F446400
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 449 | 240 | 449 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300025910|Ga0207684_10027669|Ga0207684_100276692 |
| Length | 95 |
| Sequence | MILPRRGSFTDSDMATRFLFDPPRRPKAKVGPNLKSLLVRCPSTSKLTDTGQTMEEKRWRIARVKTQSFTCAHCGGIHTWTKKDVILGRPISINR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 77 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 138 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 139 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 142 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 149 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 160 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 161 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 162 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 163 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 164 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 165 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 166 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 167 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 168 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 169 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 170 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 231 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.78 |
| Metatranscriptomes | 0.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.01 |
| Rhizosphere | 93.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3091812 | 2162886007 | Unclassified | 1155 |
| 2 | JGI24035J26624_1002606 | 3300002126 | Bacteria | 1684 |
| 3 | JGI25405J52794_10002557 | 3300003911 | Unclassified | 3144 |
| 4 | JGI25405J52794_10134608 | 3300003911 | Unclassified | 560 |
| 5 | Ga0065714_10198230 | 3300005288 | Unclassified | 904 |
| 6 | Ga0065714_10239087 | 3300005288 | Unclassified | 775 |
| 7 | Ga0065704_10031597 | 3300005289 | Unclassified | 774 |
| 8 | Ga0065704_10083566 | 3300005289 | Bacteria | 3448 |
| 9 | Ga0065712_10175636 | 3300005290 | Bacteria | 1196 |
| 10 | Ga0065712_10208697 | 3300005290 | Bacteria | 1081 |
| 11 | Ga0065712_10213629 | 3300005290 | Unclassified | 1046 |
| 12 | Ga0065712_10339090 | 3300005290 | Unclassified | 803 |
| 13 | Ga0065712_10498800 | 3300005290 | Unclassified | 650 |
| 14 | Ga0065715_10030536 | 3300005293 | Bacteria | 1060 |
| 15 | Ga0065715_10116467 | 3300005293 | Bacteria | 2378 |
| 16 | Ga0065715_10398975 | 3300005293 | Unclassified | 884 |
| 17 | Ga0065715_10593819 | 3300005293 | Unclassified | 712 |
| 18 | Ga0065707_10039729 | 3300005295 | Bacteria | 1124 |
| 19 | Ga0065707_10333507 | 3300005295 | Unclassified | 945 |
| 20 | Ga0070676_10227638 | 3300005328 | Bacteria | 1234 |
| 21 | Ga0070676_11176891 | 3300005328 | Bacteria | 582 |
| 22 | Ga0070683_100493402 | 3300005329 | Unclassified | 1170 |
| 23 | Ga0070683_100598085 | 3300005329 | Bacteria | 1055 |
| 24 | Ga0070683_100854740 | 3300005329 | Unclassified | 872 |
| 25 | Ga0070690_100815371 | 3300005330 | Unclassified | 725 |
| 26 | Ga0070670_100671047 | 3300005331 | Unclassified | 931 |
| 27 | Ga0070680_100680870 | 3300005336 | Bacteria | 885 |
| 28 | Ga0068868_100526507 | 3300005338 | Unclassified | 1038 |
| 29 | Ga0068868_100699539 | 3300005338 | Unclassified | 907 |
| 30 | Ga0070660_100284724 | 3300005339 | Bacteria | 1353 |
| 31 | Ga0070660_101224421 | 3300005339 | Unclassified | 637 |
| 32 | Ga0070689_100337638 | 3300005340 | Bacteria | 1261 |
| 33 | Ga0070687_100586548 | 3300005343 | Unclassified | 764 |
| 34 | Ga0070692_10409651 | 3300005345 | Unclassified | 858 |
| 35 | Ga0070668_100054758 | 3300005347 | Bacteria | 3077 |
| 36 | Ga0070668_101305951 | 3300005347 | Unclassified | 659 |
| 37 | Ga0070675_100006224 | 3300005354 | Bacteria | 9155 |
| 38 | Ga0070675_100176212 | 3300005354 | Unclassified | 1847 |
| 39 | Ga0070675_100299523 | 3300005354 | Bacteria | 1416 |
| 40 | Ga0070674_100098848 | 3300005356 | Bacteria | 2122 |
| 41 | Ga0070673_100627941 | 3300005364 | Bacteria | 982 |
| 42 | Ga0070673_101271795 | 3300005364 | Unclassified | 690 |
| 43 | Ga0070688_100184159 | 3300005365 | Bacteria | 1450 |
| 44 | Ga0070714_100511209 | 3300005435 | Bacteria | 1146 |
| 45 | Ga0070714_101398501 | 3300005435 | Bacteria | 683 |
| 46 | Ga0070713_101510930 | 3300005436 | Unclassified | 652 |
| 47 | Ga0070701_10110314 | 3300005438 | Bacteria | 1536 |
| 48 | Ga0070711_100733570 | 3300005439 | Unclassified | 834 |
| 49 | Ga0070711_101280476 | 3300005439 | Unclassified | 636 |
| 50 | Ga0070705_100134537 | 3300005440 | Bacteria | 1617 |
| 51 | Ga0070705_101767471 | 3300005440 | Unclassified | 524 |
| 52 | Ga0070700_100056848 | 3300005441 | Bacteria | 2454 |
| 53 | Ga0070708_100219987 | 3300005445 | Unclassified | 1781 |
| 54 | Ga0070708_101327402 | 3300005445 | Unclassified | 672 |
| 55 | Ga0070662_100203354 | 3300005457 | Bacteria | 1573 |
| 56 | Ga0070685_10222815 | 3300005466 | Unclassified | 1236 |
| 57 | Ga0070706_100514286 | 3300005467 | Unclassified | 1114 |
| 58 | Ga0070706_100619207 | 3300005467 | Unclassified | 1005 |
| 59 | Ga0070706_100623643 | 3300005467 | Unclassified | 1001 |
| 60 | Ga0070706_100759234 | 3300005467 | Unclassified | 898 |
| 61 | Ga0070706_100825380 | 3300005467 | Unclassified | 858 |
| 62 | Ga0070707_100014309 | 3300005468 | Bacteria | 7438 |
| 63 | Ga0070707_100154573 | 3300005468 | Unclassified | 2235 |
| 64 | Ga0070707_101677475 | 3300005468 | Unclassified | 603 |
| 65 | Ga0070698_100029855 | 3300005471 | Bacteria | 5656 |
| 66 | Ga0070698_100136810 | 3300005471 | Bacteria | 2403 |
| 67 | Ga0070698_100316450 | 3300005471 | Bacteria | 1491 |
| 68 | Ga0070699_100245952 | 3300005518 | Bacteria | 1598 |
| 69 | Ga0070699_101054836 | 3300005518 | Unclassified | 745 |
| 70 | Ga0070699_101073645 | 3300005518 | Unclassified | 739 |
| 71 | Ga0070679_100390019 | 3300005530 | Bacteria | 1339 |
| 72 | Ga0070684_100040959 | 3300005535 | Bacteria | 3991 |
| 73 | Ga0070684_100412280 | 3300005535 | Bacteria | 1246 |
| 74 | Ga0070684_100975979 | 3300005535 | Unclassified | 795 |
| 75 | Ga0070697_100029326 | 3300005536 | Bacteria | 4410 |
| 76 | Ga0070697_100316938 | 3300005536 | Bacteria | 1342 |
| 77 | Ga0070697_100428823 | 3300005536 | Unclassified | 1150 |
| 78 | Ga0070697_100732087 | 3300005536 | Bacteria | 873 |
| 79 | Ga0068853_100440613 | 3300005539 | Unclassified | 1224 |
| 80 | Ga0068853_102434813 | 3300005539 | Unclassified | 507 |
| 81 | Ga0070672_100431948 | 3300005543 | Unclassified | 1132 |
| 82 | Ga0070696_101247379 | 3300005546 | Unclassified | 629 |
| 83 | Ga0070665_100231343 | 3300005548 | Bacteria | 1848 |
| 84 | Ga0070665_100531756 | 3300005548 | Bacteria | 1187 |
| 85 | Ga0070704_100002997 | 3300005549 | Bacteria | 9598 |
| 86 | Ga0068855_100869535 | 3300005563 | Unclassified | 954 |
| 87 | Ga0070664_101125708 | 3300005564 | Bacteria | 740 |
| 88 | Ga0068861_100245269 | 3300005719 | Unclassified | 1526 |
| 89 | Ga0068863_100065177 | 3300005841 | Bacteria | 3446 |
| 90 | Ga0068858_100243514 | 3300005842 | Bacteria | 1707 |
| 91 | Ga0068860_100046304 | 3300005843 | Bacteria | 4147 |
| 92 | Ga0081455_10027728 | 3300005937 | Bacteria | 5187 |
| 93 | Ga0081455_10033517 | 3300005937 | Bacteria | 4614 |
| 94 | Ga0081455_10066064 | 3300005937 | Bacteria | 3022 |
| 95 | Ga0081540_1115352 | 3300005983 | Bacteria | 1126 |
| 96 | Ga0081540_1158383 | 3300005983 | Unclassified | 882 |
| 97 | Ga0081540_1294720 | 3300005983 | Unclassified | 558 |
| 98 | Ga0081539_10090675 | 3300005985 | Unclassified | 1580 |
| 99 | Ga0070717_10052827 | 3300006028 | Unclassified | 3349 |
| 100 | Ga0070717_11381067 | 3300006028 | Unclassified | 640 |
| 101 | Ga0070717_11674957 | 3300006028 | Bacteria | 576 |
| 102 | Ga0070715_10134239 | 3300006163 | Bacteria | 1195 |
| 103 | Ga0070716_100157366 | 3300006173 | Bacteria | 1468 |
| 104 | Ga0070712_100340425 | 3300006175 | Bacteria | 1224 |
| 105 | Ga0070712_101999328 | 3300006175 | Unclassified | 508 |
| 106 | Ga0068871_100292198 | 3300006358 | Unclassified | 1428 |
| 107 | Ga0068871_100440392 | 3300006358 | Bacteria | 1166 |
| 108 | Ga0075428_100493240 | 3300006844 | Bacteria | 1311 |
| 109 | Ga0075428_101563938 | 3300006844 | Unclassified | 690 |
| 110 | Ga0075431_101521737 | 3300006847 | Unclassified | 627 |
| 111 | Ga0075434_100440123 | 3300006871 | Unclassified | 1325 |
| 112 | Ga0075434_100627048 | 3300006871 | Bacteria | 1094 |
| 113 | Ga0068865_100531934 | 3300006881 | Bacteria | 984 |
| 114 | Ga0075436_100034999 | 3300006914 | Unclassified | 3464 |
| 115 | Ga0075436_100450902 | 3300006914 | Unclassified | 937 |
| 116 | Ga0099794_10120537 | 3300007265 | Unclassified | 1319 |
| 117 | Ga0099794_10132288 | 3300007265 | Unclassified | 1260 |
| 118 | Ga0099794_10468309 | 3300007265 | Bacteria | 661 |
| 119 | Ga0099795_10026214 | 3300007788 | Unclassified | 1962 |
| 120 | Ga0105245_10086639 | 3300009098 | Bacteria | 2873 |
| 121 | Ga0105245_11703175 | 3300009098 | Unclassified | 683 |
| 122 | Ga0105245_11936425 | 3300009098 | Bacteria | 643 |
| 123 | Ga0105245_12649762 | 3300009098 | Unclassified | 554 |
| 124 | Ga0105245_13018334 | 3300009098 | Unclassified | 522 |
| 125 | Ga0105245_13028831 | 3300009098 | Unclassified | 521 |
| 126 | Ga0114129_10006734 | 3300009147 | Bacteria | 16318 |
| 127 | Ga0114129_10568236 | 3300009147 | Bacteria | 1473 |
| 128 | Ga0114129_11520245 | 3300009147 | Bacteria | 822 |
| 129 | Ga0105243_10527635 | 3300009148 | Bacteria | 1124 |
| 130 | Ga0105243_12822566 | 3300009148 | Unclassified | 526 |
| 131 | Ga0105242_10195527 | 3300009176 | Bacteria | 1793 |
| 132 | Ga0105242_10810641 | 3300009176 | Unclassified | 928 |
| 133 | Ga0105242_11421808 | 3300009176 | Unclassified | 722 |
| 134 | Ga0105242_11994652 | 3300009176 | Bacteria | 622 |
| 135 | Ga0105248_11425707 | 3300009177 | Unclassified | 784 |
| 136 | Ga0105248_11721517 | 3300009177 | Unclassified | 711 |
| 137 | Ga0105237_10765724 | 3300009545 | Unclassified | 972 |
| 138 | Ga0105249_10078307 | 3300009553 | Bacteria | 3067 |
| 139 | Ga0105249_10078509 | 3300009553 | Bacteria | 3063 |
| 140 | Ga0105249_10309196 | 3300009553 | Bacteria | 1588 |
| 141 | Ga0105249_13053651 | 3300009553 | Unclassified | 538 |
| 142 | Ga0099796_10005068 | 3300010159 | Bacteria | 3254 |
| 143 | Ga0099796_10139556 | 3300010159 | Unclassified | 946 |
| 144 | Ga0105239_10146127 | 3300010375 | Bacteria | 2637 |
| 145 | Ga0105239_10430894 | 3300010375 | Unclassified | 1495 |
| 146 | Ga0105246_10233438 | 3300011119 | Bacteria | 1450 |
| 147 | Ga0157345_1005848 | 3300012498 | Unclassified | 964 |
| 148 | Ga0157315_1004532 | 3300012508 | Bacteria | 998 |
| 149 | Ga0157371_10767544 | 3300013102 | Bacteria | 725 |
| 150 | Ga0157371_10969326 | 3300013102 | Unclassified | 647 |
| 151 | Ga0157369_10635669 | 3300013105 | Unclassified | 1101 |
| 152 | Ga0157374_10142065 | 3300013296 | Unclassified | 2331 |
| 153 | Ga0157374_10260773 | 3300013296 | Bacteria | 1707 |
| 154 | Ga0157374_10280613 | 3300013296 | Bacteria | 1645 |
| 155 | Ga0157374_10556481 | 3300013296 | Bacteria | 1155 |
| 156 | Ga0157374_10703709 | 3300013296 | Bacteria | 1023 |
| 157 | Ga0157374_11145023 | 3300013296 | Bacteria | 799 |
| 158 | Ga0157374_12847166 | 3300013296 | Bacteria | 511 |
| 159 | Ga0157378_10017733 | 3300013297 | Bacteria | 6250 |
| 160 | Ga0157378_10045457 | 3300013297 | Bacteria | 3901 |
| 161 | Ga0157378_10122310 | 3300013297 | Bacteria | 2401 |
| 162 | Ga0157378_10519570 | 3300013297 | Unclassified | 1192 |
| 163 | Ga0157378_10676410 | 3300013297 | Bacteria | 1050 |
| 164 | Ga0163162_10169749 | 3300013306 | Bacteria | 2306 |
| 165 | Ga0163162_10960349 | 3300013306 | Unclassified | 965 |
| 166 | Ga0157372_10016210 | 3300013307 | Bacteria | 7995 |
| 167 | Ga0157372_10247746 | 3300013307 | Bacteria | 2068 |
| 168 | Ga0157372_10515038 | 3300013307 | Unclassified | 1395 |
| 169 | Ga0157375_10039899 | 3300013308 | Bacteria | 4521 |
| 170 | Ga0157375_10050583 | 3300013308 | Bacteria | 4076 |
| 171 | Ga0157375_13218418 | 3300013308 | Unclassified | 544 |
| 172 | Ga0157375_13220902 | 3300013308 | Unclassified | 544 |
| 173 | Ga0163163_10888968 | 3300014325 | Bacteria | 954 |
| 174 | Ga0163163_11258350 | 3300014325 | Bacteria | 802 |
| 175 | Ga0157377_10112400 | 3300014745 | Unclassified | 1639 |
| 176 | Ga0157377_10195707 | 3300014745 | Bacteria | 1280 |
| 177 | Ga0157379_10295126 | 3300014968 | Bacteria | 1477 |
| 178 | Ga0157376_10372014 | 3300014969 | Bacteria | 1374 |
| 179 | Ga0157376_11439896 | 3300014969 | Unclassified | 721 |
| 180 | Ga0157376_12507578 | 3300014969 | Bacteria | 555 |
| 181 | Ga0163161_10848202 | 3300017792 | Unclassified | 771 |
| 182 | Ga0163161_11355567 | 3300017792 | Unclassified | 620 |
| 183 | Ga0163161_11477931 | 3300017792 | Unclassified | 596 |
| 184 | Ga0207666_1001307 | 3300025271 | Bacteria | 2930 |
| 185 | Ga0207666_1015481 | 3300025271 | Unclassified | 1086 |
| 186 | Ga0207673_1003036 | 3300025290 | Bacteria | 1947 |
| 187 | Ga0207697_10003691 | 3300025315 | Bacteria | 7495 |
| 188 | Ga0207697_10019321 | 3300025315 | Bacteria | 2790 |
| 189 | Ga0207697_10024938 | 3300025315 | Bacteria | 2446 |
| 190 | Ga0207697_10147220 | 3300025315 | Bacteria | 1023 |
| 191 | Ga0207697_10189109 | 3300025315 | Unclassified | 904 |
| 192 | Ga0207697_10256769 | 3300025315 | Bacteria | 773 |
| 193 | Ga0207653_10031133 | 3300025885 | Bacteria | 1723 |
| 194 | Ga0207692_10591864 | 3300025898 | Unclassified | 712 |
| 195 | Ga0207692_11008141 | 3300025898 | Unclassified | 550 |
| 196 | Ga0207692_11137278 | 3300025898 | Unclassified | 518 |
| 197 | Ga0207647_10117115 | 3300025904 | Bacteria | 1573 |
| 198 | Ga0207647_10138863 | 3300025904 | Bacteria | 1425 |
| 199 | Ga0207684_10010154 | 3300025910 | Bacteria | 8290 |
| 200 | Ga0207684_10027669 | 3300025910 | Unclassified | 4829 |
| 201 | Ga0207684_10062978 | 3300025910 | Bacteria | 3149 |
| 202 | Ga0207693_10205518 | 3300025915 | Bacteria | 1548 |
| 203 | Ga0207693_10296141 | 3300025915 | Unclassified | 1267 |
| 204 | Ga0207693_11095517 | 3300025915 | Unclassified | 605 |
| 205 | Ga0207663_10064242 | 3300025916 | Bacteria | 2341 |
| 206 | Ga0207663_11102012 | 3300025916 | Unclassified | 638 |
| 207 | Ga0207662_10094084 | 3300025918 | Unclassified | 1847 |
| 208 | Ga0207662_10270029 | 3300025918 | Unclassified | 1122 |
| 209 | Ga0207657_10023722 | 3300025919 | Bacteria | 5705 |
| 210 | Ga0207652_10306238 | 3300025921 | Bacteria | 1434 |
| 211 | Ga0207646_10443897 | 3300025922 | Unclassified | 1171 |
| 212 | Ga0207646_10576228 | 3300025922 | Unclassified | 1011 |
| 213 | Ga0207646_11055414 | 3300025922 | Bacteria | 716 |
| 214 | Ga0207646_11190607 | 3300025922 | Unclassified | 668 |
| 215 | Ga0207659_10227612 | 3300025926 | Bacteria | 1502 |
| 216 | Ga0207659_10294336 | 3300025926 | Unclassified | 1331 |
| 217 | Ga0207687_11554001 | 3300025927 | Unclassified | 568 |
| 218 | Ga0207700_11716914 | 3300025928 | Unclassified | 553 |
| 219 | Ga0207644_10087804 | 3300025931 | Bacteria | 2312 |
| 220 | Ga0207690_10138803 | 3300025932 | Bacteria | 1788 |
| 221 | Ga0207706_10065598 | 3300025933 | Bacteria | 3197 |
| 222 | Ga0207706_10161352 | 3300025933 | Unclassified | 1970 |
| 223 | Ga0207706_10435772 | 3300025933 | Bacteria | 1135 |
| 224 | Ga0207706_11091487 | 3300025933 | Unclassified | 667 |
| 225 | Ga0207709_11045401 | 3300025935 | Unclassified | 669 |
| 226 | Ga0207670_10245867 | 3300025936 | Bacteria | 1380 |
| 227 | Ga0207670_10769517 | 3300025936 | Bacteria | 801 |
| 228 | Ga0207704_10585989 | 3300025938 | Unclassified | 911 |
| 229 | Ga0207665_10217376 | 3300025939 | Bacteria | 1399 |
| 230 | Ga0207665_10895027 | 3300025939 | Unclassified | 704 |
| 231 | Ga0207665_11688831 | 3300025939 | Unclassified | 501 |
| 232 | Ga0207691_10169221 | 3300025940 | Bacteria | 1914 |
| 233 | Ga0207711_10714212 | 3300025941 | Bacteria | 935 |
| 234 | Ga0207689_10047568 | 3300025942 | Bacteria | 3540 |
| 235 | Ga0207661_10132785 | 3300025944 | Bacteria | 2135 |
| 236 | Ga0207661_11491162 | 3300025944 | Unclassified | 620 |
| 237 | Ga0207679_10884698 | 3300025945 | Unclassified | 816 |
| 238 | Ga0207667_11545884 | 3300025949 | Unclassified | 633 |
| 239 | Ga0207712_10081794 | 3300025961 | Bacteria | 2353 |
| 240 | Ga0207712_11117432 | 3300025961 | Unclassified | 702 |
| 241 | Ga0207668_10132376 | 3300025972 | Bacteria | 1906 |
| 242 | Ga0207668_11704885 | 3300025972 | Unclassified | 569 |
| 243 | Ga0207658_10272333 | 3300025986 | Bacteria | 1448 |
| 244 | Ga0207658_11238511 | 3300025986 | Unclassified | 682 |
| 245 | Ga0207677_10202731 | 3300026023 | Unclassified | 1578 |
| 246 | Ga0207703_10336759 | 3300026035 | Bacteria | 1386 |
| 247 | Ga0207678_10763892 | 3300026067 | Unclassified | 852 |
| 248 | Ga0207708_10112133 | 3300026075 | Bacteria | 2118 |
| 249 | Ga0207641_10328786 | 3300026088 | Bacteria | 1451 |
| 250 | Ga0207641_12116724 | 3300026088 | Unclassified | 563 |
| 251 | Ga0207676_11621383 | 3300026095 | Unclassified | 645 |
| 252 | Ga0207675_100389387 | 3300026118 | Bacteria | 1372 |
| 253 | Ga0207683_10109673 | 3300026121 | Bacteria | 2470 |
| 254 | Ga0207683_11366542 | 3300026121 | Unclassified | 655 |
| 255 | Ga0210002_1019115 | 3300027617 | Unclassified | 1099 |
| 256 | Ga0209588_1190195 | 3300027671 | Bacteria | 642 |
| 257 | Ga0209971_1079852 | 3300027682 | Unclassified | 796 |
| 258 | Ga0209998_10003228 | 3300027717 | Bacteria | 3601 |
| 259 | Ga0209974_10013786 | 3300027876 | Bacteria | 2692 |
| 260 | Ga0268266_10660362 | 3300028379 | Bacteria | 1006 |
| 261 | Ga0268264_10564247 | 3300028381 | Unclassified | 1118 |
| 262 | Ga0268264_12326514 | 3300028381 | Bacteria | 542 |
| 263 | Ga0373926_0140302 | 3300035083 | Unclassified | 918 |
| 264 | Ga0373934_0063529 | 3300035086 | Bacteria | 1473 |
| 265 | Ga0373944_0057681 | 3300035089 | Unclassified | 1238 |
| 266 | Ga0373923_0182490 | 3300035111 | Unclassified | 965 |
| 267 | Ga0373936_0512653 | 3300035113 | Unclassified | 558 |
| 268 | Ga0373936_0523727 | 3300035113 | Unclassified | 552 |
| 269 | Ga0373936_0602689 | 3300035113 | Unclassified | 516 |
| 270 | Ga0373939_0085882 | 3300035114 | Bacteria | 1055 |
| 271 | Ga0373945_0154769 | 3300035116 | Bacteria | 931 |
| 272 | Ga0373945_0284923 | 3300035116 | Unclassified | 705 |
| 273 | Ga0373945_0400520 | 3300035116 | Unclassified | 601 |
| 274 | Ga0373953_0183286 | 3300035117 | Bacteria | 903 |
| 275 | Ga0373954_0195817 | 3300035118 | Unclassified | 993 |
| 276 | Ga0373956_0184846 | 3300035119 | Unclassified | 986 |
| 277 | Ga0373943_0259056 | 3300035170 | Unclassified | 979 |
| 278 | Ga0373943_0312700 | 3300035170 | Bacteria | 894 |
| 279 | Ga0373943_0394930 | 3300035170 | Bacteria | 798 |
| 280 | Ga0373946_0060719 | 3300035171 | Unclassified | 1608 |
| 281 | Ga0373946_0231295 | 3300035171 | Unclassified | 896 |
| 282 | Ga0373946_0360962 | 3300035171 | Unclassified | 728 |
| 283 | Ga0373955_0127974 | 3300035172 | Unclassified | 1481 |
| 284 | Ga0373955_0176473 | 3300035172 | Unclassified | 1266 |
| 285 | Ga0373931_0055092 | 3300035691 | Bacteria | 2127 |
| 286 | Ga0373931_0460923 | 3300035691 | Unclassified | 814 |
| 287 | Ga0373935_0036165 | 3300035692 | Plasmid | 3086 |
| 288 | Ga0373935_0055207 | 3300035692 | Bacteria | 2531 |
| 289 | Ga0373935_0183915 | 3300035692 | Bacteria | 1436 |
| 290 | Ga0373935_0727032 | 3300035692 | Unclassified | 731 |
| 291 | Ga0373927_0480317 | 3300035695 | Unclassified | 821 |
| 292 | Ga0373927_0866176 | 3300035695 | Unclassified | 596 |
| 293 | Ga0373933_0156110 | 3300035724 | Bacteria | 1447 |
| 294 | Ga0373933_0263728 | 3300035724 | Bacteria | 1111 |
| 295 | Ga0373947_0023777 | 3300035725 | Unclassified | 3567 |
| 296 | Ga0373947_0245120 | 3300035725 | Bacteria | 1183 |
| 297 | Ga0373947_0347236 | 3300035725 | Unclassified | 995 |
| 298 | Ga0373947_0961100 | 3300035725 | Unclassified | 583 |
| 299 | Ga0373947_1226759 | 3300035725 | Unclassified | 511 |
| 300 | Ga0373937_0051503 | 3300036401 | Unclassified | 3774 |
| 301 | Ga0373937_0407867 | 3300036401 | Unclassified | 1289 |
| 302 | Ga0373937_0674658 | 3300036401 | Bacteria | 979 |
| 303 | Ga0373937_0850634 | 3300036401 | Bacteria | 861 |
| 304 | Ga0373925_0214857 | 3300037068 | Bacteria | 1533 |
| 305 | Ga0373925_0215732 | 3300037068 | Bacteria | 1530 |
| 306 | Ga0373925_0337999 | 3300037068 | Bacteria | 1221 |
| 307 | Ga0373925_0685962 | 3300037068 | Unclassified | 844 |
| 308 | Ga0373925_1064315 | 3300037068 | Unclassified | 666 |
| 309 | Ga0373925_1344555 | 3300037068 | Unclassified | 586 |
| 310 | Ga0395900_0005020 | 3300037418 | Bacteria | 13882 |
| 311 | Ga0395900_0102768 | 3300037418 | Unclassified | 2936 |
| 312 | Ga0395900_0732166 | 3300037418 | Unclassified | 920 |
| 313 | Ga0395905_1791101 | 3300037471 | Unclassified | 520 |
| 314 | Ga0395901_0101057 | 3300038443 | Bacteria | 3026 |
| 315 | Ga0395901_0267590 | 3300038443 | Bacteria | 1778 |
| 316 | Ga0395901_0846490 | 3300038443 | Unclassified | 900 |
| 317 | Ga0436365_1123849 | 3300039437 | Unclassified | 547 |
| 318 | Ga0436363_1252962 | 3300039450 | Bacteria | 1055 |
| 319 | Ga0436362_0358886 | 3300039453 | Unclassified | 683 |
| 320 | Ga0439448_0059937 | 3300042005 | Bacteria | 1257 |
| 321 | Ga0439448_0123381 | 3300042005 | Unclassified | 890 |
| 322 | Ga0439450_040912 | 3300042008 | Bacteria | 1076 |
| 323 | Ga0439455_0002349 | 3300042012 | Bacteria | 3416 |
| 324 | Ga0439455_0026410 | 3300042012 | Bacteria | 1418 |
| 325 | Ga0439455_0162433 | 3300042012 | Unclassified | 639 |
| 326 | Ga0439455_0187558 | 3300042012 | Unclassified | 596 |
| 327 | Ga0439458_0026772 | 3300042157 | Bacteria | 1358 |
| 328 | Ga0439464_0073500 | 3300042439 | Unclassified | 1014 |
| 329 | Ga0439464_0175770 | 3300042439 | Unclassified | 677 |
| 330 | Ga0439460_0088531 | 3300042461 | Unclassified | 981 |
| 331 | Ga0451576_0544346 | 3300045051 | Bacteria | 1220 |
| 332 | Ga0495592_0003064 | 3300046454 | Bacteria | 11922 |
| 333 | Ga0495590_0440988 | 3300046457 | Unclassified | 503 |
| 334 | Ga0495629_0330404 | 3300046459 | Bacteria | 1041 |
| 335 | Ga0495641_0300381 | 3300046461 | Bacteria | 724 |
| 336 | Ga0495651_0102300 | 3300046462 | Unclassified | 2131 |
| 337 | Ga0495651_0530203 | 3300046462 | Unclassified | 750 |
| 338 | Ga0495653_0058018 | 3300046463 | Unclassified | 2943 |
| 339 | Ga0495653_0479818 | 3300046463 | Bacteria | 778 |
| 340 | Ga0495580_0346851 | 3300046472 | Unclassified | 1006 |
| 341 | Ga0495662_0130069 | 3300046476 | Bacteria | 1237 |
| 342 | Ga0495664_0258654 | 3300046477 | Bacteria | 1052 |
| 343 | Ga0495664_0468872 | 3300046477 | Unclassified | 753 |
| 344 | Ga0495584_0191282 | 3300046491 | Unclassified | 1040 |
| 345 | Ga0495584_0269655 | 3300046491 | Unclassified | 865 |
| 346 | Ga0495585_0084862 | 3300046492 | Bacteria | 1712 |
| 347 | Ga0495616_0128811 | 3300046513 | Bacteria | 1162 |
| 348 | Ga0495618_0355333 | 3300046514 | Bacteria | 902 |
| 349 | Ga0495618_0676769 | 3300046514 | Unclassified | 608 |
| 350 | Ga0495628_0026105 | 3300046516 | Unclassified | 4768 |
| 351 | Ga0495628_0231301 | 3300046516 | Bacteria | 1386 |
| 352 | Ga0495630_0212501 | 3300046517 | Bacteria | 1476 |
| 353 | Ga0495630_0489225 | 3300046517 | Unclassified | 943 |
| 354 | Ga0495630_0797349 | 3300046517 | Bacteria | 721 |
| 355 | Ga0495630_1303654 | 3300046517 | Bacteria | 547 |
| 356 | Ga0495666_0054927 | 3300046526 | Bacteria | 1909 |
| 357 | Ga0495652_0128915 | 3300046529 | Bacteria | 2005 |
| 358 | Ga0495640_0239419 | 3300046533 | Bacteria | 1139 |
| 359 | Ga0495586_0615364 | 3300046535 | Unclassified | 627 |
| 360 | Ga0495587_0025896 | 3300046536 | Bacteria | 3580 |
| 361 | Ga0495598_0007957 | 3300046537 | Bacteria | 2452 |
| 362 | Ga0495621_0237999 | 3300046539 | Unclassified | 741 |
| 363 | Ga0495645_0011858 | 3300046543 | Bacteria | 6141 |
| 364 | Ga0495645_0122012 | 3300046543 | Unclassified | 1834 |
| 365 | Ga0495633_0296475 | 3300046558 | Bacteria | 735 |
| 366 | Ga0495667_0109439 | 3300046559 | Bacteria | 1785 |
| 367 | Ga0495667_0331650 | 3300046559 | Unclassified | 962 |
| 368 | Ga0495634_0558542 | 3300046642 | Unclassified | 667 |
| 369 | Ga0495625_0645648 | 3300046660 | Unclassified | 631 |
| 370 | Ga0495635_0265298 | 3300046663 | Bacteria | 1155 |
| 371 | Ga0495635_0349255 | 3300046663 | Unclassified | 987 |
| 372 | Ga0495659_0109039 | 3300046664 | Unclassified | 1079 |
| 373 | Ga0495588_0735736 | 3300046674 | Bacteria | 516 |
| 374 | Ga0495657_0672035 | 3300046675 | Unclassified | 596 |
| 375 | Ga0495599_0018090 | 3300046678 | Unclassified | 4388 |
| 376 | Ga0495623_0052654 | 3300046679 | Bacteria | 2571 |
| 377 | Ga0495646_0191907 | 3300046680 | Bacteria | 1116 |
| 378 | Ga0495646_0291000 | 3300046680 | Unclassified | 866 |
| 379 | Ga0495647_0138915 | 3300046681 | Unclassified | 1035 |
| 380 | Ga0495658_0479453 | 3300046683 | Bacteria | 795 |
| 381 | Ga0495669_0049659 | 3300046684 | Bacteria | 1879 |
| 382 | Ga0495669_0103324 | 3300046684 | Bacteria | 1325 |
| 383 | Ga0495669_0123394 | 3300046684 | Unclassified | 1215 |
| 384 | Ga0495589_0433605 | 3300046794 | Bacteria | 602 |
| 385 | Ga0495604_0178586 | 3300047317 | Bacteria | 1486 |
| 386 | Ga0495674_0071955 | 3300047319 | Bacteria | 2983 |
| 387 | Ga0495674_0219398 | 3300047319 | Bacteria | 1572 |
| 388 | Ga0495674_0311784 | 3300047319 | Bacteria | 1284 |
| 389 | Ga0495676_0254154 | 3300047321 | Bacteria | 1198 |
| 390 | Ga0495680_0194583 | 3300047322 | Bacteria | 1458 |
| 391 | Ga0495680_0360245 | 3300047322 | Unclassified | 1011 |
| 392 | Ga0495683_0444962 | 3300047323 | Bacteria | 532 |
| 393 | Ga0495675_0081308 | 3300047444 | Bacteria | 2040 |
| 394 | Ga0495675_0437039 | 3300047444 | Unclassified | 758 |
| 395 | Ga0495675_0446832 | 3300047444 | Unclassified | 748 |
| 396 | Ga0495684_0189391 | 3300047471 | Unclassified | 1522 |
| 397 | Ga0495684_0291120 | 3300047471 | Bacteria | 1175 |
| 398 | Ga0495602_0087719 | 3300048088 | Unclassified | 2592 |
| 399 | Ga0495602_0698851 | 3300048088 | Unclassified | 688 |
| 400 | Ga0496100_0480875 | 3300048903 | Bacteria | 955 |
| 401 | Ga0496100_0872269 | 3300048903 | Unclassified | 706 |
| 402 | Ga0496101_0548108 | 3300048904 | Bacteria | 914 |
| 403 | Ga0496102_0280947 | 3300048905 | Bacteria | 1569 |
| 404 | Ga0496102_0485399 | 3300048905 | Unclassified | 1157 |
| 405 | Ga0496102_0677251 | 3300048905 | Bacteria | 954 |
| 406 | Ga0496104_0062145 | 3300048907 | Bacteria | 3541 |
| 407 | Ga0496105_0379929 | 3300048908 | Bacteria | 1124 |
| 408 | Ga0496106_0260647 | 3300048909 | Unclassified | 1387 |
| 409 | Ga0496108_0007056 | 3300048911 | Bacteria | 9097 |
| 410 | Ga0496108_0136285 | 3300048911 | Bacteria | 2113 |
| 411 | Ga0496108_0655892 | 3300048911 | Bacteria | 912 |
| 412 | Ga0496109_1795545 | 3300048912 | Unclassified | 546 |
| 413 | Ga0496110_0109495 | 3300048913 | Bacteria | 2481 |
| 414 | Ga0496110_0135659 | 3300048913 | Bacteria | 2224 |
| 415 | Ga0496111_1186928 | 3300048914 | Unclassified | 541 |
| 416 | Ga0496111_1248891 | 3300048914 | Unclassified | 525 |
| 417 | Ga0496112_0392633 | 3300048915 | Bacteria | 1328 |
| 418 | Ga0496112_0394990 | 3300048915 | Unclassified | 1323 |
| 419 | Ga0496112_0556672 | 3300048915 | Bacteria | 1080 |
| 420 | Ga0496112_0625289 | 3300048915 | Bacteria | 1008 |
| 421 | Ga0496113_0685148 | 3300048916 | Bacteria | 819 |
| 422 | Ga0496114_0149117 | 3300048917 | Bacteria | 2029 |
| 423 | Ga0496115_0011972 | 3300048918 | Bacteria | 6518 |
| 424 | Ga0496115_0055307 | 3300048918 | Bacteria | 3188 |
| 425 | Ga0496115_0336747 | 3300048918 | Unclassified | 1232 |
| 426 | Ga0496115_0469740 | 3300048918 | Bacteria | 1014 |
| 427 | nmdc:mga05p37_1866607_c1 | 3300050507 | Unclassified | 576 |
| 428 | nmdc:mga05p37_407355_c1 | 3300050507 | Bacteria | 1586 |
| 429 | nmdc:mga05p37_635685_c1 | 3300050507 | Unclassified | 1198 |
| 430 | nmdc:mga05p37_71349_c1 | 3300050507 | Bacteria | 4272 |
| 431 | nmdc:mga08y16_901846_c1 | 3300050511 | Bacteria | 870 |
| 432 | nmdc:mga0n895_538531_c1 | 3300050512 | Bacteria | 1174 |
| 433 | nmdc:mga0n895_548488_c1 | 3300050512 | Bacteria | 1162 |
| 434 | nmdc:mga0n895_579459_c1 | 3300050512 | Unclassified | 1126 |
| 435 | nmdc:mga0rr50_1628155_c1 | 3300050513 | Unclassified | 545 |
| 436 | nmdc:mga0rr50_517576_c1 | 3300050513 | Bacteria | 1015 |
| 437 | nmdc:mga0rr50_517655_c1 | 3300050513 | Bacteria | 1015 |
| 438 | nmdc:mga08x19_1363495_c1 | 3300050514 | Bacteria | 502 |
| 439 | nmdc:mga08x19_29033_c1 | 3300050514 | Unclassified | 3468 |
| 440 | nmdc:mga0a205_331918_c1 | 3300050515 | Unclassified | 1390 |
| 441 | nmdc:mga0a205_456518_c1 | 3300050515 | Bacteria | 1137 |
| 442 | nmdc:mga0a205_532619_c1 | 3300050515 | Bacteria | 1030 |
| 443 | nmdc:mga0a205_894731_c1 | 3300050515 | Unclassified | 735 |
| 444 | Ga0495601_0233694 | 3300053077 | Bacteria | 1200 |
| 445 | Ga0495612_0026483 | 3300053078 | Bacteria | 2330 |
| 446 | Ga0495595_0260600 | 3300053084 | Bacteria | 869 |
| 447 | Ga0495619_0218110 | 3300053085 | Unclassified | 1321 |
| 448 | Ga0495619_0607822 | 3300053085 | Bacteria | 748 |
| 449 | Ga0587067_127459 | 3300059640 | Bacteria | 618 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005985 | Ga0081539_10090675 | Ga0081539_100906752 | 76 |
| 2 | 3300035170 | Ga0373943_0394930 | Ga0373943_0394930_207_440 | 76 |
| 3 | 3300005288 | Ga0065714_10198230 | Ga0065714_101982302 | 77 |
| 4 | 3300005290 | Ga0065712_10498800 | Ga0065712_104988002 | 77 |
| 5 | 3300005293 | Ga0065715_10593819 | Ga0065715_105938192 | 77 |
| 6 | 3300005328 | Ga0070676_10227638 | Ga0070676_102276383 | 77 |
| 7 | 3300005329 | Ga0070683_100598085 | Ga0070683_1005980853 | 77 |
| 8 | 3300005329 | Ga0070683_100854740 | Ga0070683_1008547402 | 77 |
| 9 | 3300005336 | Ga0070680_100680870 | Ga0070680_1006808702 | 77 |
| 10 | 3300005347 | Ga0070668_101305951 | Ga0070668_1013059511 | 77 |
| 11 | 3300005354 | Ga0070675_100176212 | Ga0070675_1001762123 | 77 |
| 12 | 3300005445 | Ga0070708_101327402 | Ga0070708_1013274022 | 77 |
| 13 | 3300005535 | Ga0070684_100975979 | Ga0070684_1009759792 | 77 |
| 14 | 3300005539 | Ga0068853_100440613 | Ga0068853_1004406133 | 77 |
| 15 | 3300005539 | Ga0068853_102434813 | Ga0068853_1024348132 | 77 |
| 16 | 3300005564 | Ga0070664_101125708 | Ga0070664_1011257083 | 77 |
| 17 | 3300005983 | Ga0081540_1294720 | Ga0081540_12947202 | 77 |
| 18 | 3300006163 | Ga0070715_10134239 | Ga0070715_101342391 | 77 |
| 19 | 3300006175 | Ga0070712_101999328 | Ga0070712_1019993281 | 77 |
| 20 | 3300006358 | Ga0068871_100440392 | Ga0068871_1004403923 | 77 |
| 21 | 3300006871 | Ga0075434_100627048 | Ga0075434_1006270482 | 77 |
| 22 | 3300009147 | Ga0114129_11520245 | Ga0114129_115202452 | 77 |
| 23 | 3300009553 | Ga0105249_13053651 | Ga0105249_130536511 | 77 |
| 24 | 3300011119 | Ga0105246_10233438 | Ga0105246_102334384 | 77 |
| 25 | 3300012498 | Ga0157345_1005848 | Ga0157345_10058482 | 77 |
| 26 | 3300012508 | Ga0157315_1004532 | Ga0157315_10045322 | 77 |
| 27 | 3300013102 | Ga0157371_10767544 | Ga0157371_107675442 | 77 |
| 28 | 3300013102 | Ga0157371_10969326 | Ga0157371_109693262 | 77 |
| 29 | 3300013296 | Ga0157374_10142065 | Ga0157374_101420654 | 77 |
| 30 | 3300013296 | Ga0157374_10703709 | Ga0157374_107037093 | 77 |
| 31 | 3300013296 | Ga0157374_12847166 | Ga0157374_128471661 | 77 |
| 32 | 3300013297 | Ga0157378_10122310 | Ga0157378_101223103 | 77 |
| 33 | 3300013297 | Ga0157378_10676410 | Ga0157378_106764102 | 77 |
| 34 | 3300013307 | Ga0157372_10016210 | Ga0157372_100162105 | 77 |
| 35 | 3300013307 | Ga0157372_10247746 | Ga0157372_102477462 | 77 |
| 36 | 3300013308 | Ga0157375_10039899 | Ga0157375_100398994 | 77 |
| 37 | 3300013308 | Ga0157375_13218418 | Ga0157375_132184181 | 77 |
| 38 | 3300014325 | Ga0163163_10888968 | Ga0163163_108889681 | 77 |
| 39 | 3300014325 | Ga0163163_11258350 | Ga0163163_112583502 | 77 |
| 40 | 3300014969 | Ga0157376_10372014 | Ga0157376_103720142 | 77 |
| 41 | 3300014969 | Ga0157376_12507578 | Ga0157376_125075781 | 77 |
| 42 | 3300017792 | Ga0163161_11477931 | Ga0163161_114779312 | 77 |
| 43 | 3300025315 | Ga0207697_10003691 | Ga0207697_100036912 | 77 |
| 44 | 3300025931 | Ga0207644_10087804 | Ga0207644_100878042 | 77 |
| 45 | 3300025933 | Ga0207706_11091487 | Ga0207706_110914872 | 77 |
| 46 | 3300025936 | Ga0207670_10769517 | Ga0207670_107695172 | 77 |
| 47 | 3300025941 | Ga0207711_10714212 | Ga0207711_107142121 | 77 |
| 48 | 3300025944 | Ga0207661_11491162 | Ga0207661_114911621 | 77 |
| 49 | 3300026121 | Ga0207683_10109673 | Ga0207683_101096733 | 77 |
| 50 | 3300035086 | Ga0373934_0063529 | Ga0373934_0063529_1141_1380 | 77 |
| 51 | 3300035089 | Ga0373944_0057681 | Ga0373944_0057681_788_1027 | 77 |
| 52 | 3300035113 | Ga0373936_0512653 | Ga0373936_0512653_34_276 | 77 |
| 53 | 3300035116 | Ga0373945_0154769 | Ga0373945_0154769_239_475 | 77 |
| 54 | 3300035116 | Ga0373945_0284923 | Ga0373945_0284923_64_300 | 77 |
| 55 | 3300035117 | Ga0373953_0183286 | Ga0373953_0183286_109_348 | 77 |
| 56 | 3300035118 | Ga0373954_0195817 | Ga0373954_0195817_695_934 | 77 |
| 57 | 3300035170 | Ga0373943_0312700 | Ga0373943_0312700_416_652 | 77 |
| 58 | 3300035171 | Ga0373946_0231295 | Ga0373946_0231295_403_639 | 77 |
| 59 | 3300035172 | Ga0373955_0176473 | Ga0373955_0176473_442_681 | 77 |
| 60 | 3300035691 | Ga0373931_0055092 | Ga0373931_0055092_1343_1579 | 77 |
| 61 | 3300035692 | Ga0373935_0055207 | Ga0373935_0055207_1114_1350 | 77 |
| 62 | 3300035692 | Ga0373935_0183915 | Ga0373935_0183915_413_652 | 77 |
| 63 | 3300035695 | Ga0373927_0866176 | Ga0373927_0866176_314_550 | 77 |
| 64 | 3300035724 | Ga0373933_0156110 | Ga0373933_0156110_946_1185 | 77 |
| 65 | 3300035725 | Ga0373947_0023777 | Ga0373947_0023777_1411_1653 | 77 |
| 66 | 3300035725 | Ga0373947_0245120 | Ga0373947_0245120_901_1137 | 77 |
| 67 | 3300035725 | Ga0373947_0347236 | Ga0373947_0347236_28_267 | 77 |
| 68 | 3300036401 | Ga0373937_0407867 | Ga0373937_0407867_334_573 | 77 |
| 69 | 3300036401 | Ga0373937_0674658 | Ga0373937_0674658_173_412 | 77 |
| 70 | 3300037068 | Ga0373925_0214857 | Ga0373925_0214857_1170_1406 | 77 |
| 71 | 3300037068 | Ga0373925_0337999 | Ga0373925_0337999_677_919 | 77 |
| 72 | 3300037068 | Ga0373925_0685962 | Ga0373925_0685962_469_708 | 77 |
| 73 | 3300037068 | Ga0373925_1064315 | Ga0373925_1064315_363_599 | 77 |
| 74 | 3300037418 | Ga0395900_0005020 | Ga0395900_0005020_4344_4586 | 77 |
| 75 | 3300038443 | Ga0395901_0101057 | Ga0395901_0101057_446_688 | 77 |
| 76 | 3300039437 | Ga0436365_1123849 | Ga0436365_1123849_108_341 | 77 |
| 77 | 3300042012 | Ga0439455_0026410 | Ga0439455_0026410_29_268 | 77 |
| 78 | 3300046454 | Ga0495592_0003064 | Ga0495592_0003064_1656_1895 | 77 |
| 79 | 3300046457 | Ga0495590_0440988 | Ga0495590_0440988_203_439 | 77 |
| 80 | 3300046459 | Ga0495629_0330404 | Ga0495629_0330404_484_723 | 77 |
| 81 | 3300046462 | Ga0495651_0102300 | Ga0495651_0102300_273_512 | 77 |
| 82 | 3300046463 | Ga0495653_0058018 | Ga0495653_0058018_1153_1392 | 77 |
| 83 | 3300046463 | Ga0495653_0479818 | Ga0495653_0479818_106_345 | 77 |
| 84 | 3300046472 | Ga0495580_0346851 | Ga0495580_0346851_68_304 | 77 |
| 85 | 3300046476 | Ga0495662_0130069 | Ga0495662_0130069_798_1037 | 77 |
| 86 | 3300046477 | Ga0495664_0258654 | Ga0495664_0258654_308_547 | 77 |
| 87 | 3300046491 | Ga0495584_0269655 | Ga0495584_0269655_55_291 | 77 |
| 88 | 3300046492 | Ga0495585_0084862 | Ga0495585_0084862_1004_1240 | 77 |
| 89 | 3300046513 | Ga0495616_0128811 | Ga0495616_0128811_767_1003 | 77 |
| 90 | 3300046514 | Ga0495618_0355333 | Ga0495618_0355333_417_656 | 77 |
| 91 | 3300046516 | Ga0495628_0026105 | Ga0495628_0026105_152_391 | 77 |
| 92 | 3300046517 | Ga0495630_0212501 | Ga0495630_0212501_1185_1424 | 77 |
| 93 | 3300046526 | Ga0495666_0054927 | Ga0495666_0054927_370_609 | 77 |
| 94 | 3300046529 | Ga0495652_0128915 | Ga0495652_0128915_726_965 | 77 |
| 95 | 3300046533 | Ga0495640_0239419 | Ga0495640_0239419_444_683 | 77 |
| 96 | 3300046535 | Ga0495586_0615364 | Ga0495586_0615364_111_350 | 77 |
| 97 | 3300046536 | Ga0495587_0025896 | Ga0495587_0025896_1811_2050 | 77 |
| 98 | 3300046537 | Ga0495598_0007957 | Ga0495598_0007957_1948_2184 | 77 |
| 99 | 3300046539 | Ga0495621_0237999 | Ga0495621_0237999_279_515 | 77 |
| 100 | 3300046543 | Ga0495645_0011858 | Ga0495645_0011858_4991_5230 | 77 |
| 101 | 3300046558 | Ga0495633_0296475 | Ga0495633_0296475_32_268 | 77 |
| 102 | 3300046559 | Ga0495667_0109439 | Ga0495667_0109439_559_798 | 77 |
| 103 | 3300046559 | Ga0495667_0331650 | Ga0495667_0331650_417_656 | 77 |
| 104 | 3300046660 | Ga0495625_0645648 | Ga0495625_0645648_114_350 | 77 |
| 105 | 3300046663 | Ga0495635_0265298 | Ga0495635_0265298_339_578 | 77 |
| 106 | 3300046664 | Ga0495659_0109039 | Ga0495659_0109039_499_735 | 77 |
| 107 | 3300046674 | Ga0495588_0735736 | Ga0495588_0735736_170_406 | 77 |
| 108 | 3300046675 | Ga0495657_0672035 | Ga0495657_0672035_133_372 | 77 |
| 109 | 3300046678 | Ga0495599_0018090 | Ga0495599_0018090_2278_2517 | 77 |
| 110 | 3300046679 | Ga0495623_0052654 | Ga0495623_0052654_1018_1257 | 77 |
| 111 | 3300046680 | Ga0495646_0191907 | Ga0495646_0191907_611_850 | 77 |
| 112 | 3300046683 | Ga0495658_0479453 | Ga0495658_0479453_375_614 | 77 |
| 113 | 3300046684 | Ga0495669_0049659 | Ga0495669_0049659_1048_1287 | 77 |
| 114 | 3300046684 | Ga0495669_0123394 | Ga0495669_0123394_563_799 | 77 |
| 115 | 3300046794 | Ga0495589_0433605 | Ga0495589_0433605_272_508 | 77 |
| 116 | 3300047317 | Ga0495604_0178586 | Ga0495604_0178586_356_595 | 77 |
| 117 | 3300047319 | Ga0495674_0071955 | Ga0495674_0071955_1485_1724 | 77 |
| 118 | 3300047319 | Ga0495674_0219398 | Ga0495674_0219398_123_362 | 77 |
| 119 | 3300047322 | Ga0495680_0360245 | Ga0495680_0360245_440_679 | 77 |
| 120 | 3300047323 | Ga0495683_0444962 | Ga0495683_0444962_61_297 | 77 |
| 121 | 3300047444 | Ga0495675_0437039 | Ga0495675_0437039_355_594 | 77 |
| 122 | 3300047444 | Ga0495675_0446832 | Ga0495675_0446832_252_491 | 77 |
| 123 | 3300047471 | Ga0495684_0291120 | Ga0495684_0291120_548_787 | 77 |
| 124 | 3300048088 | Ga0495602_0087719 | Ga0495602_0087719_849_1088 | 77 |
| 125 | 3300048088 | Ga0495602_0698851 | Ga0495602_0698851_387_626 | 77 |
| 126 | 3300048903 | Ga0496100_0480875 | Ga0496100_0480875_219_458 | 77 |
| 127 | 3300048903 | Ga0496100_0872269 | Ga0496100_0872269_31_267 | 77 |
| 128 | 3300048904 | Ga0496101_0548108 | Ga0496101_0548108_163_402 | 77 |
| 129 | 3300048905 | Ga0496102_0280947 | Ga0496102_0280947_101_340 | 77 |
| 130 | 3300048905 | Ga0496102_0485399 | Ga0496102_0485399_717_953 | 77 |
| 131 | 3300048905 | Ga0496102_0677251 | Ga0496102_0677251_157_396 | 77 |
| 132 | 3300048907 | Ga0496104_0062145 | Ga0496104_0062145_2075_2314 | 77 |
| 133 | 3300048908 | Ga0496105_0379929 | Ga0496105_0379929_34_273 | 77 |
| 134 | 3300048909 | Ga0496106_0260647 | Ga0496106_0260647_337_573 | 77 |
| 135 | 3300048911 | Ga0496108_0007056 | Ga0496108_0007056_2298_2537 | 77 |
| 136 | 3300048911 | Ga0496108_0655892 | Ga0496108_0655892_563_802 | 77 |
| 137 | 3300048912 | Ga0496109_1795545 | Ga0496109_1795545_217_456 | 77 |
| 138 | 3300048913 | Ga0496110_0135659 | Ga0496110_0135659_240_479 | 77 |
| 139 | 3300048915 | Ga0496112_0394990 | Ga0496112_0394990_600_839 | 77 |
| 140 | 3300048915 | Ga0496112_0556672 | Ga0496112_0556672_79_318 | 77 |
| 141 | 3300048918 | Ga0496115_0011972 | Ga0496115_0011972_1968_2207 | 77 |
| 142 | 3300048918 | Ga0496115_0055307 | Ga0496115_0055307_164_403 | 77 |
| 143 | 3300048918 | Ga0496115_0336747 | Ga0496115_0336747_445_681 | 77 |
| 144 | 3300050507 | nmdc:mga05p37_1866607_c1 | nmdc:mga05p37_1866607_c1_74_310 | 77 |
| 145 | 3300050512 | nmdc:mga0n895_538531_c1 | nmdc:mga0n895_538531_c1_731_967 | 77 |
| 146 | 3300050512 | nmdc:mga0n895_548488_c1 | nmdc:mga0n895_548488_c1_639_875 | 77 |
| 147 | 3300050513 | nmdc:mga0rr50_517655_c1 | nmdc:mga0rr50_517655_c1_502_738 | 77 |
| 148 | 3300050514 | nmdc:mga08x19_1363495_c1 | nmdc:mga08x19_1363495_c1_233_469 | 77 |
| 149 | 3300050515 | nmdc:mga0a205_456518_c1 | nmdc:mga0a205_456518_c1_470_706 | 77 |
| 150 | 3300053077 | Ga0495601_0233694 | Ga0495601_0233694_734_973 | 77 |
| 151 | 3300053078 | Ga0495612_0026483 | Ga0495612_0026483_1539_1778 | 77 |
| 152 | 3300053084 | Ga0495595_0260600 | Ga0495595_0260600_390_629 | 77 |
| 153 | 3300053085 | Ga0495619_0218110 | Ga0495619_0218110_404_643 | 77 |
| 154 | 2162886007 | SwRhRL2b_contig_3091812 | SwRhRL2b_0116.00007280 | 78 |
| 155 | 3300002126 | JGI24035J26624_1002606 | JGI24035J26624_10026063 | 78 |
| 156 | 3300003911 | JGI25405J52794_10002557 | JGI25405J52794_100025573 | 78 |
| 157 | 3300003911 | JGI25405J52794_10134608 | JGI25405J52794_101346081 | 78 |
| 158 | 3300005288 | Ga0065714_10239087 | Ga0065714_102390872 | 78 |
| 159 | 3300005289 | Ga0065704_10031597 | Ga0065704_100315972 | 78 |
| 160 | 3300005289 | Ga0065704_10083566 | Ga0065704_100835664 | 78 |
| 161 | 3300005290 | Ga0065712_10175636 | Ga0065712_101756362 | 78 |
| 162 | 3300005290 | Ga0065712_10208697 | Ga0065712_102086972 | 78 |
| 163 | 3300005290 | Ga0065712_10213629 | Ga0065712_102136292 | 78 |
| 164 | 3300005290 | Ga0065712_10339090 | Ga0065712_103390902 | 78 |
| 165 | 3300005293 | Ga0065715_10030536 | Ga0065715_100305363 | 78 |
| 166 | 3300005293 | Ga0065715_10116467 | Ga0065715_101164674 | 78 |
| 167 | 3300005293 | Ga0065715_10398975 | Ga0065715_103989752 | 78 |
| 168 | 3300005295 | Ga0065707_10039729 | Ga0065707_100397292 | 78 |
| 169 | 3300005295 | Ga0065707_10333507 | Ga0065707_103335072 | 78 |
| 170 | 3300005328 | Ga0070676_11176891 | Ga0070676_111768912 | 78 |
| 171 | 3300005329 | Ga0070683_100493402 | Ga0070683_1004934022 | 78 |
| 172 | 3300005330 | Ga0070690_100815371 | Ga0070690_1008153712 | 78 |
| 173 | 3300005331 | Ga0070670_100671047 | Ga0070670_1006710472 | 78 |
| 174 | 3300005338 | Ga0068868_100526507 | Ga0068868_1005265072 | 78 |
| 175 | 3300005338 | Ga0068868_100699539 | Ga0068868_1006995392 | 78 |
| 176 | 3300005339 | Ga0070660_100284724 | Ga0070660_1002847241 | 78 |
| 177 | 3300005339 | Ga0070660_101224421 | Ga0070660_1012244211 | 78 |
| 178 | 3300005340 | Ga0070689_100337638 | Ga0070689_1003376382 | 78 |
| 179 | 3300005343 | Ga0070687_100586548 | Ga0070687_1005865481 | 78 |
| 180 | 3300005345 | Ga0070692_10409651 | Ga0070692_104096512 | 78 |
| 181 | 3300005347 | Ga0070668_100054758 | Ga0070668_1000547582 | 78 |
| 182 | 3300005354 | Ga0070675_100006224 | Ga0070675_10000622413 | 78 |
| 183 | 3300005354 | Ga0070675_100299523 | Ga0070675_1002995233 | 78 |
| 184 | 3300005356 | Ga0070674_100098848 | Ga0070674_1000988483 | 78 |
| 185 | 3300005364 | Ga0070673_100627941 | Ga0070673_1006279411 | 78 |
| 186 | 3300005364 | Ga0070673_101271795 | Ga0070673_1012717953 | 78 |
| 187 | 3300005365 | Ga0070688_100184159 | Ga0070688_1001841592 | 78 |
| 188 | 3300005435 | Ga0070714_100511209 | Ga0070714_1005112092 | 78 |
| 189 | 3300005435 | Ga0070714_101398501 | Ga0070714_1013985012 | 78 |
| 190 | 3300005436 | Ga0070713_101510930 | Ga0070713_1015109302 | 78 |
| 191 | 3300005438 | Ga0070701_10110314 | Ga0070701_101103142 | 78 |
| 192 | 3300005439 | Ga0070711_100733570 | Ga0070711_1007335702 | 78 |
| 193 | 3300005439 | Ga0070711_101280476 | Ga0070711_1012804762 | 78 |
| 194 | 3300005440 | Ga0070705_100134537 | Ga0070705_1001345372 | 78 |
| 195 | 3300005440 | Ga0070705_101767471 | Ga0070705_1017674712 | 78 |
| 196 | 3300005441 | Ga0070700_100056848 | Ga0070700_1000568484 | 78 |
| 197 | 3300005445 | Ga0070708_100219987 | Ga0070708_1002199871 | 78 |
| 198 | 3300005457 | Ga0070662_100203354 | Ga0070662_1002033542 | 78 |
| 199 | 3300005466 | Ga0070685_10222815 | Ga0070685_102228152 | 78 |
| 200 | 3300005467 | Ga0070706_100514286 | Ga0070706_1005142862 | 78 |
| 201 | 3300005467 | Ga0070706_100619207 | Ga0070706_1006192072 | 78 |
| 202 | 3300005467 | Ga0070706_100623643 | Ga0070706_1006236432 | 78 |
| 203 | 3300005467 | Ga0070706_100759234 | Ga0070706_1007592341 | 78 |
| 204 | 3300005467 | Ga0070706_100825380 | Ga0070706_1008253802 | 78 |
| 205 | 3300005468 | Ga0070707_100014309 | Ga0070707_1000143091 | 78 |
| 206 | 3300005468 | Ga0070707_100154573 | Ga0070707_1001545733 | 78 |
| 207 | 3300005468 | Ga0070707_101677475 | Ga0070707_1016774752 | 78 |
| 208 | 3300005471 | Ga0070698_100029855 | Ga0070698_1000298554 | 78 |
| 209 | 3300005471 | Ga0070698_100136810 | Ga0070698_1001368103 | 78 |
| 210 | 3300005471 | Ga0070698_100316450 | Ga0070698_1003164502 | 78 |
| 211 | 3300005518 | Ga0070699_100245952 | Ga0070699_1002459522 | 78 |
| 212 | 3300005518 | Ga0070699_101054836 | Ga0070699_1010548361 | 78 |
| 213 | 3300005518 | Ga0070699_101073645 | Ga0070699_1010736452 | 78 |
| 214 | 3300005530 | Ga0070679_100390019 | Ga0070679_1003900192 | 78 |
| 215 | 3300005535 | Ga0070684_100040959 | Ga0070684_1000409594 | 78 |
| 216 | 3300005535 | Ga0070684_100412280 | Ga0070684_1004122802 | 78 |
| 217 | 3300005536 | Ga0070697_100029326 | Ga0070697_1000293263 | 78 |
| 218 | 3300005536 | Ga0070697_100316938 | Ga0070697_1003169382 | 78 |
| 219 | 3300005536 | Ga0070697_100428823 | Ga0070697_1004288232 | 78 |
| 220 | 3300005536 | Ga0070697_100732087 | Ga0070697_1007320872 | 78 |
| 221 | 3300005543 | Ga0070672_100431948 | Ga0070672_1004319482 | 78 |
| 222 | 3300005546 | Ga0070696_101247379 | Ga0070696_1012473792 | 78 |
| 223 | 3300005548 | Ga0070665_100231343 | Ga0070665_1002313432 | 78 |
| 224 | 3300005548 | Ga0070665_100531756 | Ga0070665_1005317561 | 78 |
| 225 | 3300005549 | Ga0070704_100002997 | Ga0070704_10000299713 | 78 |
| 226 | 3300005563 | Ga0068855_100869535 | Ga0068855_1008695353 | 78 |
| 227 | 3300005719 | Ga0068861_100245269 | Ga0068861_1002452692 | 78 |
| 228 | 3300005841 | Ga0068863_100065177 | Ga0068863_1000651774 | 78 |
| 229 | 3300005842 | Ga0068858_100243514 | Ga0068858_1002435142 | 78 |
| 230 | 3300005843 | Ga0068860_100046304 | Ga0068860_1000463043 | 78 |
| 231 | 3300005937 | Ga0081455_10027728 | Ga0081455_100277283 | 78 |
| 232 | 3300005937 | Ga0081455_10033517 | Ga0081455_100335174 | 78 |
| 233 | 3300005937 | Ga0081455_10066064 | Ga0081455_100660645 | 78 |
| 234 | 3300005983 | Ga0081540_1115352 | Ga0081540_11153522 | 78 |
| 235 | 3300005983 | Ga0081540_1158383 | Ga0081540_11583832 | 78 |
| 236 | 3300006028 | Ga0070717_10052827 | Ga0070717_100528272 | 78 |
| 237 | 3300006028 | Ga0070717_11381067 | Ga0070717_113810672 | 78 |
| 238 | 3300006028 | Ga0070717_11674957 | Ga0070717_116749571 | 78 |
| 239 | 3300006173 | Ga0070716_100157366 | Ga0070716_1001573663 | 78 |
| 240 | 3300006175 | Ga0070712_100340425 | Ga0070712_1003404252 | 78 |
| 241 | 3300006358 | Ga0068871_100292198 | Ga0068871_1002921982 | 78 |
| 242 | 3300006844 | Ga0075428_100493240 | Ga0075428_1004932403 | 78 |
| 243 | 3300006844 | Ga0075428_101563938 | Ga0075428_1015639381 | 78 |
| 244 | 3300006847 | Ga0075431_101521737 | Ga0075431_1015217372 | 78 |
| 245 | 3300006871 | Ga0075434_100440123 | Ga0075434_1004401233 | 78 |
| 246 | 3300006881 | Ga0068865_100531934 | Ga0068865_1005319343 | 78 |
| 247 | 3300006914 | Ga0075436_100034999 | Ga0075436_1000349992 | 78 |
| 248 | 3300006914 | Ga0075436_100450902 | Ga0075436_1004509021 | 78 |
| 249 | 3300007265 | Ga0099794_10120537 | Ga0099794_101205372 | 78 |
| 250 | 3300007265 | Ga0099794_10132288 | Ga0099794_101322882 | 78 |
| 251 | 3300007265 | Ga0099794_10468309 | Ga0099794_104683091 | 78 |
| 252 | 3300007788 | Ga0099795_10026214 | Ga0099795_100262142 | 78 |
| 253 | 3300009098 | Ga0105245_10086639 | Ga0105245_100866396 | 78 |
| 254 | 3300009098 | Ga0105245_11703175 | Ga0105245_117031751 | 78 |
| 255 | 3300009098 | Ga0105245_11936425 | Ga0105245_119364252 | 78 |
| 256 | 3300009098 | Ga0105245_12649762 | Ga0105245_126497622 | 78 |
| 257 | 3300009098 | Ga0105245_13018334 | Ga0105245_130183341 | 78 |
| 258 | 3300009098 | Ga0105245_13028831 | Ga0105245_130288311 | 78 |
| 259 | 3300009147 | Ga0114129_10006734 | Ga0114129_1000673411 | 78 |
| 260 | 3300009147 | Ga0114129_10568236 | Ga0114129_105682362 | 78 |
| 261 | 3300009148 | Ga0105243_10527635 | Ga0105243_105276352 | 78 |
| 262 | 3300009148 | Ga0105243_12822566 | Ga0105243_128225661 | 78 |
| 263 | 3300009176 | Ga0105242_10195527 | Ga0105242_101955271 | 78 |
| 264 | 3300009176 | Ga0105242_10810641 | Ga0105242_108106412 | 78 |
| 265 | 3300009176 | Ga0105242_11421808 | Ga0105242_114218082 | 78 |
| 266 | 3300009176 | Ga0105242_11994652 | Ga0105242_119946522 | 78 |
| 267 | 3300009177 | Ga0105248_11425707 | Ga0105248_114257072 | 78 |
| 268 | 3300009177 | Ga0105248_11721517 | Ga0105248_117215172 | 78 |
| 269 | 3300009545 | Ga0105237_10765724 | Ga0105237_107657242 | 78 |
| 270 | 3300009553 | Ga0105249_10078307 | Ga0105249_100783074 | 78 |
| 271 | 3300009553 | Ga0105249_10078509 | Ga0105249_100785093 | 78 |
| 272 | 3300009553 | Ga0105249_10309196 | Ga0105249_103091962 | 78 |
| 273 | 3300010159 | Ga0099796_10005068 | Ga0099796_100050685 | 78 |
| 274 | 3300010159 | Ga0099796_10139556 | Ga0099796_101395561 | 78 |
| 275 | 3300010375 | Ga0105239_10146127 | Ga0105239_101461274 | 78 |
| 276 | 3300010375 | Ga0105239_10430894 | Ga0105239_104308942 | 78 |
| 277 | 3300013105 | Ga0157369_10635669 | Ga0157369_106356691 | 78 |
| 278 | 3300013296 | Ga0157374_10260773 | Ga0157374_102607733 | 78 |
| 279 | 3300013296 | Ga0157374_10280613 | Ga0157374_102806132 | 78 |
| 280 | 3300013296 | Ga0157374_10556481 | Ga0157374_105564812 | 78 |
| 281 | 3300013296 | Ga0157374_11145023 | Ga0157374_111450232 | 78 |
| 282 | 3300013297 | Ga0157378_10017733 | Ga0157378_100177334 | 78 |
| 283 | 3300013297 | Ga0157378_10045457 | Ga0157378_100454576 | 78 |
| 284 | 3300013297 | Ga0157378_10519570 | Ga0157378_105195702 | 78 |
| 285 | 3300013306 | Ga0163162_10169749 | Ga0163162_101697492 | 78 |
| 286 | 3300013306 | Ga0163162_10960349 | Ga0163162_109603491 | 78 |
| 287 | 3300013307 | Ga0157372_10515038 | Ga0157372_105150383 | 78 |
| 288 | 3300013308 | Ga0157375_10050583 | Ga0157375_100505833 | 78 |
| 289 | 3300013308 | Ga0157375_13220902 | Ga0157375_132209021 | 78 |
| 290 | 3300014745 | Ga0157377_10112400 | Ga0157377_101124001 | 78 |
| 291 | 3300014745 | Ga0157377_10195707 | Ga0157377_101957072 | 78 |
| 292 | 3300014968 | Ga0157379_10295126 | Ga0157379_102951263 | 78 |
| 293 | 3300014969 | Ga0157376_11439896 | Ga0157376_114398962 | 78 |
| 294 | 3300017792 | Ga0163161_10848202 | Ga0163161_108482023 | 78 |
| 295 | 3300017792 | Ga0163161_11355567 | Ga0163161_113555671 | 78 |
| 296 | 3300025271 | Ga0207666_1001307 | Ga0207666_10013074 | 78 |
| 297 | 3300025271 | Ga0207666_1015481 | Ga0207666_10154812 | 78 |
| 298 | 3300025290 | Ga0207673_1003036 | Ga0207673_10030363 | 78 |
| 299 | 3300025315 | Ga0207697_10019321 | Ga0207697_100193213 | 78 |
| 300 | 3300025315 | Ga0207697_10024938 | Ga0207697_100249383 | 78 |
| 301 | 3300025315 | Ga0207697_10147220 | Ga0207697_101472203 | 78 |
| 302 | 3300025315 | Ga0207697_10189109 | Ga0207697_101891092 | 78 |
| 303 | 3300025315 | Ga0207697_10256769 | Ga0207697_102567691 | 78 |
| 304 | 3300025885 | Ga0207653_10031133 | Ga0207653_100311332 | 78 |
| 305 | 3300025898 | Ga0207692_10591864 | Ga0207692_105918642 | 78 |
| 306 | 3300025898 | Ga0207692_11008141 | Ga0207692_110081411 | 78 |
| 307 | 3300025898 | Ga0207692_11137278 | Ga0207692_111372782 | 78 |
| 308 | 3300025904 | Ga0207647_10117115 | Ga0207647_101171152 | 78 |
| 309 | 3300025904 | Ga0207647_10138863 | Ga0207647_101388632 | 78 |
| 310 | 3300025910 | Ga0207684_10010154 | Ga0207684_100101546 | 78 |
| 311 | 3300025910 | Ga0207684_10027669 | Ga0207684_100276692 | 78 |
| 312 | 3300025910 | Ga0207684_10062978 | Ga0207684_100629782 | 78 |
| 313 | 3300025915 | Ga0207693_10205518 | Ga0207693_102055183 | 78 |
| 314 | 3300025915 | Ga0207693_10296141 | Ga0207693_102961412 | 78 |
| 315 | 3300025915 | Ga0207693_11095517 | Ga0207693_110955172 | 78 |
| 316 | 3300025916 | Ga0207663_10064242 | Ga0207663_100642422 | 78 |
| 317 | 3300025916 | Ga0207663_11102012 | Ga0207663_111020121 | 78 |
| 318 | 3300025918 | Ga0207662_10094084 | Ga0207662_100940842 | 78 |
| 319 | 3300025918 | Ga0207662_10270029 | Ga0207662_102700292 | 78 |
| 320 | 3300025919 | Ga0207657_10023722 | Ga0207657_100237228 | 78 |
| 321 | 3300025921 | Ga0207652_10306238 | Ga0207652_103062382 | 78 |
| 322 | 3300025922 | Ga0207646_10443897 | Ga0207646_104438973 | 78 |
| 323 | 3300025922 | Ga0207646_10576228 | Ga0207646_105762282 | 78 |
| 324 | 3300025922 | Ga0207646_11055414 | Ga0207646_110554142 | 78 |
| 325 | 3300025922 | Ga0207646_11190607 | Ga0207646_111906072 | 78 |
| 326 | 3300025926 | Ga0207659_10227612 | Ga0207659_102276122 | 78 |
| 327 | 3300025926 | Ga0207659_10294336 | Ga0207659_102943362 | 78 |
| 328 | 3300025927 | Ga0207687_11554001 | Ga0207687_115540012 | 78 |
| 329 | 3300025928 | Ga0207700_11716914 | Ga0207700_117169141 | 78 |
| 330 | 3300025932 | Ga0207690_10138803 | Ga0207690_101388033 | 78 |
| 331 | 3300025933 | Ga0207706_10065598 | Ga0207706_100655983 | 78 |
| 332 | 3300025933 | Ga0207706_10161352 | Ga0207706_101613522 | 78 |
| 333 | 3300025933 | Ga0207706_10435772 | Ga0207706_104357723 | 78 |
| 334 | 3300025935 | Ga0207709_11045401 | Ga0207709_110454012 | 78 |
| 335 | 3300025936 | Ga0207670_10245867 | Ga0207670_102458673 | 78 |
| 336 | 3300025938 | Ga0207704_10585989 | Ga0207704_105859892 | 78 |
| 337 | 3300025939 | Ga0207665_10217376 | Ga0207665_102173763 | 78 |
| 338 | 3300025939 | Ga0207665_10895027 | Ga0207665_108950271 | 78 |
| 339 | 3300025939 | Ga0207665_11688831 | Ga0207665_116888312 | 78 |
| 340 | 3300025940 | Ga0207691_10169221 | Ga0207691_101692212 | 78 |
| 341 | 3300025942 | Ga0207689_10047568 | Ga0207689_100475682 | 78 |
| 342 | 3300025944 | Ga0207661_10132785 | Ga0207661_101327852 | 78 |
| 343 | 3300025945 | Ga0207679_10884698 | Ga0207679_108846982 | 78 |
| 344 | 3300025949 | Ga0207667_11545884 | Ga0207667_115458842 | 78 |
| 345 | 3300025961 | Ga0207712_10081794 | Ga0207712_100817944 | 78 |
| 346 | 3300025961 | Ga0207712_11117432 | Ga0207712_111174321 | 78 |
| 347 | 3300025972 | Ga0207668_10132376 | Ga0207668_101323762 | 78 |
| 348 | 3300025972 | Ga0207668_11704885 | Ga0207668_117048852 | 78 |
| 349 | 3300025986 | Ga0207658_10272333 | Ga0207658_102723332 | 78 |
| 350 | 3300025986 | Ga0207658_11238511 | Ga0207658_112385112 | 78 |
| 351 | 3300026023 | Ga0207677_10202731 | Ga0207677_102027313 | 78 |
| 352 | 3300026035 | Ga0207703_10336759 | Ga0207703_103367592 | 78 |
| 353 | 3300026067 | Ga0207678_10763892 | Ga0207678_107638922 | 78 |
| 354 | 3300026075 | Ga0207708_10112133 | Ga0207708_101121332 | 78 |
| 355 | 3300026088 | Ga0207641_10328786 | Ga0207641_103287862 | 78 |
| 356 | 3300026088 | Ga0207641_12116724 | Ga0207641_121167241 | 78 |
| 357 | 3300026095 | Ga0207676_11621383 | Ga0207676_116213832 | 78 |
| 358 | 3300026118 | Ga0207675_100389387 | Ga0207675_1003893873 | 78 |
| 359 | 3300026121 | Ga0207683_11366542 | Ga0207683_113665422 | 78 |
| 360 | 3300027617 | Ga0210002_1019115 | Ga0210002_10191152 | 78 |
| 361 | 3300027671 | Ga0209588_1190195 | Ga0209588_11901952 | 78 |
| 362 | 3300027682 | Ga0209971_1079852 | Ga0209971_10798521 | 78 |
| 363 | 3300027717 | Ga0209998_10003228 | Ga0209998_100032283 | 78 |
| 364 | 3300027876 | Ga0209974_10013786 | Ga0209974_100137863 | 78 |
| 365 | 3300028379 | Ga0268266_10660362 | Ga0268266_106603622 | 78 |
| 366 | 3300028381 | Ga0268264_10564247 | Ga0268264_105642472 | 78 |
| 367 | 3300028381 | Ga0268264_12326514 | Ga0268264_123265141 | 78 |
| 368 | 3300035083 | Ga0373926_0140302 | Ga0373926_0140302_423_659 | 78 |
| 369 | 3300035111 | Ga0373923_0182490 | Ga0373923_0182490_503_739 | 78 |
| 370 | 3300035113 | Ga0373936_0523727 | Ga0373936_0523727_235_471 | 78 |
| 371 | 3300035113 | Ga0373936_0602689 | Ga0373936_0602689_256_492 | 78 |
| 372 | 3300035114 | Ga0373939_0085882 | Ga0373939_0085882_26_262 | 78 |
| 373 | 3300035116 | Ga0373945_0400520 | Ga0373945_0400520_295_531 | 78 |
| 374 | 3300035119 | Ga0373956_0184846 | Ga0373956_0184846_17_253 | 78 |
| 375 | 3300035170 | Ga0373943_0259056 | Ga0373943_0259056_218_454 | 78 |
| 376 | 3300035171 | Ga0373946_0060719 | Ga0373946_0060719_182_418 | 78 |
| 377 | 3300035171 | Ga0373946_0360962 | Ga0373946_0360962_27_263 | 78 |
| 378 | 3300035172 | Ga0373955_0127974 | Ga0373955_0127974_56_292 | 78 |
| 379 | 3300035691 | Ga0373931_0460923 | Ga0373931_0460923_426_674 | 78 |
| 380 | 3300035692 | Ga0373935_0036165 | Ga0373935_0036165_2705_2941 | 78 |
| 381 | 3300035692 | Ga0373935_0727032 | Ga0373935_0727032_399_635 | 78 |
| 382 | 3300035695 | Ga0373927_0480317 | Ga0373927_0480317_491_727 | 78 |
| 383 | 3300035724 | Ga0373933_0263728 | Ga0373933_0263728_117_353 | 78 |
| 384 | 3300035725 | Ga0373947_0961100 | Ga0373947_0961100_258_494 | 78 |
| 385 | 3300035725 | Ga0373947_1226759 | Ga0373947_1226759_210_446 | 78 |
| 386 | 3300036401 | Ga0373937_0051503 | Ga0373937_0051503_3183_3419 | 78 |
| 387 | 3300036401 | Ga0373937_0850634 | Ga0373937_0850634_329_577 | 78 |
| 388 | 3300037068 | Ga0373925_0215732 | Ga0373925_0215732_1165_1407 | 78 |
| 389 | 3300037068 | Ga0373925_1344555 | Ga0373925_1344555_20_256 | 78 |
| 390 | 3300037418 | Ga0395900_0102768 | Ga0395900_0102768_2122_2364 | 78 |
| 391 | 3300037418 | Ga0395900_0732166 | Ga0395900_0732166_534_782 | 78 |
| 392 | 3300037471 | Ga0395905_1791101 | Ga0395905_1791101_134_382 | 78 |
| 393 | 3300038443 | Ga0395901_0267590 | Ga0395901_0267590_68_316 | 78 |
| 394 | 3300038443 | Ga0395901_0846490 | Ga0395901_0846490_88_330 | 78 |
| 395 | 3300039450 | Ga0436363_1252962 | Ga0436363_1252962_425_664 | 78 |
| 396 | 3300039453 | Ga0436362_0358886 | Ga0436362_0358886_258_497 | 78 |
| 397 | 3300042005 | Ga0439448_0059937 | Ga0439448_0059937_222_464 | 78 |
| 398 | 3300042005 | Ga0439448_0123381 | Ga0439448_0123381_218_466 | 78 |
| 399 | 3300042008 | Ga0439450_040912 | Ga0439450_040912_693_941 | 78 |
| 400 | 3300042012 | Ga0439455_0002349 | Ga0439455_0002349_2081_2323 | 78 |
| 401 | 3300042012 | Ga0439455_0162433 | Ga0439455_0162433_346_594 | 78 |
| 402 | 3300042012 | Ga0439455_0187558 | Ga0439455_0187558_67_315 | 78 |
| 403 | 3300042157 | Ga0439458_0026772 | Ga0439458_0026772_271_513 | 78 |
| 404 | 3300042439 | Ga0439464_0073500 | Ga0439464_0073500_327_569 | 78 |
| 405 | 3300042439 | Ga0439464_0175770 | Ga0439464_0175770_113_355 | 78 |
| 406 | 3300042461 | Ga0439460_0088531 | Ga0439460_0088531_538_780 | 78 |
| 407 | 3300045051 | Ga0451576_0544346 | Ga0451576_0544346_904_1146 | 78 |
| 408 | 3300046461 | Ga0495641_0300381 | Ga0495641_0300381_256_504 | 78 |
| 409 | 3300046462 | Ga0495651_0530203 | Ga0495651_0530203_397_633 | 78 |
| 410 | 3300046477 | Ga0495664_0468872 | Ga0495664_0468872_502_738 | 78 |
| 411 | 3300046491 | Ga0495584_0191282 | Ga0495584_0191282_523_759 | 78 |
| 412 | 3300046514 | Ga0495618_0676769 | Ga0495618_0676769_250_486 | 78 |
| 413 | 3300046516 | Ga0495628_0231301 | Ga0495628_0231301_246_482 | 78 |
| 414 | 3300046517 | Ga0495630_0489225 | Ga0495630_0489225_191_427 | 78 |
| 415 | 3300046517 | Ga0495630_0797349 | Ga0495630_0797349_319_567 | 78 |
| 416 | 3300046517 | Ga0495630_1303654 | Ga0495630_1303654_30_278 | 78 |
| 417 | 3300046543 | Ga0495645_0122012 | Ga0495645_0122012_473_709 | 78 |
| 418 | 3300046642 | Ga0495634_0558542 | Ga0495634_0558542_378_614 | 78 |
| 419 | 3300046663 | Ga0495635_0349255 | Ga0495635_0349255_728_964 | 78 |
| 420 | 3300046680 | Ga0495646_0291000 | Ga0495646_0291000_122_358 | 78 |
| 421 | 3300046681 | Ga0495647_0138915 | Ga0495647_0138915_549_797 | 78 |
| 422 | 3300046684 | Ga0495669_0103324 | Ga0495669_0103324_681_929 | 78 |
| 423 | 3300047319 | Ga0495674_0311784 | Ga0495674_0311784_147_395 | 78 |
| 424 | 3300047321 | Ga0495676_0254154 | Ga0495676_0254154_127_375 | 78 |
| 425 | 3300047322 | Ga0495680_0194583 | Ga0495680_0194583_144_392 | 78 |
| 426 | 3300047444 | Ga0495675_0081308 | Ga0495675_0081308_792_1028 | 78 |
| 427 | 3300047471 | Ga0495684_0189391 | Ga0495684_0189391_118_354 | 78 |
| 428 | 3300048911 | Ga0496108_0136285 | Ga0496108_0136285_1034_1276 | 78 |
| 429 | 3300048913 | Ga0496110_0109495 | Ga0496110_0109495_1014_1256 | 78 |
| 430 | 3300048914 | Ga0496111_1186928 | Ga0496111_1186928_49_285 | 78 |
| 431 | 3300048914 | Ga0496111_1248891 | Ga0496111_1248891_110_352 | 78 |
| 432 | 3300048915 | Ga0496112_0392633 | Ga0496112_0392633_732_974 | 78 |
| 433 | 3300048915 | Ga0496112_0625289 | Ga0496112_0625289_565_801 | 78 |
| 434 | 3300048916 | Ga0496113_0685148 | Ga0496113_0685148_545_793 | 78 |
| 435 | 3300048917 | Ga0496114_0149117 | Ga0496114_0149117_1708_1956 | 78 |
| 436 | 3300048918 | Ga0496115_0469740 | Ga0496115_0469740_54_296 | 78 |
| 437 | 3300050507 | nmdc:mga05p37_407355_c1 | nmdc:mga05p37_407355_c1_707_943 | 78 |
| 438 | 3300050507 | nmdc:mga05p37_635685_c1 | nmdc:mga05p37_635685_c1_378_614 | 78 |
| 439 | 3300050507 | nmdc:mga05p37_71349_c1 | nmdc:mga05p37_71349_c1_298_546 | 78 |
| 440 | 3300050511 | nmdc:mga08y16_901846_c1 | nmdc:mga08y16_901846_c1_120_356 | 78 |
| 441 | 3300050512 | nmdc:mga0n895_579459_c1 | nmdc:mga0n895_579459_c1_475_723 | 78 |
| 442 | 3300050513 | nmdc:mga0rr50_1628155_c1 | nmdc:mga0rr50_1628155_c1_202_441 | 78 |
| 443 | 3300050513 | nmdc:mga0rr50_517576_c1 | nmdc:mga0rr50_517576_c1_68_304 | 78 |
| 444 | 3300050514 | nmdc:mga08x19_29033_c1 | nmdc:mga08x19_29033_c1_676_915 | 78 |
| 445 | 3300050515 | nmdc:mga0a205_331918_c1 | nmdc:mga0a205_331918_c1_604_852 | 78 |
| 446 | 3300050515 | nmdc:mga0a205_532619_c1 | nmdc:mga0a205_532619_c1_590_826 | 78 |
| 447 | 3300050515 | nmdc:mga0a205_894731_c1 | nmdc:mga0a205_894731_c1_130_366 | 78 |
| 448 | 3300053085 | Ga0495619_0607822 | Ga0495619_0607822_188_436 | 78 |
| 449 | 3300059640 | Ga0587067_127459 | Ga0587067_127459_288_524 | 78 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4my6-assembly1.cif.gz_A | enah-evh1 in complex with peptidomimetic low-molecular weight inhibitor ac-[2-cl-f]-[prom-2]-[prom-1]-oh | 0.637 | 21 | 41 |
| 1qvi-assembly1.cif.gz_A | crystal structure of scallop myosin s1 in the pre-power stroke state to 2.6 angstrom resolution: flexibility and function in the head | 0.5759 | 22 | 75 |
| 2otg-assembly1.cif.gz_A | rigor-like structures of muscle myosins reveal key mechanical elements in the transduction pathways of this allosteric motor | 0.5667 | 22 | 75 |
| 5t45-assembly1.cif.gz_A | chicken smooth muscle myosin motor domain co-crystallized with the specific ck-571 inhibitor, mgadp.befx form | 0.5545 | 22 | 72 |
| 4a4e-assembly1.cif.gz_A | solution structure of smn tudor domain in complex with symmetrically dimethylated arginine | 0.5506 | 23 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dnhA01 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.6825 | 21 | 37 | 2.30.110.10 |
| af_A0A2R8Q3W9_2_100_2.60.40.150 | Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain | 0.6099 | 21 | 42 | 2.60.40.150 |
| af_Q4V9I6_60_182_2.40.10.10 | Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases | 0.5919 | 19 | 37 | 2.40.10.10 |
| af_Q9VWS8_303_353_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.5828 | 23 | 73 | 2.30.30.140 |
| af_Q5VSI4_773_839_2.40.50.90 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); | 0.5792 | 23 | 78 | 2.40.50.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1MTU6-F1-model_v4 | Uncharacterized protein | 0.9726 | 21 | 76 |
|
| AF-A0A2V5UIB6-F1-model_v4 | Uncharacterized protein | 0.949 | 14 | 78 |
|
| AF-A0A7Z1ZC26-F1-model_v4 | deleted | 0.9464 | 22 | 76 |
|
| AF-A0A127EY42-F1-model_v4 | Zinc finger CHCC-type domain-containing protein | 0.9443 | 22 | 75 |
|
| AF-A0A1Y5SZA3-F1-model_v4 | Uncharacterized protein | 0.9429 | 22 | 74 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar