 Ga0495633_0296475 Ga0495633_0296475_32_268 77
102 3300046559 Ga0495667_0109439 Ga0495667_0109439_559_798 77
103 3300046559 Ga0495667_0331650 Ga0495667_0331650_417_656 77
104 3300046660 Ga0495625_0645648 Ga0495625_0645648_114_350 77
105 3300046663 Ga0495635_0265298 Ga0495635_0265298_339_578 77
106 3300046664 Ga0495659_0109039 Ga0495659_0109039_499_735 77
107 3300046674 Ga0495588_0735736 Ga0495588_0735736_170_406 77
108 3300046675 Ga0495657_0672035 Ga0495657_0672035_133_372 77
109 3300046678 Ga0495599_0018090 Ga0495599_0018090_2278_2517 77
110 3300046679 Ga0495623_0052654 Ga0495623_0052654_1018_1257 77
111 3300046680 Ga0495646_0191907 Ga0495646_0191907_611_850 77
112 3300046683 Ga0495658_0479453 Ga0495658_0479453_375_614 77
113 3300046684 Ga0495669_0049659 Ga0495669_0049659_1048_1287 77
114 3300046684 Ga0495669_0123394 Ga0495669_0123394_563_799 77
115 3300046794 Ga0495589_0433605 Ga0495589_0433605_272_508 77
116 3300047317 Ga0495604_0178586 Ga0495604_0178586_356_595 77
117 3300047319 Ga0495674_0071955 Ga0495674_0071955_1485_1724 77
118 3300047319 Ga0495674_0219398 Ga0495674_0219398_123_362 77
119 3300047322 Ga0495680_0360245 Ga0495680_0360245_440_679 77
120 3300047323 Ga0495683_0444962 Ga0495683_0444962_61_297 77
121 3300047444 Ga0495675_0437039 Ga0495675_0437039_355_594 77
122 3300047444 Ga0495675_0446832 Ga0495675_0446832_252_491 77
123 3300047471 Ga0495684_0291120 Ga0495684_0291120_548_787 77
124 3300048088 Ga0495602_0087719 Ga0495602_0087719_849_1088 77
125 3300048088 Ga0495602_0698851 Ga0495602_0698851_387_626 77
126 3300048903 Ga0496100_0480875 Ga0496100_0480875_219_458 77
127 3300048903 Ga0496100_0872269 Ga0496100_0872269_31_267 77
128 3300048904 Ga0496101_0548108 Ga0496101_0548108_163_402 77
129 3300048905 Ga0496102_0280947 Ga0496102_0280947_101_340 77
130 3300048905 Ga0496102_0485399 Ga0496102_0485399_717_953 77
131 3300048905 Ga0496102_0677251 Ga0496102_0677251_157_396 77
132 3300048907 Ga0496104_0062145 Ga0496104_0062145_2075_2314 77
133 3300048908 Ga0496105_0379929 Ga0496105_0379929_34_273 77
134 3300048909 Ga0496106_0260647 Ga0496106_0260647_337_573 77
135 3300048911 Ga0496108_0007056 Ga0496108_0007056_2298_2537 77
136 3300048911 Ga0496108_0655892 Ga0496108_0655892_563_802 77
137 3300048912 Ga0496109_1795545 Ga0496109_1795545_217_456 77
138 3300048913 Ga0496110_0135659 Ga0496110_0135659_240_479 77
139 3300048915 Ga0496112_0394990 Ga0496112_0394990_600_839 77
140 3300048915 Ga0496112_0556672 Ga0496112_0556672_79_318 77
141 3300048918 Ga0496115_0011972 Ga0496115_0011972_1968_2207 77
142 3300048918 Ga0496115_0055307 Ga0496115_0055307_164_403 77
143 3300048918 Ga0496115_0336747 Ga0496115_0336747_445_681 77
144 3300050507 nmdc:mga05p37_1866607_c1 nmdc:mga05p37_1866607_c1_74_310 77
145 3300050512 nmdc:mga0n895_538531_c1 nmdc:mga0n895_538531_c1_731_967 77
146 3300050512 nmdc:mga0n895_548488_c1 nmdc:mga0n895_548488_c1_639_875 77
147 3300050513 nmdc:mga0rr50_517655_c1 nmdc:mga0rr50_517655_c1_502_738 77
148 3300050514 nmdc:mga08x19_1363495_c1 nmdc:mga08x19_1363495_c1_233_469 77
149 3300050515 nmdc:mga0a205_456518_c1 nmdc:mga0a205_456518_c1_470_706 77
150 3300053077 Ga0495601_0233694 Ga0495601_0233694_734_973 77
151 3300053078 Ga0495612_0026483 Ga0495612_0026483_1539_1778 77
152 3300053084 Ga0495595_0260600 Ga0495595_0260600_390_629 77
153 3300053085 Ga0495619_0218110 Ga0495619_0218110_404_643 77
154 2162886007 SwRhRL2b_contig_3091812 SwRhRL2b_0116.00007280 78
155 3300002126 JGI24035J26624_1002606 JGI24035J26624_10026063 78
156 3300003911 JGI25405J52794_10002557 JGI25405J52794_100025573 78
157 3300003911 JGI25405J52794_10134608 JGI25405J52794_101346081 78
158 3300005288 Ga0065714_10239087 Ga0065714_102390872 78
159 3300005289 Ga0065704_10031597 Ga0065704_100315972 78
160 3300005289 Ga0065704_10083566 Ga0065704_100835664 78
161 3300005290 Ga0065712_10175636 Ga0065712_101756362 78
162 3300005290 Ga0065712_10208697 Ga0065712_102086972 78
163 3300005290 Ga0065712_10213629 Ga0065712_102136292 78
164 3300005290 Ga0065712_10339090 Ga0065712_103390902 78
165 3300005293 Ga0065715_10030536 Ga0065715_100305363 78
166 3300005293 Ga0065715_10116467 Ga0065715_101164674 78
167 3300005293 Ga0065715_10398975 Ga0065715_103989752 78
168 3300005295 Ga0065707_10039729 Ga0065707_100397292 78
169 3300005295 Ga0065707_10333507 Ga0065707_103335072 78
170 3300005328 Ga0070676_11176891 Ga0070676_111768912 78
171 3300005329 Ga0070683_100493402 Ga0070683_1004934022 78
172 3300005330 Ga0070690_100815371 Ga0070690_1008153712 78
173 3300005331 Ga0070670_100671047 Ga0070670_1006710472 78
174 3300005338 Ga0068868_100526507 Ga0068868_1005265072 78
175 3300005338 Ga0068868_100699539 Ga0068868_1006995392 78
176 3300005339 Ga0070660_100284724 Ga0070660_1002847241 78
177 3300005339 Ga0070660_101224421 Ga0070660_1012244211 78
178 3300005340 Ga0070689_100337638 Ga0070689_1003376382 78
179 3300005343 Ga0070687_100586548 Ga0070687_1005865481 78
180 3300005345 Ga0070692_10409651 Ga0070692_104096512 78
181 3300005347 Ga0070668_100054758 Ga0070668_1000547582 78
182 3300005354 Ga0070675_100006224 Ga0070675_10000622413 78
183 3300005354 Ga0070675_100299523 Ga0070675_1002995233 78
184 3300005356 Ga0070674_100098848 Ga0070674_1000988483 78
185 3300005364 Ga0070673_100627941 Ga0070673_1006279411 78
186 3300005364 Ga0070673_101271795 Ga0070673_1012717953 78
187 3300005365 Ga0070688_100184159 Ga0070688_1001841592 78
188 3300005435 Ga0070714_100511209 Ga0070714_1005112092 78
189 3300005435 Ga0070714_101398501 Ga0070714_1013985012 78
190 3300005436 Ga0070713_101510930 Ga0070713_1015109302 78
191 3300005438 Ga0070701_10110314 Ga0070701_101103142 78
192 3300005439 Ga0070711_100733570 Ga0070711_1007335702 78
193 3300005439 Ga0070711_101280476 Ga0070711_1012804762 78
194 3300005440 Ga0070705_100134537 Ga0070705_1001345372 78
195 3300005440 Ga0070705_101767471 Ga0070705_1017674712 78
196 3300005441 Ga0070700_100056848 Ga0070700_1000568484 78
197 3300005445 Ga0070708_100219987 Ga0070708_1002199871 78
198 3300005457 Ga0070662_100203354 Ga0070662_1002033542 78
199 3300005466 Ga0070685_10222815 Ga0070685_102228152 78
200 3300005467 Ga0070706_100514286 Ga0070706_1005142862 78
201 3300005467 Ga0070706_100619207 Ga0070706_1006192072 78
202 3300005467 Ga0070706_100623643 Ga0070706_1006236432 78
203 3300005467 Ga0070706_100759234 Ga0070706_1007592341 78
204 3300005467 Ga0070706_100825380 Ga0070706_1008253802 78
205 3300005468 Ga0070707_100014309 Ga0070707_1000143091 78
206 3300005468 Ga0070707_100154573 Ga0070707_1001545733 78
207 3300005468 Ga0070707_101677475 Ga0070707_1016774752 78
208 3300005471 Ga0070698_100029855 Ga0070698_1000298554 78
209 3300005471 Ga0070698_100136810 Ga0070698_1001368103 78
210 3300005471 Ga0070698_100316450 Ga0070698_1003164502 78
211 3300005518 Ga0070699_100245952 Ga0070699_1002459522 78
212 3300005518 Ga0070699_101054836 Ga0070699_1010548361 78
213 3300005518 Ga0070699_101073645 Ga0070699_1010736452 78
214 3300005530 Ga0070679_100390019 Ga0070679_1003900192 78
215 3300005535 Ga0070684_100040959 Ga0070684_1000409594 78
216 3300005535 Ga0070684_100412280 Ga0070684_1004122802 78
217 3300005536 Ga0070697_100029326 Ga0070697_1000293263 78
218 3300005536 Ga0070697_100316938 Ga0070697_1003169382 78
219 3300005536 Ga0070697_100428823 Ga0070697_1004288232 78
220 3300005536 Ga0070697_100732087 Ga0070697_1007320872 78
221 3300005543 Ga0070672_100431948 Ga0070672_1004319482 78
222 3300005546 Ga0070696_101247379 Ga0070696_1012473792 78
223 3300005548 Ga0070665_100231343 Ga0070665_1002313432 78
224 3300005548 Ga0070665_100531756 Ga0070665_1005317561 78
225 3300005549 Ga0070704_100002997 Ga0070704_10000299713 78
226 3300005563 Ga0068855_100869535 Ga0068855_1008695353 78
227 3300005719 Ga0068861_100245269 Ga0068861_1002452692 78
228 3300005841 Ga0068863_100065177 Ga0068863_1000651774 78
229 3300005842 Ga0068858_100243514 Ga0068858_1002435142 78
230 3300005843 Ga0068860_100046304 Ga0068860_1000463043 78
231 3300005937 Ga0081455_10027728 Ga0081455_100277283 78
232 3300005937 Ga0081455_10033517 Ga0081455_100335174 78
233 3300005937 Ga0081455_10066064 Ga0081455_100660645 78
234 3300005983 Ga0081540_1115352 Ga0081540_11153522 78
235 3300005983 Ga0081540_1158383 Ga0081540_11583832 78
236 3300006028 Ga0070717_10052827 Ga0070717_100528272 78
237 3300006028 Ga0070717_11381067 Ga0070717_113810672 78
238 3300006028 Ga0070717_11674957 Ga0070717_116749571 78
239 3300006173 Ga0070716_100157366 Ga0070716_1001573663 78
240 3300006175 Ga0070712_100340425 Ga0070712_1003404252 78
241 3300006358 Ga0068871_100292198 Ga0068871_1002921982 78
242 3300006844 Ga0075428_100493240 Ga0075428_1004932403 78
243 3300006844 Ga0075428_101563938 Ga0075428_1015639381 78
244 3300006847 Ga0075431_101521737 Ga0075431_1015217372 78
245 3300006871 Ga0075434_100440123 Ga0075434_1004401233 78
246 3300006881 Ga0068865_100531934 Ga0068865_1005319343 78
247 3300006914 Ga0075436_100034999 Ga0075436_1000349992 78
248 3300006914 Ga0075436_100450902 Ga0075436_1004509021 78
249 3300007265 Ga0099794_10120537 Ga0099794_101205372 78
250 3300007265 Ga0099794_10132288 Ga0099794_101322882 78
251 3300007265 Ga0099794_10468309 Ga0099794_104683091 78
252 3300007788 Ga0099795_10026214 Ga0099795_100262142 78
253 3300009098 Ga0105245_10086639 Ga0105245_100866396 78
254 3300009098 Ga0105245_11703175 Ga0105245_117031751 78
255 3300009098 Ga0105245_11936425 Ga0105245_119364252 78
256 3300009098 Ga0105245_12649762 Ga0105245_126497622 78
257 3300009098 Ga0105245_13018334 Ga0105245_130183341 78
258 3300009098 Ga0105245_13028831 Ga0105245_130288311 78
259 3300009147 Ga0114129_10006734 Ga0114129_1000673411 78
260 3300009147 Ga0114129_10568236 Ga0114129_105682362 78
261 3300009148 Ga0105243_10527635 Ga0105243_105276352 78
262 3300009148 Ga0105243_12822566 Ga0105243_128225661 78
263 3300009176 Ga0105242_10195527 Ga0105242_101955271 78
264 3300009176 Ga0105242_10810641 Ga0105242_108106412 78
265 3300009176 Ga0105242_11421808 Ga0105242_114218082 78
266 3300009176 Ga0105242_11994652 Ga0105242_119946522 78
267 3300009177 Ga0105248_11425707 Ga0105248_114257072 78
268 3300009177 Ga0105248_11721517 Ga0105248_117215172 78
269 3300009545 Ga0105237_10765724 Ga0105237_107657242 78
270 3300009553 Ga0105249_10078307 Ga0105249_100783074 78
271 3300009553 Ga0105249_10078509 Ga0105249_100785093 78
272 3300009553 Ga0105249_10309196 Ga0105249_103091962 78
273 3300010159 Ga0099796_10005068 Ga0099796_100050685 78
274 3300010159 Ga0099796_10139556 Ga0099796_101395561 78
275 3300010375 Ga0105239_10146127 Ga0105239_101461274 78
276 3300010375 Ga0105239_10430894 Ga0105239_104308942 78
277 3300013105 Ga0157369_10635669 Ga0157369_106356691 78
278 3300013296 Ga0157374_10260773 Ga0157374_102607733 78
279 3300013296 Ga0157374_10280613 Ga0157374_102806132 78
280 3300013296 Ga0157374_10556481 Ga0157374_105564812 78
281 3300013296 Ga0157374_11145023 Ga0157374_111450232 78
282 3300013297 Ga0157378_10017733 Ga0157378_100177334 78
283 3300013297 Ga0157378_10045457 Ga0157378_100454576 78
284 3300013297 Ga0157378_10519570 Ga0157378_105195702 78
285 3300013306 Ga0163162_10169749 Ga0163162_101697492 78
286 3300013306 Ga0163162_10960349 Ga0163162_109603491 78
287 3300013307 Ga0157372_10515038 Ga0157372_105150383 78
288 3300013308 Ga0157375_10050583 Ga0157375_100505833 78
289 3300013308 Ga0157375_13220902 Ga0157375_132209021 78
290 3300014745 Ga0157377_10112400 Ga0157377_101124001 78
291 3300014745 Ga0157377_10195707 Ga0157377_101957072 78
292 3300014968 Ga0157379_10295126 Ga0157379_102951263 78
293 3300014969 Ga0157376_11439896 Ga0157376_114398962 78
294 3300017792 Ga0163161_10848202 Ga0163161_108482023 78
295 3300017792 Ga0163161_11355567 Ga0163161_113555671 78
296 3300025271 Ga0207666_1001307 Ga0207666_10013074 78
297 3300025271 Ga0207666_1015481 Ga0207666_10154812 78
298 3300025290 Ga0207673_1003036 Ga0207673_10030363 78
299 3300025315 Ga0207697_10019321 Ga0207697_100193213 78
300 3300025315 Ga0207697_10024938 Ga0207697_100249383 78
301 3300025315 Ga0207697_10147220 Ga0207697_101472203 78
302 3300025315 Ga0207697_10189109 Ga0207697_101891092 78
303 3300025315 Ga0207697_10256769 Ga0207697_102567691 78
304 3300025885 Ga0207653_10031133 Ga0207653_100311332 78
305 3300025898 Ga0207692_10591864 Ga0207692_105918642 78
306 3300025898 Ga0207692_11008141 Ga0207692_110081411 78
307 3300025898 Ga0207692_11137278 Ga0207692_111372782 78
308 3300025904 Ga0207647_10117115 Ga0207647_101171152 78
309 3300025904 Ga0207647_10138863 Ga0207647_101388632 78
310 3300025910 Ga0207684_10010154 Ga0207684_100101546 78
311 3300025910 Ga0207684_10027669 Ga0207684_100276692 78
312 3300025910 Ga0207684_10062978 Ga0207684_100629782 78
313 3300025915 Ga0207693_10205518 Ga0207693_102055183 78
314 3300025915 Ga0207693_10296141 Ga0207693_102961412 78
315 3300025915 Ga0207693_11095517 Ga0207693_110955172 78
316 3300025916 Ga0207663_10064242 Ga0207663_100642422 78
317 3300025916 Ga0207663_11102012 Ga0207663_111020121 78
318 3300025918 Ga0207662_10094084 Ga0207662_100940842 78
319 3300025918 Ga0207662_10270029 Ga0207662_102700292 78
320 3300025919 Ga0207657_10023722 Ga0207657_100237228 78
321 3300025921 Ga0207652_10306238 Ga0207652_103062382 78
322 3300025922 Ga0207646_10443897 Ga0207646_104438973 78
323 3300025922 Ga0207646_10576228 Ga0207646_105762282 78
324 3300025922 Ga0207646_11055414 Ga0207646_110554142 78
325 3300025922 Ga0207646_11190607 Ga0207646_111906072 78
326 3300025926 Ga0207659_10227612 Ga0207659_102276122 78
327 3300025926 Ga0207659_10294336 Ga0207659_102943362 78
328 3300025927 Ga0207687_11554001 Ga0207687_115540012 78
329 3300025928 Ga0207700_11716914 Ga0207700_117169141 78
330 3300025932 Ga0207690_10138803 Ga0207690_101388033 78
331 3300025933 Ga0207706_10065598 Ga0207706_100655983 78
332 3300025933 Ga0207706_10161352 Ga0207706_101613522 78
333 3300025933 Ga0207706_10435772 Ga0207706_104357723 78
334 3300025935 Ga0207709_11045401 Ga0207709_110454012 78
335 3300025936 Ga0207670_10245867 Ga0207670_102458673 78
336 3300025938 Ga0207704_10585989 Ga0207704_105859892 78
337 3300025939 Ga0207665_10217376 Ga0207665_102173763 78
338 3300025939 Ga0207665_10895027 Ga0207665_108950271 78
339 3300025939 Ga0207665_11688831 Ga0207665_116888312 78
340 3300025940 Ga0207691_10169221 Ga0207691_101692212 78
341 3300025942 Ga0207689_10047568 Ga0207689_100475682 78
342 3300025944 Ga0207661_10132785 Ga0207661_101327852 78
343 3300025945 Ga0207679_10884698 Ga0207679_108846982 78
344 3300025949 Ga0207667_11545884 Ga0207667_115458842 78
345 3300025961 Ga0207712_10081794 Ga0207712_100817944 78
346 3300025961 Ga0207712_11117432 Ga0207712_111174321 78
347 3300025972 Ga0207668_10132376 Ga0207668_101323762 78
348 3300025972 Ga0207668_11704885 Ga0207668_117048852 78
349 3300025986 Ga0207658_10272333 Ga0207658_102723332 78
350 3300025986 Ga0207658_11238511 Ga0207658_112385112 78
351 3300026023 Ga0207677_10202731 Ga0207677_102027313 78
352 3300026035 Ga0207703_10336759 Ga0207703_103367592 78
353 3300026067 Ga0207678_10763892 Ga0207678_107638922 78
354 3300026075 Ga0207708_10112133 Ga0207708_101121332 78
355 3300026088 Ga0207641_10328786 Ga0207641_103287862 78
356 3300026088 Ga0207641_12116724 Ga0207641_121167241 78
357 3300026095 Ga0207676_11621383 Ga0207676_116213832 78
358 3300026118 Ga0207675_100389387 Ga0207675_1003893873 78
359 3300026121 Ga0207683_11366542 Ga0207683_113665422 78
360 3300027617 Ga0210002_1019115 Ga0210002_10191152 78
361 3300027671 Ga0209588_1190195 Ga0209588_11901952 78
362 3300027682 Ga0209971_1079852 Ga0209971_10798521 78
363 3300027717 Ga0209998_10003228 Ga0209998_100032283 78
364 3300027876 Ga0209974_10013786 Ga0209974_100137863 78
365 3300028379 Ga0268266_10660362 Ga0268266_106603622 78
366 3300028381 Ga0268264_10564247 Ga0268264_105642472 78
367 3300028381 Ga0268264_12326514 Ga0268264_123265141 78
368 3300035083 Ga0373926_0140302 Ga0373926_0140302_423_659 78
369 3300035111 Ga0373923_0182490 Ga0373923_0182490_503_739 78
370 3300035113 Ga0373936_0523727 Ga0373936_0523727_235_471 78
371 3300035113 Ga0373936_0602689 Ga0373936_0602689_256_492 78
372 3300035114 Ga0373939_0085882 Ga0373939_0085882_26_262 78
373 3300035116 Ga0373945_0400520 Ga0373945_0400520_295_531 78
374 3300035119 Ga0373956_0184846 Ga0373956_0184846_17_253 78
375 3300035170 Ga0373943_0259056 Ga0373943_0259056_218_454 78
376 3300035171 Ga0373946_0060719 Ga0373946_0060719_182_418 78
377 3300035171 Ga0373946_0360962 Ga0373946_0360962_27_263 78
378 3300035172 Ga0373955_0127974 Ga0373955_0127974_56_292 78
379 3300035691 Ga0373931_0460923 Ga0373931_0460923_426_674 78
380 3300035692 Ga0373935_0036165 Ga0373935_0036165_2705_2941 78
381 3300035692 Ga0373935_0727032 Ga0373935_0727032_399_635 78
382 3300035695 Ga0373927_0480317 Ga0373927_0480317_491_727 78
383 3300035724 Ga0373933_0263728 Ga0373933_0263728_117_353 78
384 3300035725 Ga0373947_0961100 Ga0373947_0961100_258_494 78
385 3300035725 Ga0373947_1226759 Ga0373947_1226759_210_446 78
386 3300036401 Ga0373937_0051503 Ga0373937_0051503_3183_3419 78
387 3300036401 Ga0373937_0850634 Ga0373937_0850634_329_577 78
388 3300037068 Ga0373925_0215732 Ga0373925_0215732_1165_1407 78
389 3300037068 Ga0373925_1344555 Ga0373925_1344555_20_256 78
390 3300037418 Ga0395900_0102768 Ga0395900_0102768_2122_2364 78
391 3300037418 Ga0395900_0732166 Ga0395900_0732166_534_782 78
392 3300037471 Ga0395905_1791101 Ga0395905_1791101_134_382 78
393 3300038443 Ga0395901_0267590 Ga0395901_0267590_68_316 78
394 3300038443 Ga0395901_0846490 Ga0395901_0846490_88_330 78
395 3300039450 Ga0436363_1252962 Ga0436363_1252962_425_664 78
396 3300039453 Ga0436362_0358886 Ga0436362_0358886_258_497 78
397 3300042005 Ga0439448_0059937 Ga0439448_0059937_222_464 78
398 3300042005 Ga0439448_0123381 Ga0439448_0123381_218_466 78
399 3300042008 Ga0439450_040912 Ga0439450_040912_693_941 78
400 3300042012 Ga0439455_0002349 Ga0439455_0002349_2081_2323 78
401 3300042012 Ga0439455_0162433 Ga0439455_0162433_346_594 78
402 3300042012 Ga0439455_0187558 Ga0439455_0187558_67_315 78
403 3300042157 Ga0439458_0026772 Ga0439458_0026772_271_513 78
404 3300042439 Ga0439464_0073500 Ga0439464_0073500_327_569 78
405 3300042439 Ga0439464_0175770 Ga0439464_0175770_113_355 78
406 3300042461 Ga0439460_0088531 Ga0439460_0088531_538_780 78
407 3300045051 Ga0451576_0544346 Ga0451576_0544346_904_1146 78
408 3300046461 Ga0495641_0300381 Ga0495641_0300381_256_504 78
409 3300046462 Ga0495651_0530203 Ga0495651_0530203_397_633 78
410 3300046477 Ga0495664_0468872 Ga0495664_0468872_502_738 78
411 3300046491 Ga0495584_0191282 Ga0495584_0191282_523_759 78
412 3300046514 Ga0495618_0676769 Ga0495618_0676769_250_486 78
413 3300046516 Ga0495628_0231301 Ga0495628_0231301_246_482 78
414 3300046517 Ga0495630_0489225 Ga0495630_0489225_191_427 78
415 3300046517 Ga0495630_0797349 Ga0495630_0797349_319_567 78
416 3300046517 Ga0495630_1303654 Ga0495630_1303654_30_278 78
417 3300046543 Ga0495645_0122012 Ga0495645_0122012_473_709 78
418 3300046642 Ga0495634_0558542 Ga0495634_0558542_378_614 78
419 3300046663 Ga0495635_0349255 Ga0495635_0349255_728_964 78
420 3300046680 Ga0495646_0291000 Ga0495646_0291000_122_358 78
421 3300046681 Ga0495647_0138915 Ga0495647_0138915_549_797 78
422 3300046684 Ga0495669_0103324 Ga0495669_0103324_681_929 78
423 3300047319 Ga0495674_0311784 Ga0495674_0311784_147_395 78
424 3300047321 Ga0495676_0254154 Ga0495676_0254154_127_375 78
425 3300047322 Ga0495680_0194583 Ga0495680_0194583_144_392 78
426 3300047444 Ga0495675_0081308 Ga0495675_0081308_792_1028 78
427 3300047471 Ga0495684_0189391 Ga0495684_0189391_118_354 78
428 3300048911 Ga0496108_0136285 Ga0496108_0136285_1034_1276 78
429 3300048913 Ga0496110_0109495 Ga0496110_0109495_1014_1256 78
430 3300048914 Ga0496111_1186928 Ga0496111_1186928_49_285 78
431 3300048914 Ga0496111_1248891 Ga0496111_1248891_110_352 78
432 3300048915 Ga0496112_0392633 Ga0496112_0392633_732_974 78
433 3300048915 Ga0496112_0625289 Ga0496112_0625289_565_801 78
434 3300048916 Ga0496113_0685148 Ga0496113_0685148_545_793 78
435 3300048917 Ga0496114_0149117 Ga0496114_0149117_1708_1956 78
436 3300048918 Ga0496115_0469740 Ga0496115_0469740_54_296 78
437 3300050507 nmdc:mga05p37_407355_c1 nmdc:mga05p37_407355_c1_707_943 78
438 3300050507 nmdc:mga05p37_635685_c1 nmdc:mga05p37_635685_c1_378_614 78
439 3300050507 nmdc:mga05p37_71349_c1 nmdc:mga05p37_71349_c1_298_546 78
440 3300050511 nmdc:mga08y16_901846_c1 nmdc:mga08y16_901846_c1_120_356 78
441 3300050512 nmdc:mga0n895_579459_c1 nmdc:mga0n895_579459_c1_475_723 78
442 3300050513 nmdc:mga0rr50_1628155_c1 nmdc:mga0rr50_1628155_c1_202_441 78
443 3300050513 nmdc:mga0rr50_517576_c1 nmdc:mga0rr50_517576_c1_68_304 78
444 3300050514 nmdc:mga08x19_29033_c1 nmdc:mga08x19_29033_c1_676_915 78
445 3300050515 nmdc:mga0a205_331918_c1 nmdc:mga0a205_331918_c1_604_852 78
446 3300050515 nmdc:mga0a205_532619_c1 nmdc:mga0a205_532619_c1_590_826 78
447 3300050515 nmdc:mga0a205_894731_c1 nmdc:mga0a205_894731_c1_130_366 78
448 3300053085 Ga0495619_0607822 Ga0495619_0607822_188_436 78
449 3300059640 Ga0587067_127459 Ga0587067_127459_288_524 78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4my6-assembly1.cif.gz_A enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh 0.637 21 41
1qvi-assembly1.cif.gz_A crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head 0.5759 22 75
2otg-assembly1.cif.gz_A rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor 0.5667 22 75
5t45-assembly1.cif.gz_A chicken smooth muscle myosin motor domain co-crystallized with the specific ck-571 inhibitor, mgadp.befx form 0.5545 22 72
4a4e-assembly1.cif.gz_A solution structure of smn tudor domain in complex with symmetrically dimethylated arginine 0.5506 23 78
ID Description Score Start End Superfamily
3dnhA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6825 21 37 2.30.110.10
af_A0A2R8Q3W9_2_100_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.6099 21 42 2.60.40.150
af_Q4V9I6_60_182_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.5919 19 37 2.40.10.10
af_Q9VWS8_303_353_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.5828 23 73 2.30.30.140
af_Q5VSI4_773_839_2.40.50.90 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.5792 23 78 2.40.50.90
ID Description Score Start End GO Terms
AF-A0A7W1MTU6-F1-model_v4 Uncharacterized protein 0.9726 21 76
AF-A0A2V5UIB6-F1-model_v4 Uncharacterized protein 0.949 14 78
AF-A0A7Z1ZC26-F1-model_v4 deleted 0.9464 22 76
AF-A0A127EY42-F1-model_v4 Zinc finger CHCC-type domain-containing protein 0.9443 22 75
AF-A0A1Y5SZA3-F1-model_v4 Uncharacterized protein 0.9429 22 74

Feature Viewer

pLDDT pTM Quality
83.1 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map