F446388

General Info

Members Datasets Scaffolds Average Seq Length
449 278 898 262

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10253175|Ga0157380_102531752
Length 275
Sequence MTTPTRAILIEEMAMKTSSPSIFRPEGGVDQGALKEHKALIEEIDRRKILRGAVSLGALTMLTGCNVTHTDAVQSVLKRISQFNDKVQELMFRPNHLAPTFSESQVVKPPRFNAYYDIEDIAPVDVAKWKLELVGKIKDKRSWTAHQIYSLPEQEWIIRHICVEGWDYIGQWSGVNLREFLKRIGADLTAKYVSFRCADDYYGSIDMATALHPQTILATKYAKEPITDPFGFPLRLRTATKLGFKNPKWITEIEVTNEYRGGYWEDRGFNWFSGI

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
197 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
241 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
258 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
259 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
273 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
278 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.24
Nodule 0
Rhizoplane 10.47
Rhizosphere 79.96
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10253175 3300014326 Bacteria 1595
2 JGI24743J22301_10044172 3300001991 Bacteria 899
3 JGI24033J26618_1008716 3300002155 Bacteria 1172
4 JGI24034J26672_10004400 3300002239 Bacteria 1995
5 JGI24751J29686_10015050 3300002459 Bacteria 1596
6 Ga0055531_10008530 3300003794 Bacteria 5381
7 Ga0065712_10185826 3300005290 Bacteria 1166
8 Ga0070658_10305024 3300005327 Bacteria 1358
9 Ga0070670_100076567 3300005331 Bacteria 2874
10 Ga0070670_100259490 3300005331 Bacteria 1515
11 Ga0068869_100060795 3300005334 Bacteria 2769
12 Ga0068869_100082940 3300005334 Bacteria 2397
13 Ga0070666_10225717 3300005335 Bacteria 1322
14 Ga0070680_100035194 3300005336 Bacteria 4042
15 Ga0070682_100113658 3300005337 Bacteria 1808
16 Ga0068868_100055644 3300005338 Bacteria 3122
17 Ga0070660_100125402 3300005339 Bacteria 2051
18 Ga0070689_100046494 3300005340 Bacteria 3345
19 Ga0070689_100092408 3300005340 Bacteria 2386
20 Ga0070689_100407579 3300005340 Bacteria 1150
21 Ga0070668_100190866 3300005347 Bacteria 1678
22 Ga0070675_100040825 3300005354 Bacteria 3789
23 Ga0070675_100395470 3300005354 Bacteria 1232
24 Ga0070671_100083692 3300005355 Bacteria 2668
25 Ga0070671_100353526 3300005355 Bacteria 1254
26 Ga0070674_100307763 3300005356 Bacteria 1265
27 Ga0070674_100563630 3300005356 Bacteria 957
28 Ga0070673_100520925 3300005364 Bacteria 1077
29 Ga0070688_100009549 3300005365 Bacteria 5313
30 Ga0070688_100014350 3300005365 Bacteria 4487
31 Ga0070667_100052973 3300005367 Bacteria 3424
32 Ga0070703_10002576 3300005406 Bacteria 5228
33 Ga0070701_10179063 3300005438 Bacteria 1239
34 Ga0070711_100027762 3300005439 Bacteria 3719
35 Ga0070711_100037885 3300005439 Bacteria 3238
36 Ga0070705_100000687 3300005440 Bacteria 19392
37 Ga0070700_100000805 3300005441 Bacteria 15391
38 Ga0070694_100000380 3300005444 Bacteria 23966
39 Ga0070708_100006255 3300005445 Bacteria 9469
40 Ga0070663_100013529 3300005455 Bacteria 5208
41 Ga0070662_100049781 3300005457 Bacteria 3022
42 Ga0070681_10590418 3300005458 Bacteria 1025
43 Ga0068867_100083693 3300005459 Bacteria 2409
44 Ga0070685_10036704 3300005466 Bacteria 2771
45 Ga0070685_10042229 3300005466 Bacteria 2601
46 Ga0070685_10049729 3300005466 Bacteria 2419
47 Ga0070706_100707325 3300005467 Bacteria 934
48 Ga0070699_100001676 3300005518 Bacteria 20190
49 Ga0070679_100116480 3300005530 Bacteria 2657
50 Ga0070679_100247027 3300005530 Bacteria 1741
51 Ga0070697_100026956 3300005536 Bacteria 4595
52 Ga0070697_100079088 3300005536 Bacteria 2706
53 Ga0070672_100303597 3300005543 Bacteria 1354
54 Ga0070686_100026152 3300005544 Bacteria 3519
55 Ga0070686_100292928 3300005544 Bacteria 1204
56 Ga0070696_100000968 3300005546 Bacteria 18607
57 Ga0070693_100010855 3300005547 Bacteria 4573
58 Ga0070693_100156198 3300005547 Bacteria 1449
59 Ga0070704_100003987 3300005549 Bacteria 8514
60 Ga0070704_100034067 3300005549 Bacteria 3450
61 Ga0070664_100036935 3300005564 Bacteria 4105
62 Ga0068857_100025978 3300005577 Bacteria 5158
63 Ga0068854_100289428 3300005578 Bacteria 1321
64 Ga0068856_100066305 3300005614 Bacteria 3568
65 Ga0068856_100100171 3300005614 Bacteria 2889
66 Ga0070702_100007251 3300005615 Bacteria 5301
67 Ga0070702_100024669 3300005615 Bacteria 3211
68 Ga0068859_100002996 3300005617 Bacteria 17128
69 Ga0068859_100023700 3300005617 Bacteria 6160
70 Ga0068864_100005603 3300005618 Bacteria 10294
71 Ga0068864_100063192 3300005618 Bacteria 3208
72 Ga0068864_100533895 3300005618 Bacteria 1132
73 Ga0068866_10224891 3300005718 Bacteria 1134
74 Ga0068861_100126925 3300005719 Bacteria 2065
75 Ga0068851_10056624 3300005834 Bacteria 2000
76 Ga0068870_10012992 3300005840 Bacteria 3902
77 Ga0068863_100095417 3300005841 Bacteria 2823
78 Ga0068858_100075410 3300005842 Bacteria 3133
79 Ga0068858_100152086 3300005842 Bacteria 2176
80 Ga0068860_100005664 3300005843 Bacteria 12615
81 Ga0068860_100282412 3300005843 Unclassified 1623
82 Ga0068860_100674385 3300005843 Bacteria 1042
83 Ga0068862_100002411 3300005844 Bacteria 16598
84 Ga0068862_100043360 3300005844 Bacteria 3835
85 Ga0068862_100146410 3300005844 Bacteria 2099
86 Ga0081455_10008807 3300005937 Bacteria 10442
87 Ga0081455_10068629 3300005937 Bacteria 2950
88 Ga0081540_1037386 3300005983 Bacteria 2574
89 Ga0081539_10000118 3300005985 Bacteria 184562
90 Ga0081539_10002228 3300005985 Bacteria 28275
91 Ga0070717_10142816 3300006028 Bacteria 2066
92 Ga0075365_10077102 3300006038 Bacteria 2251
93 Ga0075365_10238411 3300006038 Bacteria 1277
94 Ga0075368_10001704 3300006042 Bacteria 7063
95 Ga0075368_10183593 3300006042 Bacteria 882
96 Ga0075363_100025528 3300006048 Bacteria 3015
97 Ga0075363_100139150 3300006048 Bacteria 1366
98 Ga0075364_10272686 3300006051 Bacteria 1151
99 Ga0075364_10450840 3300006051 Bacteria 879
100 Ga0075364_10479576 3300006051 Bacteria 850
101 Ga0070712_100001927 3300006175 Bacteria 12698
102 Ga0070712_100008082 3300006175 Bacteria 6603
103 Ga0070712_100535316 3300006175 Bacteria 985
104 Ga0075362_10003501 3300006177 Bacteria 5508
105 Ga0075362_10076984 3300006177 Bacteria 1532
106 Ga0075362_10186605 3300006177 Bacteria 1006
107 Ga0075367_10004092 3300006178 Bacteria 7063
108 Ga0075367_10124194 3300006178 Unclassified 1592
109 Ga0075366_10003158 3300006195 Bacteria 8627
110 Ga0097621_100116561 3300006237 Bacteria 2262
111 Ga0097621_100120633 3300006237 Bacteria 2224
112 Ga0068871_100213143 3300006358 Bacteria 1671
113 Ga0068871_100601377 3300006358 Bacteria 1000
114 Ga0075430_100000152 3300006846 Bacteria 44881
115 Ga0075431_100000874 3300006847 Bacteria 26476
116 Ga0075431_100001126 3300006847 Bacteria 23957
117 Ga0075433_10008785 3300006852 Bacteria 8062
118 Ga0075433_10022540 3300006852 Bacteria 5287
119 Ga0075434_100003531 3300006871 Bacteria 13958
120 Ga0075434_100040543 3300006871 Bacteria 4611
121 Ga0075429_100044920 3300006880 Bacteria 3843
122 Ga0097620_100002996 3300006931 Bacteria 17128
123 Ga0097620_100023700 3300006931 Bacteria 6160
124 Ga0075435_100078117 3300007076 Bacteria 2714
125 Ga0099795_10001049 3300007788 Bacteria 5702
126 Ga0099795_10046335 3300007788 Bacteria 1566
127 Ga0099795_10068586 3300007788 Bacteria 1333
128 Ga0105251_10168816 3300009011 Bacteria 986
129 Ga0105250_10024689 3300009092 Bacteria 2421
130 Ga0111539_10018444 3300009094 Bacteria 8644
131 Ga0111539_10095258 3300009094 Bacteria 3497
132 Ga0111539_10161451 3300009094 Bacteria 2621
133 Ga0105245_10047205 3300009098 Bacteria 3849
134 Ga0105245_10272310 3300009098 Bacteria 1652
135 Ga0105247_10018273 3300009101 Bacteria 4206
136 Ga0105247_10032755 3300009101 Bacteria 3158
137 Ga0105247_10122905 3300009101 Bacteria 1684
138 Ga0114129_10628141 3300009147 Bacteria 1388
139 Ga0105243_10280192 3300009148 Bacteria 1501
140 Ga0105241_10224749 3300009174 Bacteria 1580
141 Ga0105237_10224570 3300009545 Bacteria 1878
142 Ga0105237_10891078 3300009545 Bacteria 897
143 Ga0105238_10007744 3300009551 Bacteria 10742
144 Ga0105238_10336165 3300009551 Bacteria 1498
145 Ga0105249_10020221 3300009553 Bacteria 5950
146 Ga0105249_10148166 3300009553 Bacteria 2257
147 Ga0105249_10490218 3300009553 Bacteria 1273
148 Ga0099796_10001304 3300010159 Bacteria 4935
149 Ga0099796_10027394 3300010159 Bacteria 1820
150 Ga0105239_10610881 3300010375 Bacteria 1244
151 Ga0105246_10635856 3300011119 Bacteria 927
152 Ga0157371_10290865 3300013102 Bacteria 1181
153 Ga0157374_10057114 3300013296 Bacteria 3645
154 Ga0157378_10251806 3300013297 Bacteria 1691
155 Ga0157372_10925935 3300013307 Bacteria 1011
156 Ga0157375_10249018 3300013308 Bacteria 1937
157 Ga0163163_10194694 3300014325 Bacteria 2075
158 Ga0157379_10278571 3300014968 Bacteria 1522
159 Ga0157379_10594718 3300014968 Bacteria 1032
160 Ga0157376_10062562 3300014969 Bacteria 3132
161 Ga0209233_1006839 3300025261 Bacteria 3646
162 Ga0209455_1000956 3300025272 Bacteria 14731
163 Ga0209758_1000223 3300025297 Bacteria 122584
164 Ga0209758_1024372 3300025297 Bacteria 2698
165 Ga0209050_1004929 3300025298 Bacteria 8716
166 Ga0209051_1022428 3300025303 Bacteria 2658
167 Ga0209257_1000311 3300025304 Bacteria 103263
168 Ga0207653_10005154 3300025885 Bacteria 4086
169 Ga0207710_10068697 3300025900 Bacteria 1621
170 Ga0207688_10002291 3300025901 Bacteria 10295
171 Ga0207688_10089327 3300025901 Bacteria 1768
172 Ga0207645_10031887 3300025907 Bacteria 3388
173 Ga0207643_10005254 3300025908 Bacteria 6925
174 Ga0207707_10019396 3300025912 Bacteria 5936
175 Ga0207693_10000484 3300025915 Bacteria 36109
176 Ga0207693_10008900 3300025915 Bacteria 8202
177 Ga0207693_10036286 3300025915 Bacteria 3886
178 Ga0207693_10076718 3300025915 Bacteria 2617
179 Ga0207693_10241404 3300025915 Bacteria 1418
180 Ga0207660_10001088 3300025917 Bacteria 18115
181 Ga0207662_10003397 3300025918 Bacteria 8187
182 Ga0207662_10022617 3300025918 Bacteria 3605
183 Ga0207662_10128542 3300025918 Bacteria 1595
184 Ga0207662_10364975 3300025918 Bacteria 972
185 Ga0207646_10598372 3300025922 Bacteria 990
186 Ga0207681_10489303 3300025923 Bacteria 1006
187 Ga0207659_10028336 3300025926 Bacteria 3805
188 Ga0207659_10142394 3300025926 Bacteria 1862
189 Ga0207659_10506597 3300025926 Bacteria 1022
190 Ga0207687_10407032 3300025927 Bacteria 1120
191 Ga0207700_10013231 3300025928 Bacteria 5359
192 Ga0207700_10130761 3300025928 Bacteria 2049
193 Ga0207700_10304082 3300025928 Bacteria 1378
194 Ga0207700_10547464 3300025928 Bacteria 1027
195 Ga0207700_10648244 3300025928 Bacteria 941
196 Ga0207644_10041302 3300025931 Bacteria 3262
197 Ga0207690_10144666 3300025932 Bacteria 1756
198 Ga0207706_10073321 3300025933 Bacteria 3010
199 Ga0207686_10251341 3300025934 Bacteria 1292
200 Ga0207686_10459436 3300025934 Bacteria 981
201 Ga0207704_10390238 3300025938 Bacteria 1095
202 Ga0207691_10015850 3300025940 Bacteria 7163
203 Ga0207691_10150527 3300025940 Unclassified 2046
204 Ga0207689_10009830 3300025942 Bacteria 8245
205 Ga0207689_10079894 3300025942 Bacteria 2688
206 Ga0207651_10012170 3300025960 Bacteria 4854
207 Ga0207712_10010596 3300025961 Bacteria 5853
208 Ga0207712_10142970 3300025961 Bacteria 1838
209 Ga0207712_10354191 3300025961 Bacteria 1221
210 Ga0207668_10161182 3300025972 Bacteria 1748
211 Ga0207640_10057722 3300025981 Bacteria 2554
212 Ga0207658_10040442 3300025986 Bacteria 3371
213 Ga0207703_10033525 3300026035 Bacteria 4072
214 Ga0207639_10378795 3300026041 Bacteria 1270
215 Ga0207678_10002197 3300026067 Bacteria 17621
216 Ga0207678_10107735 3300026067 Bacteria 2377
217 Ga0207708_10001743 3300026075 Bacteria 16065
218 Ga0207641_10113279 3300026088 Bacteria 2408
219 Ga0207641_10616128 3300026088 Bacteria 1064
220 Ga0207648_10027773 3300026089 Bacteria 5021
221 Ga0207648_10285335 3300026089 Bacteria 1477
222 Ga0207676_10045508 3300026095 Bacteria 3391
223 Ga0207676_10313053 3300026095 Bacteria 1438
224 Ga0207674_10036049 3300026116 Bacteria 5159
225 Ga0207674_10036192 3300026116 Bacteria 5146
226 Ga0207674_10043961 3300026116 Bacteria 4604
227 Ga0207675_100010776 3300026118 Bacteria 8566
228 Ga0207675_100166933 3300026118 Bacteria 2102
229 Ga0207683_10031515 3300026121 Bacteria 4601
230 Ga0207683_10426480 3300026121 Bacteria 1222
231 Ga0209179_1001529 3300027512 Bacteria 2863
232 Ga0209813_10000285 3300027866 Bacteria 14139
233 Ga0207428_10028858 3300027907 Bacteria 4605
234 Ga0268265_10004479 3300028380 Bacteria 9679
235 Ga0268264_10007048 3300028381 Bacteria 9426
236 Ga0268264_10259082 3300028381 Bacteria 1619
237 Ga0265332_10004044 3300031238 Bacteria 6969
238 Ga0265332_10016285 3300031238 Bacteria 3280
239 Ga0265325_10000294 3300031241 Bacteria 34895
240 Ga0265325_10009224 3300031241 Bacteria 5771
241 Ga0265325_10049436 3300031241 Bacteria 2170
242 Ga0265340_10011046 3300031247 Bacteria 4813
243 Ga0265339_10010544 3300031249 Bacteria 5735
244 Ga0265313_10007283 3300031595 Bacteria 7595
245 Ga0265342_10000116 3300031712 Bacteria 87805
246 Ga0265342_10006625 3300031712 Bacteria 8598
247 Ga0307406_10292268 3300031901 Bacteria 1248
248 Ga0307412_10248968 3300031911 Bacteria 1379
249 Ga0373938_0027847 3300034957 Bacteria 1191
250 Ga0373926_0023598 3300035083 Bacteria 2137
251 Ga0373940_0051457 3300035088 Bacteria 1158
252 Ga0373944_0009699 3300035089 Unclassified 2615
253 Ga0373932_0009968 3300035112 Bacteria 2293
254 Ga0373936_0015044 3300035113 Bacteria 2963
255 Ga0373953_0026834 3300035117 Bacteria 2209
256 Ga0373956_0016795 3300035119 Bacteria 3077
257 Ga0373960_0002098 3300035121 Bacteria 4486
258 Ga0373943_0000111 3300035170 Bacteria 30271
259 Ga0373943_0125562 3300035170 Bacteria 1368
260 Ga0373946_0005230 3300035171 Bacteria 4678
261 Ga0373946_0133804 3300035171 Bacteria 1143
262 Ga0373955_0016175 3300035172 Bacteria 3668
263 Ga0373931_0002078 3300035691 Bacteria 8814
264 Ga0373931_0143459 3300035691 Bacteria 1386
265 Ga0373931_0250050 3300035691 Bacteria 1078
266 Ga0373935_0028255 3300035692 Bacteria 3467
267 Ga0373935_0075528 3300035692 Bacteria 2180
268 Ga0373927_0000846 3300035695 Bacteria 23349
269 Ga0373927_0003604 3300035695 Bacteria 11045
270 Ga0373927_0121834 3300035695 Bacteria 1702
271 Ga0373947_0000850 3300035725 Bacteria 18418
272 Ga0373947_0037323 3300035725 Bacteria 2883
273 Ga0373947_0087777 3300035725 Bacteria 1935
274 Ga0373937_0002397 3300036401 Bacteria 15600
275 Ga0373925_0020389 3300037068 Bacteria 4825
276 Ga0373925_0107867 3300037068 Bacteria 2148
277 Ga0436365_0687164 3300039437 Bacteria 2770
278 Ga0436361_0941870 3300039447 Bacteria 1887
279 Ga0451833_1460517 3300041491 Bacteria 840
280 Ga0451577_0011452 3300042876 Bacteria 8390
281 Ga0451576_0008411 3300045051 Bacteria 12111
282 Ga0466967_0040034 3300045976 Bacteria 4033
283 Ga0495592_0173201 3300046454 Bacteria 1476
284 Ga0495603_0111720 3300046455 Bacteria 1594
285 Ga0495629_0130480 3300046459 Bacteria 1750
286 Ga0495629_0160994 3300046459 Bacteria 1559
287 Ga0495629_0238221 3300046459 Bacteria 1253
288 Ga0495662_0024918 3300046476 Bacteria 2888
289 Ga0495664_0000251 3300046477 Bacteria 25898
290 Ga0495608_0081817 3300046511 Bacteria 2098
291 Ga0495618_0000361 3300046514 Bacteria 32670
292 Ga0495628_0109121 3300046516 Bacteria 2130
293 Ga0495628_0262113 3300046516 Bacteria 1288
294 Ga0495630_0001646 3300046517 Bacteria 15520
295 Ga0495630_0004982 3300046517 Bacteria 9343
296 Ga0495630_0157599 3300046517 Bacteria 1728
297 Ga0495631_0172449 3300046518 Bacteria 927
298 Ga0495637_0079394 3300046520 Bacteria 1311
299 Ga0495663_0046213 3300046525 Bacteria 1337
300 Ga0495666_0013585 3300046526 Bacteria 4060
301 Ga0495652_0482764 3300046529 Bacteria 862
302 Ga0495665_0005735 3300046531 Bacteria 6702
303 Ga0495665_0124220 3300046531 Bacteria 1351
304 Ga0495640_0033879 3300046533 Bacteria 3627
305 Ga0495586_0010238 3300046535 Bacteria 4987
306 Ga0495598_0052341 3300046537 Bacteria 1233
307 Ga0495621_0053962 3300046539 Bacteria 1444
308 Ga0495645_0004507 3300046543 Bacteria 9504
309 Ga0495656_0020657 3300046615 Bacteria 2556
310 Ga0495668_0041732 3300046616 Bacteria 2555
311 Ga0495634_0006482 3300046642 Bacteria 8889
312 Ga0495634_0008850 3300046642 Bacteria 7467
313 Ga0495625_0438881 3300046660 Bacteria 809
314 Ga0495635_0000460 3300046663 Bacteria 25774
315 Ga0495599_0160585 3300046678 Bacteria 1389
316 Ga0495599_0214633 3300046678 Bacteria 1179
317 Ga0495646_0079116 3300046680 Bacteria 1920
318 Ga0495658_0066455 3300046683 Bacteria 2083
319 Ga0495658_0182266 3300046683 Bacteria 1303
320 Ga0495669_0183764 3300046684 Bacteria 997
321 Ga0495613_0024429 3300046689 Bacteria 4503
322 Ga0495613_0311850 3300046689 Bacteria 1087
323 Ga0495613_0351216 3300046689 Bacteria 1013
324 Ga0495624_0003742 3300046690 Bacteria 11240
325 Ga0495624_0234246 3300046690 Bacteria 1112
326 Ga0495670_0168981 3300046691 Bacteria 1151
327 Ga0495581_0004329 3300047315 Bacteria 8195
328 Ga0495674_0002966 3300047319 Bacteria 16507
329 Ga0495674_0038358 3300047319 Bacteria 4301
330 Ga0495674_0255734 3300047319 Bacteria 1440
331 Ga0495674_0511756 3300047319 Bacteria 959
332 Ga0495676_0114961 3300047321 Bacteria 1968
333 Ga0495680_0177590 3300047322 Bacteria 1539
334 Ga0495677_0107655 3300047445 Bacteria 1058
335 Ga0495684_0001218 3300047471 Bacteria 20671
336 Ga0495684_0009922 3300047471 Bacteria 7351
337 Ga0495684_0012236 3300047471 Bacteria 6619
338 Ga0495686_0102152 3300047472 Bacteria 1728
339 Ga0495593_0006524 3300047673 Bacteria 6837
340 Ga0496100_0004683 3300048903 Bacteria 7291
341 Ga0496100_0200686 3300048903 Bacteria 1453
342 Ga0496100_0322378 3300048903 Bacteria 1161
343 Ga0496101_0017525 3300048904 Bacteria 4857
344 Ga0496101_0342000 3300048904 Bacteria 1175
345 Ga0496102_0009845 3300048905 Bacteria 8219
346 Ga0496102_0168912 3300048905 Bacteria 2059
347 Ga0496103_0016682 3300048906 Bacteria 4386
348 Ga0496103_0053962 3300048906 Bacteria 2491
349 Ga0496104_0005609 3300048907 Bacteria 10986
350 Ga0496104_0014190 3300048907 Bacteria 7189
351 Ga0496104_0097806 3300048907 Bacteria 2809
352 Ga0496105_0026721 3300048908 Bacteria 4711
353 Ga0496105_0035092 3300048908 Bacteria 4127
354 Ga0496105_0110039 3300048908 Bacteria 2274
355 Ga0496106_0003917 3300048909 Bacteria 11114
356 Ga0496106_0004437 3300048909 Bacteria 10401
357 Ga0496107_0005506 3300048910 Bacteria 8665
358 Ga0496107_0017971 3300048910 Bacteria 4975
359 Ga0496107_0123974 3300048910 Bacteria 1904
360 Ga0496107_0154585 3300048910 Bacteria 1698
361 Ga0496108_0006217 3300048911 Bacteria 9669
362 Ga0496108_0022933 3300048911 Bacteria 5136
363 Ga0496108_0233656 3300048911 Bacteria 1599
364 Ga0496109_0021312 3300048912 Bacteria 5729
365 Ga0496109_0052381 3300048912 Bacteria 3719
366 Ga0496109_0083982 3300048912 Bacteria 2937
367 Ga0496109_0514734 3300048912 Bacteria 1129
368 Ga0496110_0004094 3300048913 Bacteria 11256
369 Ga0496110_0005148 3300048913 Bacteria 10218
370 Ga0496110_0066931 3300048913 Bacteria 3177
371 Ga0496110_0083919 3300048913 Bacteria 2843
372 Ga0496110_0169282 3300048913 Bacteria 1982
373 Ga0496111_0018057 3300048914 Bacteria 4880
374 Ga0496111_0068986 3300048914 Bacteria 2570
375 Ga0496112_0003442 3300048915 Bacteria 13072
376 Ga0496112_0026492 3300048915 Bacteria 5579
377 Ga0496112_0093726 3300048915 Bacteria 2973
378 Ga0496112_0132686 3300048915 Bacteria 2461
379 Ga0496113_0163913 3300048916 Bacteria 1758
380 Ga0496114_0013750 3300048917 Bacteria 6488
381 Ga0496114_0026505 3300048917 Bacteria 4746
382 Ga0496114_0082447 3300048917 Bacteria 2718
383 Ga0496115_0056634 3300048918 Bacteria 3151
384 Ga0496115_0066811 3300048918 Bacteria 2906
385 Ga0496115_0067385 3300048918 Bacteria 2895
386 Ga0496115_0233234 3300048918 Bacteria 1517
387 Ga0496119_0000827 3300048922 Bacteria 41250
388 Ga0496122_0001094 3300048925 Bacteria 46993
389 Ga0496123_0001198 3300048926 Bacteria 38067
390 Ga0501031_0377844 3300049568 Bacteria 917
391 Ga0501036_0062573 3300049572 Bacteria 3152
392 Ga0501039_0131435 3300049575 Bacteria 1965
393 Ga0501040_0160709 3300049576 Bacteria 1588
394 Ga0501072_0199224 3300049588 Bacteria 1596
395 Ga0501072_0212174 3300049588 Bacteria 1543
396 Ga0501073_0161366 3300049589 Bacteria 1553
397 Ga0501073_0220212 3300049589 Unclassified 1311
398 Ga0501081_0005738 3300049743 Bacteria 8037
399 Ga0501083_0045832 3300049744 Bacteria 2957
400 Ga0501083_0292551 3300049744 Bacteria 1059
401 Ga0501035_0510479 3300049822 Bacteria 989
402 Ga0501044_0570658 3300049823 Bacteria 1027
403 Ga0501045_0017504 3300049824 Bacteria 5090
404 nmdc:mga03n38_38572_c1 3300050490 Bacteria 2067
405 nmdc:mga00v17_116028_c1 3300050491 Bacteria 1702
406 nmdc:mga00v17_361161_c1 3300050491 Bacteria 944
407 nmdc:mga0yw44_25481_c1 3300050492 Bacteria 3364
408 nmdc:mga0k408_9234_c1 3300050493 Bacteria 5312
409 nmdc:mga06z11_19225_c1 3300050494 Bacteria 3136
410 nmdc:mga06z11_8705_c1 3300050494 Bacteria 4248
411 nmdc:mga04h51_655_c1 3300050495 Bacteria 8077
412 nmdc:mga07m45_95514_c1 3300050496 Bacteria 1705
413 nmdc:mga05p37_716818_c1 3300050507 Bacteria 1108
414 nmdc:mga09592_4517_c1 3300050508 Bacteria 11257
415 nmdc:mga0qj67_234333_c1 3300050509 Bacteria 1489
416 nmdc:mga0qj67_39035_c1 3300050509 Bacteria 3727
417 nmdc:mga0qj67_51002_c1 3300050509 Bacteria 3271
418 nmdc:mga0qj67_59_c1 3300050509 Bacteria 80290
419 nmdc:mga06r32_3551_c1 3300050510 Bacteria 13923
420 nmdc:mga06r32_4015_c1 3300050510 Bacteria 13188
421 nmdc:mga08y16_102967_c1 3300050511 Plasmid 2972
422 nmdc:mga08y16_12693_c1 3300050511 Bacteria 8863
423 nmdc:mga08y16_420967_c1 3300050511 Bacteria 1365
424 nmdc:mga0n895_134660_c1 3300050512 Bacteria 2497
425 nmdc:mga0n895_210523_c1 3300050512 Bacteria 1974
426 nmdc:mga0n895_2794_c1 3300050512 Bacteria 13794
427 nmdc:mga0n895_361703_c1 3300050512 Bacteria 1469
428 nmdc:mga0n895_52730_c1 3300050512 Bacteria 3993
429 nmdc:mga0rr50_68052_c1 3300050513 Bacteria 2707
430 nmdc:mga0a205_961_c1 3300050515 Bacteria 23815
431 Ga0495601_0018648 3300053077 Bacteria 4224
432 Ga0495601_0032684 3300053077 Bacteria 3240
433 Ga0495601_0084789 3300053077 Bacteria 2035
434 Ga0495612_0000102 3300053078 Bacteria 36423
435 Ga0495655_0023335 3300053083 Bacteria 1425
436 Ga0495619_0026770 3300053085 Bacteria 3712
437 Ga0495619_0125900 3300053085 Bacteria 1758
438 Ga0495619_0138157 3300053085 Bacteria 1677
439 Ga0495619_0238926 3300053085 Unclassified 1259
440 Ga0500556_0000124 3300053104 Bacteria 67080
441 Ga0500622_0129467 3300053156 Bacteria 1215
442 Ga0500645_001678 3300053730 Bacteria 10851
443 Ga0500645_024630 3300053730 Bacteria 1839
444 Ga0501084_0104275 3300054114 Bacteria 2382
445 Ga0501084_0181372 3300054114 Bacteria 1777
446 Ga0501082_0000170 3300060353 Bacteria 56096
447 Ga0501082_0004017 3300060353 Bacteria 12838
448 Ga0530510_0041964 3300061734 Bacteria 3304
449 2643754581 2643221547 Bacteria 4740017
450 Ga0157380_10253175
451 JGI24743J22301_10044172
452 JGI24033J26618_1008716
453 JGI24034J26672_10004400
454 JGI24751J29686_10015050
455 Ga0055531_10008530
456 Ga0065712_10185826
457 Ga0070658_10305024
458 Ga0070670_100076567
459 Ga0070670_100259490
460 Ga0068869_100060795
461 Ga0068869_100082940
462 Ga0070666_10225717
463 Ga0070680_100035194
464 Ga0070682_100113658
465 Ga0068868_100055644
466 Ga0070660_100125402
467 Ga0070689_100046494
468 Ga0070689_100092408
469 Ga0070689_100407579
470 Ga0070668_100190866
471 Ga0070675_100040825
472 Ga0070675_100395470
473 Ga0070671_100083692
474 Ga0070671_100353526
475 Ga0070674_100307763
476 Ga0070674_100563630
477 Ga0070673_100520925
478 Ga0070688_100009549
479 Ga0070688_100014350
480 Ga0070667_100052973
481 Ga0070703_10002576
482 Ga0070701_10179063
483 Ga0070711_100027762
484 Ga0070711_100037885
485 Ga0070705_100000687
486 Ga0070700_100000805
487 Ga0070694_100000380
488 Ga0070708_100006255
489 Ga0070663_100013529
490 Ga0070662_100049781
491 Ga0070681_10590418
492 Ga0068867_100083693
493 Ga0070685_10036704
494 Ga0070685_10042229
495 Ga0070685_10049729
496 Ga0070706_100707325
497 Ga0070699_100001676
498 Ga0070679_100116480
499 Ga0070679_100247027
500 Ga0070697_100026956
501 Ga0070697_100079088
502 Ga0070672_100303597
503 Ga0070686_100026152
504 Ga0070686_100292928
505 Ga0070696_100000968
506 Ga0070693_100010855
507 Ga0070693_100156198
508 Ga0070704_100003987
509 Ga0070704_100034067
510 Ga0070664_100036935
511 Ga0068857_100025978
512 Ga0068854_100289428
513 Ga0068856_100066305
514 Ga0068856_100100171
515 Ga0070702_100007251
516 Ga0070702_100024669
517 Ga0068859_100002996
518 Ga0068859_100023700
519 Ga0068864_100005603
520 Ga0068864_100063192
521 Ga0068864_100533895
522 Ga0068866_10224891
523 Ga0068861_100126925
524 Ga0068851_10056624
525 Ga0068870_10012992
526 Ga0068863_100095417
527 Ga0068858_100075410
528 Ga0068858_100152086
529 Ga0068860_100005664
530 Ga0068860_100282412
531 Ga0068860_100674385
532 Ga0068862_100002411
533 Ga0068862_100043360
534 Ga0068862_100146410
535 Ga0081455_10008807
536 Ga0081455_10068629
537 Ga0081540_1037386
538 Ga0081539_10000118
539 Ga0081539_10002228
540 Ga0070717_10142816
541 Ga0075365_10077102
542 Ga0075365_10238411
543 Ga0075368_10001704
544 Ga0075368_10183593
545 Ga0075363_100025528
546 Ga0075363_100139150
547 Ga0075364_10272686
548 Ga0075364_10450840
549 Ga0075364_10479576
550 Ga0070712_100001927
551 Ga0070712_100008082
552 Ga0070712_100535316
553 Ga0075362_10003501
554 Ga0075362_10076984
555 Ga0075362_10186605
556 Ga0075367_10004092
557 Ga0075367_10124194
558 Ga0075366_10003158
559 Ga0097621_100116561
560 Ga0097621_100120633
561 Ga0068871_100213143
562 Ga0068871_100601377
563 Ga0075430_100000152
564 Ga0075431_100000874
565 Ga0075431_100001126
566 Ga0075433_10008785
567 Ga0075433_10022540
568 Ga0075434_100003531
569 Ga0075434_100040543
570 Ga0075429_100044920
571 Ga0097620_100002996
572 Ga0097620_100023700
573 Ga0075435_100078117
574 Ga0099795_10001049
575 Ga0099795_10046335
576 Ga0099795_10068586
577 Ga0105251_10168816
578 Ga0105250_10024689
579 Ga0111539_10018444
580 Ga0111539_10095258
581 Ga0111539_10161451
582 Ga0105245_10047205
583 Ga0105245_10272310
584 Ga0105247_10018273
585 Ga0105247_10032755
586 Ga0105247_10122905
587 Ga0114129_10628141
588 Ga0105243_10280192
589 Ga0105241_10224749
590 Ga0105237_10224570
591 Ga0105237_10891078
592 Ga0105238_10007744
593 Ga0105238_10336165
594 Ga0105249_10020221
595 Ga0105249_10148166
596 Ga0105249_10490218
597 Ga0099796_10001304
598 Ga0099796_10027394
599 Ga0105239_10610881
600 Ga0105246_10635856
601 Ga0157371_10290865
602 Ga0157374_10057114
603 Ga0157378_10251806
604 Ga0157372_10925935
605 Ga0157375_10249018
606 Ga0163163_10194694
607 Ga0157379_10278571
608 Ga0157379_10594718
609 Ga0157376_10062562
610 Ga0209233_1006839
611 Ga0209455_1000956
612 Ga0209758_1000223
613 Ga0209758_1024372
614 Ga0209050_1004929
615 Ga0209051_1022428
616 Ga0209257_1000311
617 Ga0207653_10005154
618 Ga0207710_10068697
619 Ga0207688_10002291
620 Ga0207688_10089327
621 Ga0207645_10031887
622 Ga0207643_10005254
623 Ga0207707_10019396
624 Ga0207693_10000484
625 Ga0207693_10008900
626 Ga0207693_10036286
627 Ga0207693_10076718
628 Ga0207693_10241404
629 Ga0207660_10001088
630 Ga0207662_10003397
631 Ga0207662_10022617
632 Ga0207662_10128542
633 Ga0207662_10364975
634 Ga0207646_10598372
635 Ga0207681_10489303
636 Ga0207659_10028336
637 Ga0207659_10142394
638 Ga0207659_10506597
639 Ga0207687_10407032
640 Ga0207700_10013231
641 Ga0207700_10130761
642 Ga0207700_10304082
643 Ga0207700_10547464
644 Ga0207700_10648244
645 Ga0207644_10041302
646 Ga0207690_10144666
647 Ga0207706_10073321
648 Ga0207686_10251341
649 Ga0207686_10459436
650 Ga0207704_10390238
651 Ga0207691_10015850
652 Ga0207691_10150527
653 Ga0207689_10009830
654 Ga0207689_10079894
655 Ga0207651_10012170
656 Ga0207712_10010596
657 Ga0207712_10142970
658 Ga0207712_10354191
659 Ga0207668_10161182
660 Ga0207640_10057722
661 Ga0207658_10040442
662 Ga0207703_10033525
663 Ga0207639_10378795
664 Ga0207678_10002197
665 Ga0207678_10107735
666 Ga0207708_10001743
667 Ga0207641_10113279
668 Ga0207641_10616128
669 Ga0207648_10027773
670 Ga0207648_10285335
671 Ga0207676_10045508
672 Ga0207676_10313053
673 Ga0207674_10036049
674 Ga0207674_10036192
675 Ga0207674_10043961
676 Ga0207675_100010776
677 Ga0207675_100166933
678 Ga0207683_10031515
679 Ga0207683_10426480
680 Ga0209179_1001529
681 Ga0209813_10000285
682 Ga0207428_10028858
683 Ga0268265_10004479
684 Ga0268264_10007048
685 Ga0268264_10259082
686 Ga0265332_10004044
687 Ga0265332_10016285
688 Ga0265325_10000294
689 Ga0265325_10009224
690 Ga0265325_10049436
691 Ga0265340_10011046
692 Ga0265339_10010544
693 Ga0265313_10007283
694 Ga0265342_10000116
695 Ga0265342_10006625
696 Ga0307406_10292268
697 Ga0307412_10248968
698 Ga0373938_0027847
699 Ga0373926_0023598
700 Ga0373940_0051457
701 Ga0373944_0009699
702 Ga0373932_0009968
703 Ga0373936_0015044
704 Ga0373953_0026834
705 Ga0373956_0016795
706 Ga0373960_0002098
707 Ga0373943_0000111
708 Ga0373943_0125562
709 Ga0373946_0005230
710 Ga0373946_0133804
711 Ga0373955_0016175
712 Ga0373931_0002078
713 Ga0373931_0143459
714 Ga0373931_0250050
715 Ga0373935_0028255
716 Ga0373935_0075528
717 Ga0373927_0000846
718 Ga0373927_0003604
719 Ga0373927_0121834
720 Ga0373947_0000850
721 Ga0373947_0037323
722 Ga0373947_0087777
723 Ga0373937_0002397
724 Ga0373925_0020389
725 Ga0373925_0107867
726 Ga0436365_0687164
727 Ga0436361_0941870
728 Ga0451833_1460517
729 Ga0451577_0011452
730 Ga0451576_0008411
731 Ga0466967_0040034
732 Ga0495592_0173201
733 Ga0495603_0111720
734 Ga0495629_0130480
735 Ga0495629_0160994
736 Ga0495629_0238221
737 Ga0495662_0024918
738 Ga0495664_0000251
739 Ga0495608_0081817
740 Ga0495618_0000361
741 Ga0495628_0109121
742 Ga0495628_0262113
743 Ga0495630_0001646
744 Ga0495630_0004982
745 Ga0495630_0157599
746 Ga0495631_0172449
747 Ga0495637_0079394
748 Ga0495663_0046213
749 Ga0495666_0013585
750 Ga0495652_0482764
751 Ga0495665_0005735
752 Ga0495665_0124220
753 Ga0495640_0033879
754 Ga0495586_0010238
755 Ga0495598_0052341
756 Ga0495621_0053962
757 Ga0495645_0004507
758 Ga0495656_0020657
759 Ga0495668_0041732
760 Ga0495634_0006482
761 Ga0495634_0008850
762 Ga0495625_0438881
763 Ga0495635_0000460
764 Ga0495599_0160585
765 Ga0495599_0214633
766 Ga0495646_0079116
767 Ga0495658_0066455
768 Ga0495658_0182266
769 Ga0495669_0183764
770 Ga0495613_0024429
771 Ga0495613_0311850
772 Ga0495613_0351216
773 Ga0495624_0003742
774 Ga0495624_0234246
775 Ga0495670_0168981
776 Ga0495581_0004329
777 Ga0495674_0002966
778 Ga0495674_0038358
779 Ga0495674_0255734
780 Ga0495674_0511756
781 Ga0495676_0114961
782 Ga0495680_0177590
783 Ga0495677_0107655
784 Ga0495684_0001218
785 Ga0495684_0009922
786 Ga0495684_0012236
787 Ga0495686_0102152
788 Ga0495593_0006524
789 Ga0496100_0004683
790 Ga0496100_0200686
791 Ga0496100_0322378
792 Ga0496101_0017525
793 Ga0496101_0342000
794 Ga0496102_0009845
795 Ga0496102_0168912
796 Ga0496103_0016682
797 Ga0496103_0053962
798 Ga0496104_0005609
799 Ga0496104_0014190
800 Ga0496104_0097806
801 Ga0496105_0026721
802 Ga0496105_0035092
803 Ga0496105_0110039
804 Ga0496106_0003917
805 Ga0496106_0004437
806 Ga0496107_0005506
807 Ga0496107_0017971
808 Ga0496107_0123974
809 Ga0496107_0154585
810 Ga0496108_0006217
811 Ga0496108_0022933
812 Ga0496108_0233656
813 Ga0496109_0021312
814 Ga0496109_0052381
815 Ga0496109_0083982
816 Ga0496109_0514734
817 Ga0496110_0004094
818 Ga0496110_0005148
819 Ga0496110_0066931
820 Ga0496110_0083919
821 Ga0496110_0169282
822 Ga0496111_0018057
823 Ga0496111_0068986
824 Ga0496112_0003442
825 Ga0496112_0026492
826 Ga0496112_0093726
827 Ga0496112_0132686
828 Ga0496113_0163913
829 Ga0496114_0013750
830 Ga0496114_0026505
831 Ga0496114_0082447
832 Ga0496115_0056634
833 Ga0496115_0066811
834 Ga0496115_0067385
835 Ga0496115_0233234
836 Ga0496119_0000827
837 Ga0496122_0001094
838 Ga0496123_0001198
839 Ga0501031_0377844
840 Ga0501036_0062573
841 Ga0501039_0131435
842 Ga0501040_0160709
843 Ga0501072_0199224
844 Ga0501072_0212174
845 Ga0501073_0161366
846 Ga0501073_0220212
847 Ga0501081_0005738
848 Ga0501083_0045832
849 Ga0501083_0292551
850 Ga0501035_0510479
851 Ga0501044_0570658
852 Ga0501045_0017504
853 nmdc:mga03n38_38572_c1
854 nmdc:mga00v17_116028_c1
855 nmdc:mga00v17_361161_c1
856 nmdc:mga0yw44_25481_c1
857 nmdc:mga0k408_9234_c1
858 nmdc:mga06z11_19225_c1
859 nmdc:mga06z11_8705_c1
860 nmdc:mga04h51_655_c1
861 nmdc:mga07m45_95514_c1
862 nmdc:mga05p37_716818_c1
863 nmdc:mga09592_4517_c1
864 nmdc:mga0qj67_234333_c1
865 nmdc:mga0qj67_39035_c1
866 nmdc:mga0qj67_51002_c1
867 nmdc:mga0qj67_59_c1
868 nmdc:mga06r32_3551_c1
869 nmdc:mga06r32_4015_c1
870 nmdc:mga08y16_102967_c1
871 nmdc:mga08y16_12693_c1
872 nmdc:mga08y16_420967_c1
873 nmdc:mga0n895_134660_c1
874 nmdc:mga0n895_210523_c1
875 nmdc:mga0n895_2794_c1
876 nmdc:mga0n895_361703_c1
877 nmdc:mga0n895_52730_c1
878 nmdc:mga0rr50_68052_c1
879 nmdc:mga0a205_961_c1
880 Ga0495601_0018648
881 Ga0495601_0032684
882 Ga0495601_0084789
883 Ga0495612_0000102
884 Ga0495655_0023335
885 Ga0495619_0026770
886 Ga0495619_0125900
887 Ga0495619_0138157
888 Ga0495619_0238926
889 Ga0500556_0000124
890 Ga0500622_0129467
891 Ga0500645_001678
892 Ga0500645_024630
893 Ga0501084_0104275
894 Ga0501084_0181372
895 Ga0501082_0000170
896 Ga0501082_0004017
897 Ga0530510_0041964
898 2643754581

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

118

264

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.9108 112 260
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.8823 110 245
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.8804 106 258
3hc2-assembly1.cif.gz_A-2 crystal structure of chicken sulfite oxidase mutant tyr 322 phe 0.8775 109 256
2a99-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8735 109 251
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9196 112 260 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9101 108 251 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8967 109 251 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8824 110 245 3.90.420.10
2biiB01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8548 101 251 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A1Q5QVM3-F1-model_v4 Molybdopterin-binding protein 0.9582 117 262
AF-A0A537TEQ0-F1-model_v4 Molybdopterin-binding protein 0.9538 82 262
AF-A0A380AE90-F1-model_v4 Sulfoxide reductase catalytic subunit yedY (EC 1.8.-.-) 0.9512 87 262 GO:0016491
AF-A0A1Q5QVM3-F1-model_v4 Molybdopterin-binding protein 0.9456 117 262
AF-A0A833FW84-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9438 140 262

Map